5EUWA

Rat prestin stas domain in complex with nitrate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
129
Chain Sequence
SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYNIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Prestin,Prestin
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 41
structure length 129
sequence length 143
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5euwA00
3OIRA 3LLOA 1TIDB 3NY7A 3IH8A 4XS5A 1H4XA 5EUSA 1H4ZA 1TH8B 5EUZA 3LKLA 3ZXNA 5EUXA 5EZBA 1THNB 3OIZA 3IHBA 1TILB 5EUWA 5EUUA 3AGDA 1AUZA 3MGLA 4DGHA 1T6RA 4DGFA 1BUZA 1SBOA 3ZTBA 3AGEA 3F43A 4HYLA 3T6OA 3IF5A 4QTPA 2KA5A 1H4YA 1VC1A 2KLNA 2VY9A 3IH9A 3IHAA
chains in the Genus database with same CATH superfamily
3LLOA 5EUSA 1H4ZA 2DXNA 1J7XA 3LKLA 3MOGA 2OASA 1N6FA 3GVJA 5EUWA 1HF2A 1AUZA 4DGHA 1BUZA 3DORA 1WXWA 4QTPA 1VC1A 1K32A 1V0FA 3DUPA 4AE2A 2DXLA 3NY7A 3VSEA 3V97A 1H4XA 4GHNA 5EUZA 1TH8B 3GHFA 3ZXNA 5EUXA 1THNB 4JC0A 1TILB 2ZOAA 5EUUA 4HIZA 3D03A 3GVKA 3EH7A 1SBOA 3AGEA 2AS0A 4HYLA 1FC7A 4L1CA 3QDQA 2ZO9B 2VY9A 3IH9A 3IHAA 3LDFA 3DJAA 3K50A 3D3UA 4L8KA 3GVLA 4AEJA 5EZBA 1V0EA 3IHBA 4DGFA 3ZTBA 2B78A 3F43A 4DMGA 2KA5A 1H4YA 1N6EA 3GK7A 1FC9A 3OIRA 1FCFA 1TIDB 3V8VA 3IH8A 4XS5A 1BPLA 3C0KA 2RRLA 1FC6A 3OIZA 3JU4A 3AGDA 3MGLA 1T6RA 2CWWA 3T6OA 3IF5A 1N6DA 1WXXA 2KLNA 3GMFA
chains in the Genus database with same CATH topology
3OIRA 3LLOA 1TIDB 3NY7A 3IH8A 4XS5A 1H4XA 5EUSA 1H4ZA 1TH8B 5EUZA 3LKLA 3ZXNA 5EUXA 5EZBA 1THNB 3OIZA 3IHBA 1TILB 5EUWA 5EUUA 3AGDA 1AUZA 3MGLA 4DGHA 1T6RA 4DGFA 1BUZA 1SBOA 3ZTBA 3AGEA 3F43A 4HYLA 3T6OA 3IF5A 4QTPA 2KA5A 1H4YA 1VC1A 2KLNA 2VY9A 3IH9A 3IHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OIR A;  3LLO A;  1TID B;  3NY7 A;  3IH8 A;  4XS5 A;  1H4X A;  5EUS A;  1H4Z A;  1TH8 B;  5EUZ A;  3LKL A;  3ZXN A;  5EUX A;  5EZB A;  1THN B;  3OIZ A;  3IHB A;  1TIL B;  5EUW A;  5EUU A;  3AGD A;  1AUZ A;  3MGL A;  4DGH A;  1T6R A;  4DGF A;  1BUZ A;  1SBO A;  3ZTB A;  3AGE A;  3F43 A;  4HYL A;  3T6O A;  3IF5 A;  4QTP A;  2KA5 A;  1H4Y A;  1VC1 A;  2KLN A;  2VY9 A;  3IH9 A;  3IHA A; 
#chains in the Genus database with same CATH topology
 3LLO A;  5EUS A;  1H4Z A;  2DXN A;  1J7X A;  3LKL A;  3MOG A;  2OAS A;  1N6F A;  3GVJ A;  5EUW A;  1HF2 A;  1AUZ A;  4DGH A;  1BUZ A;  3DOR A;  1WXW A;  4QTP A;  1VC1 A;  1K32 A;  1V0F A;  3DUP A;  4AE2 A;  2DXL A;  3NY7 A;  3VSE A;  3V97 A;  1H4X A;  4GHN A;  5EUZ A;  1TH8 B;  3GHF A;  3ZXN A;  5EUX A;  1THN B;  4JC0 A;  1TIL B;  2ZOA A;  5EUU A;  4HIZ A;  3D03 A;  3GVK A;  3EH7 A;  1SBO A;  3AGE A;  2AS0 A;  4HYL A;  1FC7 A;  4L1C A;  3QDQ A;  2ZO9 B;  2VY9 A;  3IH9 A;  3IHA A;  3LDF A;  3DJA A;  3K50 A;  3D3U A;  4L8K A;  3GVL A;  4AEJ A;  5EZB A;  1V0E A;  3IHB A;  4DGF A;  3ZTB A;  2B78 A;  3F43 A;  4DMG A;  2KA5 A;  1H4Y A;  1N6E A;  3GK7 A;  1FC9 A;  3OIR A;  1FCF A;  1TID B;  3V8V A;  3IH8 A;  4XS5 A;  1BPL A;  3C0K A;  2RRL A;  1FC6 A;  3OIZ A;  3JU4 A;  3AGD A;  3MGL A;  1T6R A;  2CWW A;  3T6O A;  3IF5 A;  1N6D A;  1WXX A;  2KLN A;  3GMF A; 
#chains in the Genus database with same CATH homology
 3OIR A;  3LLO A;  1TID B;  3NY7 A;  3IH8 A;  4XS5 A;  1H4X A;  5EUS A;  1H4Z A;  1TH8 B;  5EUZ A;  3LKL A;  3ZXN A;  5EUX A;  5EZB A;  1THN B;  3OIZ A;  3IHB A;  1TIL B;  5EUW A;  5EUU A;  3AGD A;  1AUZ A;  3MGL A;  4DGH A;  1T6R A;  4DGF A;  1BUZ A;  1SBO A;  3ZTB A;  3AGE A;  3F43 A;  4HYL A;  3T6O A;  3IF5 A;  4QTP A;  2KA5 A;  1H4Y A;  1VC1 A;  2KLN A;  2VY9 A;  3IH9 A;  3IHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...