3MGLA

Crystal structure of permease family protein from vibrio cholerae
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
128
Chain Sequence
b'NAEMSYELAQHGRSTLPRELAVYALEGPFFFAAAETFERVMGSIQETPQILILRLKWVPFMDITGIQTLEEMIQSFHKRGIKVLISGANSRVSQKLVKAGIVKLVGEQNVYPVFEGALSAALTEIEAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sulfate permease family protein
publication title Crystal structure of permease family protein from Vibrio cholerae
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transport protein
total genus 42
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3mglA00
3F43A 3IH8A 4DGFA 1SBOA 1BUZA 3OIRA 4HYLA 3AGEA 5EUUA 3NY7A 5EUZA 2VY9A 1H4YA 3LKLA 5EUSA 5EUWA 1TH8B 3IF5A 1THNB 3IHBA 3LLOA 1TILB 4QTPA 1H4XA 3T6OA 3ZXNA 1TIDB 3MGLA 1VC1A 2KLNA 3OIZA 5EUXA 2KA5A 3IHAA 5EZBA 1T6RA 3IH9A 1AUZA 3AGDA 4DGHA 4XS5A 3ZTBA 1H4ZA
chains in the Genus database with same CATH superfamily
4AEJA 3K50A 1N6EA 2OASA 3AGEA 3NY7A 2VY9A 1H4YA 1K32A 3QDQA 1TH8B 3IF5A 2ZO9B 1HF2A 2B78A 1H4XA 4AE2A 3GVLA 4JC0A 4HIZA 3DJAA 1WXXA 1V0EA 4L8KA 3JU4A 3GMFA 3ZTBA 1H4ZA 3F43A 2ZOAA 1SBOA 1FC9A 1BUZA 3DORA 4HYLA 2AS0A 1J7XA 1WXWA 5EUUA 5EUZA 4GHNA 4DMGA 3LKLA 3C0KA 3DUPA 3LLOA 1TILB 1BPLA 3V97A 3ZXNA 3D3UA 3V8VA 5EZBA 1FC6A 1T6RA 4XS5A 3MGLA 4DGFA 1FC7A 2CWWA 2RRLA 3EH7A 1FCFA 3IHBA 2DXLA 4QTPA 3T6OA 1TIDB 3GK7A 1VC1A 3OIZA 5EUXA 4L1CA 3D03A 3GHFA 3IH9A 4DGHA 3IH8A 2DXNA 1V0FA 3OIRA 3VSEA 3LDFA 5EUSA 5EUWA 3MOGA 1THNB 2KLNA 1N6FA 2KA5A 3IHAA 1N6DA 3GVKA 1AUZA 3AGDA 3GVJA
chains in the Genus database with same CATH topology
3F43A 3IH8A 4DGFA 1SBOA 1BUZA 3OIRA 4HYLA 3AGEA 5EUUA 3NY7A 5EUZA 2VY9A 1H4YA 3LKLA 5EUSA 5EUWA 1TH8B 3IF5A 1THNB 3IHBA 3LLOA 1TILB 4QTPA 1H4XA 3T6OA 3ZXNA 1TIDB 3MGLA 1VC1A 2KLNA 3OIZA 5EUXA 2KA5A 3IHAA 5EZBA 1T6RA 3IH9A 1AUZA 3AGDA 4DGHA 4XS5A 3ZTBA 1H4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F43 A;  3IH8 A;  4DGF A;  1SBO A;  1BUZ A;  3OIR A;  4HYL A;  3AGE A;  5EUU A;  3NY7 A;  5EUZ A;  2VY9 A;  1H4Y A;  3LKL A;  5EUS A;  5EUW A;  1TH8 B;  3IF5 A;  1THN B;  3IHB A;  3LLO A;  1TIL B;  4QTP A;  1H4X A;  3T6O A;  3ZXN A;  1TID B;  3MGL A;  1VC1 A;  2KLN A;  3OIZ A;  5EUX A;  2KA5 A;  3IHA A;  5EZB A;  1T6R A;  3IH9 A;  1AUZ A;  3AGD A;  4DGH A;  4XS5 A;  3ZTB A;  1H4Z A; 
#chains in the Genus database with same CATH topology
 4AEJ A;  3K50 A;  1N6E A;  2OAS A;  3AGE A;  3NY7 A;  2VY9 A;  1H4Y A;  1K32 A;  3QDQ A;  1TH8 B;  3IF5 A;  2ZO9 B;  1HF2 A;  2B78 A;  1H4X A;  4AE2 A;  3GVL A;  4JC0 A;  4HIZ A;  3DJA A;  1WXX A;  1V0E A;  4L8K A;  3JU4 A;  3GMF A;  3ZTB A;  1H4Z A;  3F43 A;  2ZOA A;  1SBO A;  1FC9 A;  1BUZ A;  3DOR A;  4HYL A;  2AS0 A;  1J7X A;  1WXW A;  5EUU A;  5EUZ A;  4GHN A;  4DMG A;  3LKL A;  3C0K A;  3DUP A;  3LLO A;  1TIL B;  1BPL A;  3V97 A;  3ZXN A;  3D3U A;  3V8V A;  5EZB A;  1FC6 A;  1T6R A;  4XS5 A;  3MGL A;  4DGF A;  1FC7 A;  2CWW A;  2RRL A;  3EH7 A;  1FCF A;  3IHB A;  2DXL A;  4QTP A;  3T6O A;  1TID B;  3GK7 A;  1VC1 A;  3OIZ A;  5EUX A;  4L1C A;  3D03 A;  3GHF A;  3IH9 A;  4DGH A;  3IH8 A;  2DXN A;  1V0F A;  3OIR A;  3VSE A;  3LDF A;  5EUS A;  5EUW A;  3MOG A;  1THN B;  2KLN A;  1N6F A;  2KA5 A;  3IHA A;  1N6D A;  3GVK A;  1AUZ A;  3AGD A;  3GVJ A; 
#chains in the Genus database with same CATH homology
 3F43 A;  3IH8 A;  4DGF A;  1SBO A;  1BUZ A;  3OIR A;  4HYL A;  3AGE A;  5EUU A;  3NY7 A;  5EUZ A;  2VY9 A;  1H4Y A;  3LKL A;  5EUS A;  5EUW A;  1TH8 B;  3IF5 A;  1THN B;  3IHB A;  3LLO A;  1TIL B;  4QTP A;  1H4X A;  3T6O A;  3ZXN A;  1TID B;  3MGL A;  1VC1 A;  2KLN A;  3OIZ A;  5EUX A;  2KA5 A;  3IHA A;  5EZB A;  1T6R A;  3IH9 A;  1AUZ A;  3AGD A;  4DGH A;  4XS5 A;  3ZTB A;  1H4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...