3MGLA

Crystal structure of permease family protein from vibrio cholerae
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
128
Chain Sequence
NAEMSYELAQHGRSTLPRELAVYALEGPFFFAAAETFERVMGSIQETPQILILRLKWVPFMDITGIQTLEEMIQSFHKRGIKVLISGANSRVSQKLVKAGIVKLVGEQNVYPVFEGALSAALTEIEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Sulfate permease family protein
publication title Crystal structure of permease family protein from Vibrio cholerae
rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 42
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3mglA00
3T6OA 3NY7A 3OIZA 3LLOA 1TH8B 4DGFA 5EUWA 5EZBA 4QTPA 3ZXNA 1T6RA 3LKLA 3IH8A 5EUXA 3IHAA 3OIRA 2KLNA 1TILB 1TIDB 1VC1A 1SBOA 3MGLA 1THNB 1H4XA 3IHBA 5EUUA 3ZTBA 4DGHA 5EUZA 3IH9A 5EUSA 1BUZA 4XS5A 2VY9A 1H4ZA 1AUZA 3AGEA 3AGDA 3F43A 3IF5A 4HYLA 1H4YA 2KA5A
chains in the Genus database with same CATH superfamily
4L8KA 2ZOAA 3T6OA 1N6FA 1WXXA 2DXLA 3DJAA 4QTPA 3C0KA 3IHAA 4L1CA 1FC9A 1TIDB 1VC1A 2DXNA 3K50A 4GHNA 4HIZA 3QDQA 1FC7A 2ZO9B 1AUZA 3GMFA 3D3UA 1J7XA 3GVJA 3NY7A 3OIZA 5EUWA 3DORA 5EZBA 1T6RA 5EUXA 1SBOA 2CWWA 3IHBA 1WXWA 3GK7A 3LDFA 5EUZA 1H4ZA 3AGEA 3JU4A 3AGDA 3IF5A 3EH7A 4HYLA 2AS0A 2KA5A 1HF2A 1TH8B 2KLNA 1V0FA 1TILB 3MGLA 4DMGA 4AEJA 3D03A 5EUUA 2B78A 4DGHA 2OASA 1BPLA 3DUPA 3MOGA 1FC6A 1FCFA 4XS5A 3F43A 1V0EA 4AE2A 1H4YA 3VSEA 1K32A 3V8VA 3LLOA 4DGFA 2RRLA 3ZXNA 3LKLA 1N6EA 3IH8A 3OIRA 3V97A 1THNB 1H4XA 3ZTBA 3IH9A 5EUSA 1BUZA 2VY9A 3GHFA 3GVKA 3GVLA 1N6DA 4JC0A
chains in the Genus database with same CATH topology
3T6OA 3NY7A 3OIZA 3LLOA 1TH8B 4DGFA 5EUWA 5EZBA 4QTPA 3ZXNA 1T6RA 3LKLA 3IH8A 5EUXA 3IHAA 3OIRA 2KLNA 1TILB 1TIDB 1VC1A 1SBOA 3MGLA 1THNB 1H4XA 3IHBA 5EUUA 3ZTBA 4DGHA 5EUZA 3IH9A 5EUSA 1BUZA 4XS5A 2VY9A 1H4ZA 1AUZA 3AGEA 3AGDA 3F43A 3IF5A 4HYLA 1H4YA 2KA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6O A;  3NY7 A;  3OIZ A;  3LLO A;  1TH8 B;  4DGF A;  5EUW A;  5EZB A;  4QTP A;  3ZXN A;  1T6R A;  3LKL A;  3IH8 A;  5EUX A;  3IHA A;  3OIR A;  2KLN A;  1TIL B;  1TID B;  1VC1 A;  1SBO A;  3MGL A;  1THN B;  1H4X A;  3IHB A;  5EUU A;  3ZTB A;  4DGH A;  5EUZ A;  3IH9 A;  5EUS A;  1BUZ A;  4XS5 A;  2VY9 A;  1H4Z A;  1AUZ A;  3AGE A;  3AGD A;  3F43 A;  3IF5 A;  4HYL A;  1H4Y A;  2KA5 A; 
#chains in the Genus database with same CATH topology
 4L8K A;  2ZOA A;  3T6O A;  1N6F A;  1WXX A;  2DXL A;  3DJA A;  4QTP A;  3C0K A;  3IHA A;  4L1C A;  1FC9 A;  1TID B;  1VC1 A;  2DXN A;  3K50 A;  4GHN A;  4HIZ A;  3QDQ A;  1FC7 A;  2ZO9 B;  1AUZ A;  3GMF A;  3D3U A;  1J7X A;  3GVJ A;  3NY7 A;  3OIZ A;  5EUW A;  3DOR A;  5EZB A;  1T6R A;  5EUX A;  1SBO A;  2CWW A;  3IHB A;  1WXW A;  3GK7 A;  3LDF A;  5EUZ A;  1H4Z A;  3AGE A;  3JU4 A;  3AGD A;  3IF5 A;  3EH7 A;  4HYL A;  2AS0 A;  2KA5 A;  1HF2 A;  1TH8 B;  2KLN A;  1V0F A;  1TIL B;  3MGL A;  4DMG A;  4AEJ A;  3D03 A;  5EUU A;  2B78 A;  4DGH A;  2OAS A;  1BPL A;  3DUP A;  3MOG A;  1FC6 A;  1FCF A;  4XS5 A;  3F43 A;  1V0E A;  4AE2 A;  1H4Y A;  3VSE A;  1K32 A;  3V8V A;  3LLO A;  4DGF A;  2RRL A;  3ZXN A;  3LKL A;  1N6E A;  3IH8 A;  3OIR A;  3V97 A;  1THN B;  1H4X A;  3ZTB A;  3IH9 A;  5EUS A;  1BUZ A;  2VY9 A;  3GHF A;  3GVK A;  3GVL A;  1N6D A;  4JC0 A; 
#chains in the Genus database with same CATH homology
 3T6O A;  3NY7 A;  3OIZ A;  3LLO A;  1TH8 B;  4DGF A;  5EUW A;  5EZB A;  4QTP A;  3ZXN A;  1T6R A;  3LKL A;  3IH8 A;  5EUX A;  3IHA A;  3OIR A;  2KLN A;  1TIL B;  1TID B;  1VC1 A;  1SBO A;  3MGL A;  1THN B;  1H4X A;  3IHB A;  5EUU A;  3ZTB A;  4DGH A;  5EUZ A;  3IH9 A;  5EUS A;  1BUZ A;  4XS5 A;  2VY9 A;  1H4Z A;  1AUZ A;  3AGE A;  3AGD A;  3F43 A;  3IF5 A;  4HYL A;  1H4Y A;  2KA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...