The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
124
|
sequence length |
356
|
structure length |
348
|
Chain Sequence |
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKRTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSMQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANEEKLEEVAGKYNLQVRGTGGIYDISNKRRMGLTEFQAVKEMEDGILELIKIEKEM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of Shrimp Arginine Kinase in Binary Complex with Arginine-A Molecular View of the Phosphagen Precursor Binding to the Enzyme.
pubmed doi rcsb |
molecule tags |
Transferase
|
molecule keywords |
ARGININE KINASE
|
total genus |
124
|
structure length |
348
|
sequence length |
356
|
ec nomenclature |
ec
2.7.3.3: Arginine kinase. |
pdb deposition date | 2013-04-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00217 | ATP-gua_Ptrans | ATP:guanido phosphotransferase, C-terminal catalytic domain |
A | PF02807 | ATP-gua_PtransN | ATP:guanido phosphotransferase, N-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transferase Creatine Kinase; Chain A, domain 1 | ATP:guanido phosphotransferase, N-terminal domain | ||
Alpha Beta | 2-Layer Sandwich | Creatine Kinase; Chain A, domain 2 | Glutamine synthetase/guanido kinase, catalytic domain |
#chains in the Genus database with same CATH superfamily 3JQ3 A; 4BG4 A; 1M15 A; 4GW2 A; 4HPP A; 4XYC A; 3M10 A; 1U6R A; 3L2E B; 5J99 A; 1F52 A; 4LNF A; 1G0W A; 1QK1 A; 3DRE A; 2BVC A; 1I0E A; 3L2D A; 1FPY A; 2CRK A; 1QH4 A; 4BG4 B; 4LNK A; 3JU6 A; 1HTO A; 4BHL A; 1BG0 A; 4RF7 A; 1LGR A; 3NG0 A; 4LNI A; 1RL9 A; 2J1Q A; 2LGS A; 4GW0 A; 4S17 A; 4RF6 A; 1SD0 A; 1HTQ A; 4Z9M A; 4RF8 A; 4GVY A; 4S0R A; 3B6R A; 1CRK A; 3ZXV A; 4GVZ A; 3JPZ A; 1P50 A; 4RF9 A; 2GLS A; 1VRP A; 4LNO A; 1P52 A; 3ZXR A; 3JU5 A; 3L2E A; 2WGS A; 4Q2R A; 4AM1 A; 5J9A A; 2WHI A; 4ACF A; 1F1H A; 3DRB A; 4LNN A; #chains in the Genus database with same CATH topology 3JQ3 A; 4GW2 A; 3M10 A; 1VA6 A; 4LNF A; 1QH4 A; 1HTO A; 1BG0 A; 1LGR A; 2D3A A; 4GW0 A; 4S17 A; 4RF6 A; 1CRK A; 4LNO A; 2GWD A; 3JU5 A; 4AM1 A; 2D3B A; 1F1H A; 1P50 A; 3LN6 A; 2D33 A; 4XYC A; 1U6R A; 5J99 A; 3LN7 A; 1G0W A; 1I0E A; 2CRK A; 3IG8 A; 3JU6 A; 4RF7 A; 2J1Q A; 2LGS A; 1SD0 A; 4Z9M A; 3LVV A; 4GVY A; 2D3C A; 3B6R A; 4RF9 A; 1VRP A; 3FKY A; 3ZXR A; 2WGS A; 3L2E A; 2WHI A; 2OJW A; 3DRB A; 1M15 A; 4HPP A; 3L2E B; 1F52 A; 1R8G A; 3L2D A; 1FPY A; 4BHL A; 4LNI A; 2GWC A; 4GVZ A; 2GLS A; 1P52 A; 2UU7 A; 5J9A A; 4BAX A; 4ACF A; 4LNN A; 4BG4 A; 1QK1 A; 3DRE A; 2BVC A; 4LNK A; 4BG4 B; 3NZT A; 1TT4 A; 3NG0 A; 1RL9 A; 2D32 A; 2QC8 A; 1HTQ A; 4RF8 A; 4S0R A; 3ZXV A; 3JPZ A; 3IG5 A; 4Q2R A; 1V4G A; 3LVW A; #chains in the Genus database with same CATH homology 3JQ3 A; 4BG4 A; 1M15 A; 4GW2 A; 4HPP A; 4XYC A; 3M10 A; 1U6R A; 3L2E B; 5J99 A; 1F52 A; 4LNF A; 1G0W A; 1QK1 A; 3DRE A; 2BVC A; 1I0E A; 3L2D A; 1FPY A; 2CRK A; 1QH4 A; 4BG4 B; 4LNK A; 3JU6 A; 1HTO A; 4BHL A; 1BG0 A; 4RF7 A; 1LGR A; 3NG0 A; 4LNI A; 1RL9 A; 2J1Q A; 2LGS A; 4GW0 A; 4S17 A; 4RF6 A; 1SD0 A; 1HTQ A; 4Z9M A; 4RF8 A; 4GVY A; 4S0R A; 3B6R A; 1CRK A; 3ZXV A; 4GVZ A; 3JPZ A; 1P50 A; 4RF9 A; 2GLS A; 1VRP A; 4LNO A; 1P52 A; 3ZXR A; 3JU5 A; 3L2E A; 2WGS A; 4Q2R A; 4AM1 A; 5J9A A; 2WHI A; 4ACF A; 1F1H A; 3DRB A; 4LNN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...