5EUXA

Rat prestin stas domain in complex with thiocyanate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
129
Chain Sequence
PSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSNIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prestin,Prestin
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 41
structure length 129
sequence length 142
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5euxA00
4QTPA 5EUSA 3IHBA 3LKLA 5EUUA 3F43A 3IHAA 2VY9A 1TILB 4HYLA 1BUZA 5EUXA 3OIRA 3IF5A 3OIZA 3T6OA 3AGDA 1SBOA 4DGHA 3MGLA 4XS5A 1H4YA 1T6RA 3NY7A 1AUZA 3ZTBA 1THNB 2KLNA 2KA5A 3IH9A 1VC1A 1TIDB 5EUZA 4DGFA 3IH8A 1H4XA 3LLOA 3ZXNA 5EUWA 1H4ZA 5EZBA 3AGEA 1TH8B
chains in the Genus database with same CATH superfamily
3IHBA 1FC9A 2OASA 1TILB 1FC7A 3DJAA 4HYLA 3OIRA 4L8KA 1N6DA 3AGDA 4XS5A 3K50A 4DMGA 3C0KA 3D03A 4HIZA 1H4ZA 3AGEA 3DUPA 3QDQA 1J7XA 3LKLA 5EUSA 5EUUA 1K32A 3GVJA 2DXLA 1N6FA 1BPLA 2VY9A 4AE2A 2B78A 3IF5A 3T6OA 3GMFA 3NY7A 2ZOAA 1AUZA 2KLNA 3EH7A 3ZXNA 4QTPA 4AEJA 3JU4A 1N6EA 3GK7A 1FCFA 3D3UA 1BUZA 3OIZA 1HF2A 1H4YA 3GHFA 3V8VA 2CWWA 1WXWA 3IH9A 1TIDB 3DORA 5EUWA 1V0EA 1V0FA 3V97A 3VSEA 1TH8B 2RRLA 3F43A 3LDFA 3IHAA 2ZO9B 4L1CA 3MOGA 5EUXA 1SBOA 3GVLA 3MGLA 4DGHA 1T6RA 1WXXA 4JC0A 3ZTBA 1THNB 2KA5A 1VC1A 2DXNA 3GVKA 5EUZA 4DGFA 2AS0A 3IH8A 1FC6A 1H4XA 3LLOA 5EZBA 4GHNA
chains in the Genus database with same CATH topology
4QTPA 5EUSA 3IHBA 3LKLA 5EUUA 3F43A 3IHAA 2VY9A 1TILB 4HYLA 1BUZA 5EUXA 3OIRA 3IF5A 3OIZA 3T6OA 3AGDA 1SBOA 4DGHA 3MGLA 4XS5A 1H4YA 1T6RA 3NY7A 1AUZA 3ZTBA 1THNB 2KLNA 2KA5A 3IH9A 1VC1A 1TIDB 5EUZA 4DGFA 3IH8A 1H4XA 3LLOA 3ZXNA 5EUWA 1H4ZA 5EZBA 3AGEA 1TH8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTP A;  5EUS A;  3IHB A;  3LKL A;  5EUU A;  3F43 A;  3IHA A;  2VY9 A;  1TIL B;  4HYL A;  1BUZ A;  5EUX A;  3OIR A;  3IF5 A;  3OIZ A;  3T6O A;  3AGD A;  1SBO A;  4DGH A;  3MGL A;  4XS5 A;  1H4Y A;  1T6R A;  3NY7 A;  1AUZ A;  3ZTB A;  1THN B;  2KLN A;  2KA5 A;  3IH9 A;  1VC1 A;  1TID B;  5EUZ A;  4DGF A;  3IH8 A;  1H4X A;  3LLO A;  3ZXN A;  5EUW A;  1H4Z A;  5EZB A;  3AGE A;  1TH8 B; 
#chains in the Genus database with same CATH topology
 3IHB A;  1FC9 A;  2OAS A;  1TIL B;  1FC7 A;  3DJA A;  4HYL A;  3OIR A;  4L8K A;  1N6D A;  3AGD A;  4XS5 A;  3K50 A;  4DMG A;  3C0K A;  3D03 A;  4HIZ A;  1H4Z A;  3AGE A;  3DUP A;  3QDQ A;  1J7X A;  3LKL A;  5EUS A;  5EUU A;  1K32 A;  3GVJ A;  2DXL A;  1N6F A;  1BPL A;  2VY9 A;  4AE2 A;  2B78 A;  3IF5 A;  3T6O A;  3GMF A;  3NY7 A;  2ZOA A;  1AUZ A;  2KLN A;  3EH7 A;  3ZXN A;  4QTP A;  4AEJ A;  3JU4 A;  1N6E A;  3GK7 A;  1FCF A;  3D3U A;  1BUZ A;  3OIZ A;  1HF2 A;  1H4Y A;  3GHF A;  3V8V A;  2CWW A;  1WXW A;  3IH9 A;  1TID B;  3DOR A;  5EUW A;  1V0E A;  1V0F A;  3V97 A;  3VSE A;  1TH8 B;  2RRL A;  3F43 A;  3LDF A;  3IHA A;  2ZO9 B;  4L1C A;  3MOG A;  5EUX A;  1SBO A;  3GVL A;  3MGL A;  4DGH A;  1T6R A;  1WXX A;  4JC0 A;  3ZTB A;  1THN B;  2KA5 A;  1VC1 A;  2DXN A;  3GVK A;  5EUZ A;  4DGF A;  2AS0 A;  3IH8 A;  1FC6 A;  1H4X A;  3LLO A;  5EZB A;  4GHN A; 
#chains in the Genus database with same CATH homology
 4QTP A;  5EUS A;  3IHB A;  3LKL A;  5EUU A;  3F43 A;  3IHA A;  2VY9 A;  1TIL B;  4HYL A;  1BUZ A;  5EUX A;  3OIR A;  3IF5 A;  3OIZ A;  3T6O A;  3AGD A;  1SBO A;  4DGH A;  3MGL A;  4XS5 A;  1H4Y A;  1T6R A;  3NY7 A;  1AUZ A;  3ZTB A;  1THN B;  2KLN A;  2KA5 A;  3IH9 A;  1VC1 A;  1TID B;  5EUZ A;  4DGF A;  3IH8 A;  1H4X A;  3LLO A;  3ZXN A;  5EUW A;  1H4Z A;  5EZB A;  3AGE A;  1TH8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...