1AUZA

Solution structure of spoiiaa, a phosphorylatable component of the system that regulates transcription factor sigma-f of bacillus subtilis, nmr, 24 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
116
structure length
116
Chain Sequence
SLGIDMNVKESVLCIRLTGELDHHTAETLKQKVTQSLEKDDIRHIVLNLEDLSFMDSSGLGVILGRYKQIKQIGGEMVVCAISPAVKRLFDMSGLFKIIRFEQSEQQALLTLGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPOIIAA
publication title Solution structure of SpoIIAA, a phosphorylatable component of the system that regulates transcription factor sigmaF of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
total genus 19
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1997-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1auzA00
1TIDB 5EUZA 3AGDA 1TILB 1T6RA 3MGLA 5EUUA 3IF5A 1H4ZA 5EZBA 3OIZA 3NY7A 2KLNA 1TH8B 1H4XA 4QTPA 3ZTBA 2KA5A 4XS5A 3IH9A 1SBOA 1AUZA 5EUSA 3IHAA 3IH8A 5EUWA 1BUZA 4DGFA 4DGHA 3T6OA 3AGEA 3LLOA 1VC1A 3LKLA 3OIRA 1H4YA 3IHBA 4HYLA 3F43A 1THNB 3ZXNA 2VY9A 5EUXA
chains in the Genus database with same CATH superfamily
1TIDB 3D03A 5EUZA 1TILB 1T6RA 2DXLA 3IF5A 5EUUA 3V8VA 1WXXA 3GK7A 1N6DA 3DORA 3IH9A 1SBOA 5EUSA 3IHAA 2AS0A 3C0KA 3LLOA 3OIRA 3IHBA 4HYLA 4AEJA 3GMFA 2VY9A 3EH7A 2ZO9B 3MGLA 4AE2A 5EZBA 3OIZA 3K50A 1TH8B 3ZTBA 4XS5A 1FC6A 4L8KA 4DGHA 3T6OA 1H4YA 1FC9A 1THNB 3ZXNA 1V0FA 2ZOAA 3QDQA 1N6FA 3MOGA 1FC7A 1H4ZA 3V97A 4HIZA 2RRLA 3NY7A 1H4XA 4QTPA 4GHNA 1AUZA 1BPLA 3DJAA 5EUWA 2DXNA 4DGFA 2B78A 1J7XA 1VC1A 3F43A 1K32A 5EUXA 3D3UA 3GVKA 1N6EA 4JC0A 3AGDA 3JU4A 1WXWA 3GVLA 3LDFA 1FCFA 2OASA 4L1CA 2KLNA 3GVJA 3GHFA 2KA5A 3IH8A 3VSEA 1BUZA 3DUPA 3AGEA 2CWWA 1V0EA 3LKLA 1HF2A 4DMGA
chains in the Genus database with same CATH topology
1TIDB 5EUZA 3AGDA 1TILB 1T6RA 3MGLA 5EUUA 3IF5A 1H4ZA 5EZBA 3OIZA 3NY7A 2KLNA 1TH8B 1H4XA 4QTPA 3ZTBA 2KA5A 4XS5A 3IH9A 1SBOA 1AUZA 5EUSA 3IHAA 3IH8A 5EUWA 1BUZA 4DGFA 4DGHA 3T6OA 3AGEA 3LLOA 1VC1A 3LKLA 3OIRA 1H4YA 3IHBA 4HYLA 3F43A 1THNB 3ZXNA 2VY9A 5EUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TID B;  5EUZ A;  3AGD A;  1TIL B;  1T6R A;  3MGL A;  5EUU A;  3IF5 A;  1H4Z A;  5EZB A;  3OIZ A;  3NY7 A;  2KLN A;  1TH8 B;  1H4X A;  4QTP A;  3ZTB A;  2KA5 A;  4XS5 A;  3IH9 A;  1SBO A;  1AUZ A;  5EUS A;  3IHA A;  3IH8 A;  5EUW A;  1BUZ A;  4DGF A;  4DGH A;  3T6O A;  3AGE A;  3LLO A;  1VC1 A;  3LKL A;  3OIR A;  1H4Y A;  3IHB A;  4HYL A;  3F43 A;  1THN B;  3ZXN A;  2VY9 A;  5EUX A; 
#chains in the Genus database with same CATH topology
 1TID B;  3D03 A;  5EUZ A;  1TIL B;  1T6R A;  2DXL A;  3IF5 A;  5EUU A;  3V8V A;  1WXX A;  3GK7 A;  1N6D A;  3DOR A;  3IH9 A;  1SBO A;  5EUS A;  3IHA A;  2AS0 A;  3C0K A;  3LLO A;  3OIR A;  3IHB A;  4HYL A;  4AEJ A;  3GMF A;  2VY9 A;  3EH7 A;  2ZO9 B;  3MGL A;  4AE2 A;  5EZB A;  3OIZ A;  3K50 A;  1TH8 B;  3ZTB A;  4XS5 A;  1FC6 A;  4L8K A;  4DGH A;  3T6O A;  1H4Y A;  1FC9 A;  1THN B;  3ZXN A;  1V0F A;  2ZOA A;  3QDQ A;  1N6F A;  3MOG A;  1FC7 A;  1H4Z A;  3V97 A;  4HIZ A;  2RRL A;  3NY7 A;  1H4X A;  4QTP A;  4GHN A;  1AUZ A;  1BPL A;  3DJA A;  5EUW A;  2DXN A;  4DGF A;  2B78 A;  1J7X A;  1VC1 A;  3F43 A;  1K32 A;  5EUX A;  3D3U A;  3GVK A;  1N6E A;  4JC0 A;  3AGD A;  3JU4 A;  1WXW A;  3GVL A;  3LDF A;  1FCF A;  2OAS A;  4L1C A;  2KLN A;  3GVJ A;  3GHF A;  2KA5 A;  3IH8 A;  3VSE A;  1BUZ A;  3DUP A;  3AGE A;  2CWW A;  1V0E A;  3LKL A;  1HF2 A;  4DMG A; 
#chains in the Genus database with same CATH homology
 1TID B;  5EUZ A;  3AGD A;  1TIL B;  1T6R A;  3MGL A;  5EUU A;  3IF5 A;  1H4Z A;  5EZB A;  3OIZ A;  3NY7 A;  2KLN A;  1TH8 B;  1H4X A;  4QTP A;  3ZTB A;  2KA5 A;  4XS5 A;  3IH9 A;  1SBO A;  1AUZ A;  5EUS A;  3IHA A;  3IH8 A;  5EUW A;  1BUZ A;  4DGF A;  4DGH A;  3T6O A;  3AGE A;  3LLO A;  1VC1 A;  3LKL A;  3OIR A;  1H4Y A;  3IHB A;  4HYL A;  3F43 A;  1THN B;  3ZXN A;  2VY9 A;  5EUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...