5EUWA

Rat prestin stas domain in complex with nitrate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
129
Chain Sequence
b'SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYNIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prestin,Prestin
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 41
structure length 129
sequence length 143
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5euwA00
4DGHA 3MGLA 4DGFA 2KA5A 1BUZA 3ZXNA 1TH8B 5EUZA 1TIDB 3AGEA 1H4ZA 1THNB 5EUWA 3NY7A 5EUXA 3T6OA 3AGDA 1SBOA 3F43A 5EUUA 3IHBA 1T6RA 1H4XA 1H4YA 4XS5A 3OIRA 1AUZA 3OIZA 4HYLA 3IHAA 3LLOA 4QTPA 5EUSA 2VY9A 3IF5A 2KLNA 3IH8A 3ZTBA 3LKLA 1TILB 5EZBA 3IH9A 1VC1A
chains in the Genus database with same CATH superfamily
1V0EA 1K32A 3MGLA 2CWWA 4AE2A 4DMGA 5EUZA 1N6FA 3GVLA 1TIDB 3AGEA 3GVKA 3NY7A 4AEJA 3EH7A 1T6RA 3OIZA 3GHFA 4QTPA 2B78A 3ZTBA 2ZO9B 1VC1A 3D3UA 4DGHA 4DGFA 3ZXNA 2ZOAA 3GMFA 1H4ZA 2AS0A 3T6OA 1SBOA 3F43A 1J7XA 5EUUA 1H4XA 2RRLA 3GVJA 1FC6A 3LDFA 4GHNA 3D03A 3LKLA 3DJAA 1BPLA 1TILB 1N6EA 3IH9A 4HIZA 1WXWA 1THNB 5EUWA 3MOGA 3IHBA 4XS5A 3V8VA 3GK7A 3IHAA 3DORA 3LLOA 2VY9A 3IF5A 1FC7A 5EZBA 1WXXA 1V0FA 2KA5A 3JU4A 1BUZA 1TH8B 3K50A 1HF2A 4JC0A 5EUXA 4L8KA 2DXNA 3AGDA 1FCFA 3V97A 4L1CA 3C0KA 1H4YA 3OIRA 1N6DA 1AUZA 3QDQA 3DUPA 5EUSA 2KLNA 3IH8A 2DXLA 3VSEA 2OASA 4HYLA 1FC9A
chains in the Genus database with same CATH topology
4DGHA 3MGLA 4DGFA 2KA5A 1BUZA 3ZXNA 1TH8B 5EUZA 1TIDB 3AGEA 1H4ZA 1THNB 5EUWA 3NY7A 5EUXA 3T6OA 3AGDA 1SBOA 3F43A 5EUUA 3IHBA 1T6RA 1H4XA 1H4YA 4XS5A 3OIRA 1AUZA 3OIZA 4HYLA 3IHAA 3LLOA 4QTPA 5EUSA 2VY9A 3IF5A 2KLNA 3IH8A 3ZTBA 3LKLA 1TILB 5EZBA 3IH9A 1VC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGH A;  3MGL A;  4DGF A;  2KA5 A;  1BUZ A;  3ZXN A;  1TH8 B;  5EUZ A;  1TID B;  3AGE A;  1H4Z A;  1THN B;  5EUW A;  3NY7 A;  5EUX A;  3T6O A;  3AGD A;  1SBO A;  3F43 A;  5EUU A;  3IHB A;  1T6R A;  1H4X A;  1H4Y A;  4XS5 A;  3OIR A;  1AUZ A;  3OIZ A;  4HYL A;  3IHA A;  3LLO A;  4QTP A;  5EUS A;  2VY9 A;  3IF5 A;  2KLN A;  3IH8 A;  3ZTB A;  3LKL A;  1TIL B;  5EZB A;  3IH9 A;  1VC1 A; 
#chains in the Genus database with same CATH topology
 1V0E A;  1K32 A;  3MGL A;  2CWW A;  4AE2 A;  4DMG A;  5EUZ A;  1N6F A;  3GVL A;  1TID B;  3AGE A;  3GVK A;  3NY7 A;  4AEJ A;  3EH7 A;  1T6R A;  3OIZ A;  3GHF A;  4QTP A;  2B78 A;  3ZTB A;  2ZO9 B;  1VC1 A;  3D3U A;  4DGH A;  4DGF A;  3ZXN A;  2ZOA A;  3GMF A;  1H4Z A;  2AS0 A;  3T6O A;  1SBO A;  3F43 A;  1J7X A;  5EUU A;  1H4X A;  2RRL A;  3GVJ A;  1FC6 A;  3LDF A;  4GHN A;  3D03 A;  3LKL A;  3DJA A;  1BPL A;  1TIL B;  1N6E A;  3IH9 A;  4HIZ A;  1WXW A;  1THN B;  5EUW A;  3MOG A;  3IHB A;  4XS5 A;  3V8V A;  3GK7 A;  3IHA A;  3DOR A;  3LLO A;  2VY9 A;  3IF5 A;  1FC7 A;  5EZB A;  1WXX A;  1V0F A;  2KA5 A;  3JU4 A;  1BUZ A;  1TH8 B;  3K50 A;  1HF2 A;  4JC0 A;  5EUX A;  4L8K A;  2DXN A;  3AGD A;  1FCF A;  3V97 A;  4L1C A;  3C0K A;  1H4Y A;  3OIR A;  1N6D A;  1AUZ A;  3QDQ A;  3DUP A;  5EUS A;  2KLN A;  3IH8 A;  2DXL A;  3VSE A;  2OAS A;  4HYL A;  1FC9 A; 
#chains in the Genus database with same CATH homology
 4DGH A;  3MGL A;  4DGF A;  2KA5 A;  1BUZ A;  3ZXN A;  1TH8 B;  5EUZ A;  1TID B;  3AGE A;  1H4Z A;  1THN B;  5EUW A;  3NY7 A;  5EUX A;  3T6O A;  3AGD A;  1SBO A;  3F43 A;  5EUU A;  3IHB A;  1T6R A;  1H4X A;  1H4Y A;  4XS5 A;  3OIR A;  1AUZ A;  3OIZ A;  4HYL A;  3IHA A;  3LLO A;  4QTP A;  5EUS A;  2VY9 A;  3IF5 A;  2KLN A;  3IH8 A;  3ZTB A;  3LKL A;  1TIL B;  5EZB A;  3IH9 A;  1VC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...