5EUWA

Rat prestin stas domain in complex with nitrate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
129
Chain Sequence
SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYNIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prestin,Prestin
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 41
structure length 129
sequence length 143
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5euwA00
1H4ZA 3OIZA 3ZTBA 3MGLA 3OIRA 3NY7A 4QTPA 4DGHA 1TILB 5EZBA 4XS5A 5EUSA 3IHBA 5EUXA 3LKLA 1TIDB 3IH9A 3F43A 5EUWA 1AUZA 4HYLA 1SBOA 5EUZA 3ZXNA 4DGFA 3IF5A 3T6OA 3LLOA 1THNB 1BUZA 1H4YA 1H4XA 5EUUA 2KLNA 3AGDA 2KA5A 3IH8A 1VC1A 3AGEA 3IHAA 1TH8B 1T6RA 2VY9A
chains in the Genus database with same CATH superfamily
3OIZA 3D3UA 4DMGA 2ZOAA 4L8KA 4XS5A 5EUSA 3DJAA 3LDFA 5EUXA 3LKLA 1FC7A 4AEJA 1SBOA 1J7XA 3LLOA 1THNB 1FC6A 5EUUA 4AE2A 3IH8A 4GHNA 3K50A 1TH8B 3GK7A 3MOGA 3VSEA 3C0KA 3GVKA 3MGLA 3OIRA 3NY7A 1TILB 5EZBA 2B78A 2RRLA 3F43A 1N6FA 1BPLA 1N6EA 3ZXNA 3T6OA 3GHFA 3DORA 2KLNA 3AGDA 1WXWA 2KA5A 4L1CA 4HIZA 3JU4A 2DXNA 1K32A 1VC1A 3EH7A 3IHAA 2VY9A 2OASA 1H4ZA 2ZO9B 1HF2A 2CWWA 4DGHA 3QDQA 3IH9A 1N6DA 5EUWA 1AUZA 5EUZA 4DGFA 3V8VA 3DUPA 3IF5A 3GVLA 1BUZA 3V97A 1FCFA 3AGEA 1T6RA 3D03A 3GVJA 3ZTBA 4QTPA 2AS0A 3IHBA 1WXXA 1TIDB 1FC9A 1V0EA 4HYLA 1H4XA 1H4YA 2DXLA 1V0FA 4JC0A 3GMFA
chains in the Genus database with same CATH topology
1H4ZA 3OIZA 3ZTBA 3MGLA 3OIRA 3NY7A 4QTPA 4DGHA 1TILB 5EZBA 4XS5A 5EUSA 3IHBA 5EUXA 3LKLA 1TIDB 3IH9A 3F43A 5EUWA 1AUZA 4HYLA 1SBOA 5EUZA 3ZXNA 4DGFA 3IF5A 3T6OA 3LLOA 1THNB 1BUZA 1H4YA 1H4XA 5EUUA 2KLNA 3AGDA 2KA5A 3IH8A 1VC1A 3AGEA 3IHAA 1TH8B 1T6RA 2VY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4Z A;  3OIZ A;  3ZTB A;  3MGL A;  3OIR A;  3NY7 A;  4QTP A;  4DGH A;  1TIL B;  5EZB A;  4XS5 A;  5EUS A;  3IHB A;  5EUX A;  3LKL A;  1TID B;  3IH9 A;  3F43 A;  5EUW A;  1AUZ A;  4HYL A;  1SBO A;  5EUZ A;  3ZXN A;  4DGF A;  3IF5 A;  3T6O A;  3LLO A;  1THN B;  1BUZ A;  1H4Y A;  1H4X A;  5EUU A;  2KLN A;  3AGD A;  2KA5 A;  3IH8 A;  1VC1 A;  3AGE A;  3IHA A;  1TH8 B;  1T6R A;  2VY9 A; 
#chains in the Genus database with same CATH topology
 3OIZ A;  3D3U A;  4DMG A;  2ZOA A;  4L8K A;  4XS5 A;  5EUS A;  3DJA A;  3LDF A;  5EUX A;  3LKL A;  1FC7 A;  4AEJ A;  1SBO A;  1J7X A;  3LLO A;  1THN B;  1FC6 A;  5EUU A;  4AE2 A;  3IH8 A;  4GHN A;  3K50 A;  1TH8 B;  3GK7 A;  3MOG A;  3VSE A;  3C0K A;  3GVK A;  3MGL A;  3OIR A;  3NY7 A;  1TIL B;  5EZB A;  2B78 A;  2RRL A;  3F43 A;  1N6F A;  1BPL A;  1N6E A;  3ZXN A;  3T6O A;  3GHF A;  3DOR A;  2KLN A;  3AGD A;  1WXW A;  2KA5 A;  4L1C A;  4HIZ A;  3JU4 A;  2DXN A;  1K32 A;  1VC1 A;  3EH7 A;  3IHA A;  2VY9 A;  2OAS A;  1H4Z A;  2ZO9 B;  1HF2 A;  2CWW A;  4DGH A;  3QDQ A;  3IH9 A;  1N6D A;  5EUW A;  1AUZ A;  5EUZ A;  4DGF A;  3V8V A;  3DUP A;  3IF5 A;  3GVL A;  1BUZ A;  3V97 A;  1FCF A;  3AGE A;  1T6R A;  3D03 A;  3GVJ A;  3ZTB A;  4QTP A;  2AS0 A;  3IHB A;  1WXX A;  1TID B;  1FC9 A;  1V0E A;  4HYL A;  1H4X A;  1H4Y A;  2DXL A;  1V0F A;  4JC0 A;  3GMF A; 
#chains in the Genus database with same CATH homology
 1H4Z A;  3OIZ A;  3ZTB A;  3MGL A;  3OIR A;  3NY7 A;  4QTP A;  4DGH A;  1TIL B;  5EZB A;  4XS5 A;  5EUS A;  3IHB A;  5EUX A;  3LKL A;  1TID B;  3IH9 A;  3F43 A;  5EUW A;  1AUZ A;  4HYL A;  1SBO A;  5EUZ A;  3ZXN A;  4DGF A;  3IF5 A;  3T6O A;  3LLO A;  1THN B;  1BUZ A;  1H4Y A;  1H4X A;  5EUU A;  2KLN A;  3AGD A;  2KA5 A;  3IH8 A;  1VC1 A;  3AGE A;  3IHA A;  1TH8 B;  1T6R A;  2VY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...