1AUZA

Solution structure of spoiiaa, a phosphorylatable component of the system that regulates transcription factor sigma-f of bacillus subtilis, nmr, 24 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
116
structure length
116
Chain Sequence
SLGIDMNVKESVLCIRLTGELDHHTAETLKQKVTQSLEKDDIRHIVLNLEDLSFMDSSGLGVILGRYKQIKQIGGEMVVCAISPAVKRLFDMSGLFKIIRFEQSEQQALLTLGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords SPOIIAA
publication title Solution structure of SpoIIAA, a phosphorylatable component of the system that regulates transcription factor sigmaF of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 19
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1997-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1auzA00
3LKLA 1H4ZA 1TH8B 3LLOA 5EZBA 4HYLA 3OIRA 1AUZA 3ZXNA 5EUXA 5EUZA 3F43A 2KA5A 5EUSA 3AGDA 5EUWA 3T6OA 4QTPA 4DGFA 1TIDB 3AGEA 3NY7A 1T6RA 3IH8A 5EUUA 3IHBA 2KLNA 3IH9A 3IF5A 1BUZA 3OIZA 3IHAA 4DGHA 1THNB 3ZTBA 3MGLA 2VY9A 1H4XA 1TILB 1VC1A 1H4YA 4XS5A 1SBOA
chains in the Genus database with same CATH superfamily
3LKLA 1TH8B 4L8KA 3OIRA 1AUZA 4AEJA 4L1CA 3F43A 3GHFA 3GVKA 5EUSA 2ZOAA 3NY7A 3GVLA 1V0FA 3IF5A 2RRLA 3V97A 3QDQA 3DJAA 2ZO9B 3GK7A 2VY9A 1VC1A 1H4ZA 1FC7A 3LLOA 3C0KA 3ZXNA 3D03A 1WXXA 1BPLA 1V0EA 1TIDB 3AGEA 3DUPA 1J7XA 3MOGA 2KLNA 3EH7A 3IH9A 3OIZA 1BUZA 4DGHA 4AE2A 3ZTBA 2DXLA 3MGLA 1H4XA 1TILB 4DMGA 4XS5A 3V8VA 3VSEA 1WXWA 1N6FA 4GHNA 2DXNA 2AS0A 5EUWA 3T6OA 3JU4A 4DGFA 3DORA 1T6RA 3GMFA 5EUUA 3LDFA 1THNB 1K32A 1H4YA 1SBOA 5EZBA 1HF2A 4JC0A 4HYLA 1N6DA 5EUXA 5EUZA 2KA5A 3AGDA 2CWWA 1N6EA 2OASA 1FCFA 4QTPA 3D3UA 3IH8A 3IHBA 4HIZA 1FC9A 3IHAA 3GVJA 3K50A 1FC6A 2B78A
chains in the Genus database with same CATH topology
3LKLA 1H4ZA 1TH8B 3LLOA 5EZBA 4HYLA 3OIRA 1AUZA 3ZXNA 5EUXA 5EUZA 3F43A 2KA5A 5EUSA 3AGDA 5EUWA 3T6OA 4QTPA 4DGFA 1TIDB 3AGEA 3NY7A 1T6RA 3IH8A 5EUUA 3IHBA 2KLNA 3IH9A 3IF5A 1BUZA 3OIZA 3IHAA 4DGHA 1THNB 3ZTBA 3MGLA 2VY9A 1H4XA 1TILB 1VC1A 1H4YA 4XS5A 1SBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKL A;  1H4Z A;  1TH8 B;  3LLO A;  5EZB A;  4HYL A;  3OIR A;  1AUZ A;  3ZXN A;  5EUX A;  5EUZ A;  3F43 A;  2KA5 A;  5EUS A;  3AGD A;  5EUW A;  3T6O A;  4QTP A;  4DGF A;  1TID B;  3AGE A;  3NY7 A;  1T6R A;  3IH8 A;  5EUU A;  3IHB A;  2KLN A;  3IH9 A;  3IF5 A;  1BUZ A;  3OIZ A;  3IHA A;  4DGH A;  1THN B;  3ZTB A;  3MGL A;  2VY9 A;  1H4X A;  1TIL B;  1VC1 A;  1H4Y A;  4XS5 A;  1SBO A; 
#chains in the Genus database with same CATH topology
 3LKL A;  1TH8 B;  4L8K A;  3OIR A;  1AUZ A;  4AEJ A;  4L1C A;  3F43 A;  3GHF A;  3GVK A;  5EUS A;  2ZOA A;  3NY7 A;  3GVL A;  1V0F A;  3IF5 A;  2RRL A;  3V97 A;  3QDQ A;  3DJA A;  2ZO9 B;  3GK7 A;  2VY9 A;  1VC1 A;  1H4Z A;  1FC7 A;  3LLO A;  3C0K A;  3ZXN A;  3D03 A;  1WXX A;  1BPL A;  1V0E A;  1TID B;  3AGE A;  3DUP A;  1J7X A;  3MOG A;  2KLN A;  3EH7 A;  3IH9 A;  3OIZ A;  1BUZ A;  4DGH A;  4AE2 A;  3ZTB A;  2DXL A;  3MGL A;  1H4X A;  1TIL B;  4DMG A;  4XS5 A;  3V8V A;  3VSE A;  1WXW A;  1N6F A;  4GHN A;  2DXN A;  2AS0 A;  5EUW A;  3T6O A;  3JU4 A;  4DGF A;  3DOR A;  1T6R A;  3GMF A;  5EUU A;  3LDF A;  1THN B;  1K32 A;  1H4Y A;  1SBO A;  5EZB A;  1HF2 A;  4JC0 A;  4HYL A;  1N6D A;  5EUX A;  5EUZ A;  2KA5 A;  3AGD A;  2CWW A;  1N6E A;  2OAS A;  1FCF A;  4QTP A;  3D3U A;  3IH8 A;  3IHB A;  4HIZ A;  1FC9 A;  3IHA A;  3GVJ A;  3K50 A;  1FC6 A;  2B78 A; 
#chains in the Genus database with same CATH homology
 3LKL A;  1H4Z A;  1TH8 B;  3LLO A;  5EZB A;  4HYL A;  3OIR A;  1AUZ A;  3ZXN A;  5EUX A;  5EUZ A;  3F43 A;  2KA5 A;  5EUS A;  3AGD A;  5EUW A;  3T6O A;  4QTP A;  4DGF A;  1TID B;  3AGE A;  3NY7 A;  1T6R A;  3IH8 A;  5EUU A;  3IHB A;  2KLN A;  3IH9 A;  3IF5 A;  1BUZ A;  3OIZ A;  3IHA A;  4DGH A;  1THN B;  3ZTB A;  3MGL A;  2VY9 A;  1H4X A;  1TIL B;  1VC1 A;  1H4Y A;  4XS5 A;  1SBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...