5EUXA

Rat prestin stas domain in complex with thiocyanate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
129
Chain Sequence
b'PSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prestin,Prestin
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 41
structure length 129
sequence length 142
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5euxA00
3OIZA 1TH8B 5EUXA 3LLOA 3AGDA 2KLNA 1H4XA 4XS5A 3F43A 3T6OA 3MGLA 3OIRA 3AGEA 5EUWA 1VC1A 4HYLA 5EUSA 2KA5A 3ZTBA 5EZBA 1TILB 4DGFA 1H4YA 1TIDB 4QTPA 5EUZA 3IH8A 3LKLA 1AUZA 2VY9A 1H4ZA 3NY7A 1SBOA 4DGHA 3IHBA 1T6RA 5EUUA 1BUZA 3IF5A 3IH9A 3ZXNA 3IHAA 1THNB
chains in the Genus database with same CATH superfamily
3LDFA 3OIZA 4GHNA 3GVJA 1WXXA 1N6EA 3F43A 3DORA 5EUWA 3ZTBA 1WXWA 1H4ZA 2ZOAA 3NY7A 1SBOA 3V97A 1FC6A 1N6FA 3AGDA 2KLNA 1FC7A 3MGLA 1V0FA 4AEJA 1VC1A 4HYLA 3D3UA 1TILB 2DXNA 3IH8A 3GHFA 1AUZA 1J7XA 1FC9A 3VSEA 4L1CA 2CWWA 3IHBA 1T6RA 5EUUA 3IF5A 4XS5A 3IHAA 1THNB 3D03A 3MOGA 3LLOA 4L8KA 4AE2A 3T6OA 3DJAA 3OIRA 3GK7A 3DUPA 2DXLA 3V8VA 1H4YA 1TIDB 4QTPA 5EUZA 3QDQA 2B78A 3LKLA 2ZO9B 1K32A 4JC0A 4DGHA 4DMGA 1BUZA 3GVKA 4HIZA 1TH8B 5EUXA 3JU4A 2RRLA 1H4XA 1FCFA 1HF2A 2AS0A 3C0KA 3EH7A 3GMFA 3AGEA 5EUSA 2KA5A 5EZBA 2OASA 4DGFA 2VY9A 1BPLA 1N6DA 3GVLA 1V0EA 3K50A 3IH9A 3ZXNA
chains in the Genus database with same CATH topology
3OIZA 1TH8B 5EUXA 3LLOA 3AGDA 2KLNA 1H4XA 4XS5A 3F43A 3T6OA 3MGLA 3OIRA 3AGEA 5EUWA 1VC1A 4HYLA 5EUSA 2KA5A 3ZTBA 5EZBA 1TILB 4DGFA 1H4YA 1TIDB 4QTPA 5EUZA 3IH8A 3LKLA 1AUZA 2VY9A 1H4ZA 3NY7A 1SBOA 4DGHA 3IHBA 1T6RA 5EUUA 1BUZA 3IF5A 3IH9A 3ZXNA 3IHAA 1THNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OIZ A;  1TH8 B;  5EUX A;  3LLO A;  3AGD A;  2KLN A;  1H4X A;  4XS5 A;  3F43 A;  3T6O A;  3MGL A;  3OIR A;  3AGE A;  5EUW A;  1VC1 A;  4HYL A;  5EUS A;  2KA5 A;  3ZTB A;  5EZB A;  1TIL B;  4DGF A;  1H4Y A;  1TID B;  4QTP A;  5EUZ A;  3IH8 A;  3LKL A;  1AUZ A;  2VY9 A;  1H4Z A;  3NY7 A;  1SBO A;  4DGH A;  3IHB A;  1T6R A;  5EUU A;  1BUZ A;  3IF5 A;  3IH9 A;  3ZXN A;  3IHA A;  1THN B; 
#chains in the Genus database with same CATH topology
 3LDF A;  3OIZ A;  4GHN A;  3GVJ A;  1WXX A;  1N6E A;  3F43 A;  3DOR A;  5EUW A;  3ZTB A;  1WXW A;  1H4Z A;  2ZOA A;  3NY7 A;  1SBO A;  3V97 A;  1FC6 A;  1N6F A;  3AGD A;  2KLN A;  1FC7 A;  3MGL A;  1V0F A;  4AEJ A;  1VC1 A;  4HYL A;  3D3U A;  1TIL B;  2DXN A;  3IH8 A;  3GHF A;  1AUZ A;  1J7X A;  1FC9 A;  3VSE A;  4L1C A;  2CWW A;  3IHB A;  1T6R A;  5EUU A;  3IF5 A;  4XS5 A;  3IHA A;  1THN B;  3D03 A;  3MOG A;  3LLO A;  4L8K A;  4AE2 A;  3T6O A;  3DJA A;  3OIR A;  3GK7 A;  3DUP A;  2DXL A;  3V8V A;  1H4Y A;  1TID B;  4QTP A;  5EUZ A;  3QDQ A;  2B78 A;  3LKL A;  2ZO9 B;  1K32 A;  4JC0 A;  4DGH A;  4DMG A;  1BUZ A;  3GVK A;  4HIZ A;  1TH8 B;  5EUX A;  3JU4 A;  2RRL A;  1H4X A;  1FCF A;  1HF2 A;  2AS0 A;  3C0K A;  3EH7 A;  3GMF A;  3AGE A;  5EUS A;  2KA5 A;  5EZB A;  2OAS A;  4DGF A;  2VY9 A;  1BPL A;  1N6D A;  3GVL A;  1V0E A;  3K50 A;  3IH9 A;  3ZXN A; 
#chains in the Genus database with same CATH homology
 3OIZ A;  1TH8 B;  5EUX A;  3LLO A;  3AGD A;  2KLN A;  1H4X A;  4XS5 A;  3F43 A;  3T6O A;  3MGL A;  3OIR A;  3AGE A;  5EUW A;  1VC1 A;  4HYL A;  5EUS A;  2KA5 A;  3ZTB A;  5EZB A;  1TIL B;  4DGF A;  1H4Y A;  1TID B;  4QTP A;  5EUZ A;  3IH8 A;  3LKL A;  1AUZ A;  2VY9 A;  1H4Z A;  3NY7 A;  1SBO A;  4DGH A;  3IHB A;  1T6R A;  5EUU A;  1BUZ A;  3IF5 A;  3IH9 A;  3ZXN A;  3IHA A;  1THN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...