3GMFA

Crystal structure of protein-disulfide isomerase from novosphingobium aromaticivorans
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
196
structure length
196
Chain Sequence
LADGHHLLGNPAAKLRLVEFVSYTCPHCSHFEIESEGQLKIGMVQPGKGAIEVRNFVRDPIDMTVALITNCVPPSRFFTLHTAFMRSQAQWIGPLANSTEAQRQRWFNGTFATRTRAIASDFRFYDFMAARGMDRSTLDRCLSNEALAKKLAAETDEAINQYNVSGTPSFMIDGILLAGTHDWASLRPQILARLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Protein-disulfide isomerase
publication title Crystal structure of protein-disulfide isomerase from Novosphingobium aromaticivorans
rcsb
source organism Novosphingobium aromaticivorans
total genus 77
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2009-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.110 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 3gmfA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3gmfA01
1UC7A 1IYHA 1PA3A 3A2VA 4GQFA 3HVVA 2MBTA 1TRUA 1B48A 1XW5A 1GTAA 1OKTA 5KN3A 1SJIA 4XRDA 4KB3A 4MDCA 3I9V2 1Z6NA 2IN3A 1MEKA 3IBHA 4JE1A 1XCCA 2ON7A 2AUVA 2WGRA 4O5RA 3DMLA 6GSSA 1O8WA 1OC9B 1QXHA 2CVKA 3FZ9A 3C71A 4IVFA 3ZFBA 3CBUA 2JZSA 3PR8A 3KIJA 3EINA 5A5KA 5LNKe 1TJDA 2VM2A 3KZQA 4KH7A 4ZILA 4MH2A 2LJAA 3KH7A 4BPYA 5L71A 1GL8A 2C3TA 2EC4A 3S9FA 4GLTA 1A2JA 1TDIA 2WS2A 4HU7A 5KN1A 5COHA 1F6MC 4BWSA 2R2JA 3GSSA 1LU4A 1A8YA 3CMIA 2H0IA 2QSIA 5ECHB 1N8JA 1MDJA 2CVBA 2MZCA 4RQRA 4LMWA 2DJ0A 3BOAA 1V57A 3BCKA 4GRFA 4Z7XA 4TW5A 2C3QA 4K2DA 4IJIA 2VL3A 3QFBC 1JLWA 2GQMA 3BD2A 1FO5A 4PGTA 1ERTA 3LJRA 3TKSE 1X9SB 3QDNA 4AJ8A 3M3MA 5ECOB 3ZVJD 1X9WB 3CYNA 5CREA 4K0NA 4G2EA 2J23A 1QMVA 4MCUA 3FR6A 2R4VA 3IRAA 5IOWA 4PUAA 4ZL7A 2WRTA 4HS1A 3CRTA 2HZFA 4J2FA 2DMMA 2EIOA 1KTEA 2LV3A 3HVXA 1ZZYA 4F2IA 2GVPA 5E59A 2V32A 4TOPA 2L59A 4ZL9A 2KUCA 10GSA 5CRHA 1OAZA 4FIWA 3IXRA 1O6JA 4OO5A 1YKCA 5DAKB 5DVBA 2GQLA 4QQ7A 1Q4JA 4ULXA 4K0GA 2CT6A 2VOCA 4HZ2A 3GH9A 1XWGA 1YDKA 2VCXA 4K7OA 2CZ3A 1EEJA 2GLRA 2H74A 2VLUA 4ZXGA 5B6MA 3UVTA 1R4WA 4TR0A 3GTUA 2RUEA 5J3RA 2DJJA 2LUSA 3EU3A 1ZL9A 4DVCA 1B4PA 2YPMA 5DALA 1JZRA 2YANA 4WF5A 4EL1A 2H75A 1GP1A 4JU5A 3ZL5A 3IA1A 4F0BA 5ID2A 3M8NA 4K6XA 5IMAA 3KMOA 3CTFA 2YOIA 4JEDA 3KEBA 1TOFA 1ST9A 17GSA 5GSSA 2K6VA 2DJ1A 4RUVA 4YQVA 3TKSC 2OE3A 2ZNMA 2YZHA 6GSTA 3GUSA 2G2QA 3TKQA 3IAM2 4HEA2 1MDKA 1M2BA 2Z9SA 4ZBDA 5C04A 1QK8A 1K0OA 3HY2A 2DSAA 2AV4A 2LRTA 3ZIJA 2BJXA 2H0GA 2JU5A 1NSWA 1E6BA 2DIZA 3TJJA 2I3YA 3HVSA 2FCHA 1TK5B 4OFNA 1K0BA 3FEUA 1YF0A 2B5YA 3UBKA 2CX3A 5LCZA 2C0FA 3L78A 5HFIA 1FHEA 2LRNA 3SBCA 1X5DA 2GQKA 2EIQA 3LFLA 2MMZA 4HJMA 4DSQA 4I5QA 5HFGA 1G6YA 2IMFA 1BX9A 4TR1B 4RQXA 2NBSA 3ZITA 2LQQA 1TK8B 3TJFA 3KP8A 5B6NA 3GFKA 1G6WA 1Y6EA 3K8NA 1EZKA 3WGXA 3OR5A 3RBTA 2YWNA 2I81A 2IMDA 4OO4A 5AISA 1T4YA 2VD1A 3HXSA 3WD6A 2VCWA 1M0UA 12GSA 1GLPA 1XWAA 1HYUA 4V1Ag 3BJ5A 2HSYA 1GNEA 1TW9A 1XWCA 3LYKA 2DIYA 4HU9A 1ZMAA 4ECJA 1TRSA 4PXOA 2ZUPA 2NVLA 1SYRA 1KBNA 2H70A 1SKWB 4E8HA 2OE1A 1GUMA 1YQ1A 3HCZA 5CYYA 3DVWA 3TUEA 2YN1A 1XPVA 3UJ1A 3ED3A 5G31A 2RUFA 2HI7A 4FYBA 4K1FA 1B8XA 3C8EA 3ZFLA 3DKSA 3TKPA 4G10A 3F6FA 1V2AA 1OE8A 4PQ1A 2HSHA 9GSSA 3M0FA 2GZYA 2XC2A 5C00A 1ML6A 1M2DA 4NHZA 4WETA 1S3DA 4EDYA 3EVIA 4ECCA 3F4RA 2LJKA 4AGSA 2GT5A 2V41A 5EL8A 3KCMA 2N5AA 1BQ7A 4MP4A 1DSBA 1HQOA 1T7PB 1Z7RA 4OCFA 11GSA 1PKWA 5D8IA 1FAAA 3UIWA 2L5LA 1SJZA 4LLRA 2FWEA 1SD8A 6GSVA 4JRRA 2YWIA 5F8BA 3VI5A 2YWMA 5DQSA 4KGIA 1PX6A 2B6MA 2HFDA 1G7OA 2C4JA 2ZCTA 1BJXA 4N0VA 2RM5A 3EMXA 2XBQA 1XXUA 6GSWA 2B1KA 2H1BA 1WE0A 1VF1A 3A5WA 4KCAA 4X43A 1AW9A 1OYJA 1WP0A 3RHBA 2VCTA 4I97A 2XBIA 4N30A 4KNDA 4WF4A 1A24A 3GIXA 3GL3A 5B7CA 1E2YA 4CHSA 2PGTA 1THOA 4POKA 1AIUA 3WGDA 4TXOB 5DCGA 3GV1A 4KSMA 1U87A 3G7YA 3D5JA 4OWYA 4K7IA 2B1LA 4TVEA 2B3SA 3KGKA 2GSSA 4GSNA 1UN2A 4CDOA 2WB9A 3C1SA 3UEMA 3HYPA 4PQIA 5JCUA 4K9ZA 1OC9A 2JADA 1O73A 2IPAA 3VWVA 1AQXA 1PQNA 3BBYA 3ME7A 5D73A 1YEPA 4GWRA 1TU8A 1XFLA 3QCPA 2O7KA 3NOFA 1GSDA 4L5OA 3CSIA 1BEDA 2H66A 3MNGA 4V2LA 2VCQA 2L6DA 5ECPB 6GSXA 3IR4A 2I4AA 1SK1A 3D6IA 2A2SA 3FKFA 4XS6A 4FH8A 3GKMA 4IJ3A 2VAFA 3UVHA 3QMXA 4IP6A 4ISDA 5F07A 4LL1B 4GQCA 2H6YA 1MDIA 2EIRA 1ZOFA 3P7XA 1A8LA 3IK7A 5GZZB 3LQ7A 1A0FA 4DSSA 2B7JA 3N5OA 3UOMA 3MAKA 5IO0A 4O7HA 1EWXA 5G1KA 3PINA 2ON5A 2WZ9A 6GSYA 1X5EA 5J41A 1I9DA 3IE3A 4BL7A 2M72A 1VF2A 2CAIA 2VO4A 3DEXA 5GSTA 1X9MB 1ERUA 2H30A 2O89A 5J9CA 3L9SA 4Q5QA 1AQVA 1EGOA 2M46A 2PVQA 5CNWA 3EMPA 3DGQA 1TKDB 3ZYWA 3FZ5A 5KN2A 1K0CA 20GSA 3HZ8A 5JCGA 4XHMA 2WJUA 2GSQA 1TI1A 4ML6A 3GH6A 5D9WA 3M9KA 2O8VB 4L5LA 1SU9A 5JWRB 2DJKA 3CTGA 1OE7A 3FY7A 3F9UA 3KTLA 4AJ6A 3LSZA 2H6XA 2N5BA 5ELGA 1EEMA 4WEYA 2I1UA 2K8VA 4MJAA 1PD21 3EC3A 2DMLA 1DUGA 2K9FA 2OADA 2GZPA 2L57A 5DAKA 2IMEA 4IW9A 3Q19A 19GSA 3FZAA 1GWCA 1XVWA 4MK3A 3TJGA 1I5GA 1YJ6A 3TJKA 2L4QA 4NAXA 2DJ2A 1F3BA 3CRUA 1Z3EA 2GSRA 1T8EB 3Q74A 1LJRA 2R5GA 18GSA 1GSQA 1WJKA 3AY8A 1A0RP 1RW1A 4EF0A 1FB6A 1K0MA 1R5AA 2IFQB 4OFMA 4MMMA 2AYTA 2FNOA 2XPDA 2K18A 2AAWA 2FD3A 5AIXA 3ZZXA 5DCHA 5JWOB 3VURA 2REMA 2YJ7A 2YP6A 3GA4A 3IC4A 1T00A 1K3YA 5CRDA 5DDLA 5IMCA 4WXTA 1SD9A 1FVJA 3UL3A 1PGTA 5G2ZA 2ES7A 1GUKA 13GSA 2GS3A 5J9BA 1A2LA 4ID0A 1TK0B 3VK9A 4HI7A 1U3AA 3QD9A 4V2MA 3RPNA 5EVOA 14GSA 3GX0A 5JCWA 2LS5A 1O85A 1VGLA 4ZBAA 1T4ZA 3ZRDA 1TRVA 4IP1A 4HQZA 1TU7A 3KJYA 3UBLA 3Q6OA 2N5FA 5D93A 5IMVA 1B9XC 3GSTA 3V1WA 3D4TA 1K0AA 2GT6A 3HHVA 4Q5FA 2F8FA 4KCEA 3I6AA 5ECNB 4MPGA 3LG6A 2YJHA 4GF0A 1J0FA 5IMFA 1GSEA 1O7UA 4OCEA 4XTSA 5CO3A 2IMKA 4ECBA 1X0RA 2JSZA 4EXJA 4TR1A 1USBA 3F3RA 1QGVA 3TOTA 2OACA 3LXZA 1YEXA 4TR3A 5A4VA 3DYRA 1YKAA 4WR5A 5HFKA 2F8AA 1S3CA 1SENA 1SK0A 3EURA 3GTUB 3FZ4A 1LBKA 5CP1A 3F4SA 2F3MA 5H5QA 4LMVA 3QAVA 2E7PA 1PKZA 2NPBA 4MJBA 1J08A 1B4QA 2JZRA 2V1MA 4YAPA 1OC8A 2LRCA 4TKYA 3PGTA 2X8GA 3HJMA 4OMVA 1HNBA 4AJ7A 3F0IA 1EV4A 5HR3A 4KAEA 1GTBA 5ELAA 4YQUA 3WGEA 5J5NA 3DWVA 2LNTA 1WMJA 1XOBA 1ZYEA 2WDUA 2QKEA 4MABA 5AGYA 4IGJA 3GX8A 1AAZA 3DVXA 1K0DA 2OBIA 1DBYA 2X8CA 2K8SA 1GTIA 5HR1A 4H86A 4FYUA 1J9BA 4G19A 1V9WA 5IO2A 3RPPA 3APSA 3D22A 1V98A 3ERGA 5DJLA 4GCIA 1TP9A 5FHIA 3MDKA 2C80A 3CSJA 1PMTA 2H0HA 5G30A 3QFAC 2MYGA 4N11A 1K0NA 3GMFA 4MA9A 3U5RE 1URMA 4TXVA 4N0ZA 3A3TA 2VLVA 7GSSA 1NHYA 4I2UA 4KDYA 4K8MA 3H8QA 3UARA 1NW2A 3C73A 1GSYA 3DRNA 2E2GA 3E0UA 2VCZA 3H4KA 4IQAA 2R3XA 5HQPA 5AIVA 3FW2A 3HDCA 3GHAA 1AUCA 5G5EA 3LYPA 3F3QA 4JR6A 4MJCA 2GSTA 4EVMA 3BCIA 5H5SA 1XVQA 2HZEB 3E9JB 2C3NA 4D73A 2YWOA 1PL2A 1KEBA 1TRWA 2KLXA 3UMAA 5CRGA 2D2ZA 3QR6A 2IL3A 1SL1B 2HT9A 4MLYA 2H1AA 1JZOA 1PRXA 3J7Yk 2WFCA 1EV9A 6GSUA 1XBSA 3D21A 2VIMA 2HXKA 4FYCA 4EC0A 2MMNA 4EO3A 3GURA 2H6ZA 4XRAA 1AQWA 1XZOA 3GKXA 1BAYA 1YF1A 2JZTA 3J7Yb 2NTOA 2TRXA 3FR9A 5ECLB 5INYA 4NPBA 1U88A 3W8SA 3DD3A 1ILOA 2FGXA 3US3A 3GKNA 1JLVA 2C0EA 1M9BA 2RIIA 5FT3A 2F51A 1R26A 3FRCA 4KW6A 2CA8A 3KTBA 3TRPA 3WT1A 4TRXA 2H76A 3F8UA 2KP1A 3GRXA 3TKSA 2VL2C 3P2AA 4XS4B 4KE3A 3QPMA 1FVKA 2LJRA 3IV4A 4TR4A 2P31A 2VM1A 3TDGA 4QL9A 2RLIA 3LWAA 4NV2A 1R7HA 2C0DA 2FWFA 3JCML 4HDEA 3QOUA 1T1VA 5EPFA 3W6GA 3O76A 4F03A 4MF7A 1GULA 5KN0A 2QGVA 1V40A 2L6CA 4Q5RA 1WIKA 1MD3A 4ILFA 2LNSA 4JZQA 4RI7A 3KD0A 5GAND 2C8UA 4GSSA 3DXBA 1O8XA 5IPGA 3TKRA 3KP9A 4ZB9A 1JZDA 5IMZA 3G9BA 3H1NA 1GLQA 2XHFA 4EDZA 1A2MA 1O81A 3APQA 4PUFC 3VPQA 3GYKA 1Z7PA 4RI6A 2PBJA 5B8AA 1F3AA 1M9AA 3O3TA 2IWTA 4I2TA 1ERWA 4DSRA 16GSA 4N10A 1UA5A 5IIZA 3C1RA 1G7EA 2LSTA 3FHKA 3HZ4A 3GKKA 4POBA 2F9SA 2AJQB 4MF6A 2RM6A 2IJYA 1F2EA 1UVZA 4MZWA 3D0ZA 2HNLA 1PSQA 1PX7A 2PVOC 3RDWA 1AXDA 3IHQA 3LGCA 2LTKA 3F6DA 2FWHA 5ABRA 3EYTA 2XPEA 2V6KA 3FYGA 3GN3A 1SYXA 1SL2B 1WRYA 3WYWA 1XWKA 3G7IA 2FUG2 2VCVA 3L9VA 1M2AA 4NMUA 5DQYA 3ME8A 4IHUA 4HQSA 3IDVA 4OFTA 2IFQA 2BMXA 1N2AA 5D9TA 3M1GA 3C7MA 3CSHA 2AHEA 4BVYA 2VLTA 1NM3A 2AB6A 4DEJA 2PUKC 4HJ2A 3VWUA 2H1GA 2H19A 3F63A 4DSSB 2PPTA 2H01A 1BG5A 4WR4A 2TRCP 3ERFA 3RAZA 4EE0A 1H4OA 1YZXA 2A2RA 4POLA 1DE2A 2WCIA 3F4TA 3H93A 3IPZA 3L0HA 2YCDA 4F9ZA 2PMTA 2OA7A 1WWJA 2QC7A 4PNGA 2J9HA 5ECIB 1FB0A 4KDUA 1K3OA 2G0FA 2MBSA 4L0UA 4HOJA 2H1DA 1M7TA 3UAPA 3EE2A 2GDRA 5CRWA 1ON4A 5D9XA 4NXIA 5ECQB 1HNAA 3GNJA 1GTUA 2FY6A 1EP7A 3FR3A 5GAPD 1GUHA 2X8HA 3TJBA 4ACSA 2CVDA 2H72A 1JFUA 1EP8A 1HD2A 2PWJA 4MPFA 3LXTA 3RHCA 3MWHA 5IPHA 1GSSA 5DJMA 1ZCPA 3NZNA 2KHPA 2PN8A 2LEGA 1XWBA 1QQ2A 2FWGA 3L9UA 2VL2A 3P90A 1OC3A 3IK9A 1T3BA 1FG4A 1EOHA 2C1YA 4XS1A 2B7KA 5EY6A 1F37A 2P0GA 4OD7A 1EGRA 2E2MA 5IQYA 2O85A 4L0WA 4TN8A 2L5OA 1ACVA 3TOUA 2FLSA 2CAQA 3W8JA 3HD5A 3GL5A 4XCSA 2HYXA 2PERA 1Q98A 1XW6A 1ABAA 1IYIA 3N9JA 3D4MA 5ECKB 3ZTLA 4K7NA 5HR0A 3A2WA 2KOKA 3E3EA 1QFNA 4IKHA 2P5QA 5ECMB 1DE1A 2DJ3A 3SWLA 1SJ6A 1FW1A 2E0QA 3H79A 4MZCA 2C0GA 2JACA 4JBBA 5H5RA 2WULA 1GRXA 1SKRB 2L4CA 2GGTA 3VWXA 2PU9C 2YV9A 2YV7A 5HR2A 5D9VA 3ZMLA 1NHOA 3TCOA 4L8EA 5IOXA 3DIEA 2IIYA 5E4WA 5A4WA 4BA7A 5DALB 4BVXA 2DC5A 3CXGA 5AN1A 2CZ2A 4MF5A 2VL9A 4AF2A 2JL4A 2R37A 4HZ4A 2H8LA 1SL0B 3QAGA 5ID2B 4EKZA 2TIRA 1ZGNA 5J4UA 1GH2A 1JHBA 4ML1A 4J57E 1B9YC 1CQHA 4YH2A 2YZUA 1X5CA 3I43A 4G9HA 22GSA 2VUPA 5IMDA 3VPTA 5FWGA 3KMNA 4V1Ap 2FHEA 1ERVA 2LKUA 1SK2A 3A2XA 4Q5NA 4IBPA 4J56E 5ECRB 3TRQA 5ENUA 4PQHA 2V2GA 3KH9A 5ECSA 3M9JA 1GSUA 4WKWA 1CQGA 4ZB8A 4KDXA 5A4UA 2CX4A 2H71A 2JSYA 5F05A 4ECIA 3IOSA 1FOVA 2OE0A 3O6TA 4KX4A 1SKSB 1EOGA 2FA4A 2HZEA 4O32A 2DLXA 3VWWA 1Y25A 4ZBBA 4GTUA 1R5PA 3ZREA 2GZZA 4LL4B 3TRXA 4NWYA 1S3AA 3IAS2 3NIVA 2CQ9A 3QAWA 4ZL8A 3FK8A 3HJPA 4YAVA 4FO5A 2GTUA 2B5EA 3LORA 1MTCA 3ERWA 1W4VA 3ZMKA 4WBRD 1PL1A 1C72A 1Z6MA 4GSTA 1H75A 3ZIVA 1OKDA 1K3LA 5G1LA 4POMA 3APOA 4X0XA 1U6TA 4HUAA 4MJEA 2YNXA 2A4VA 1F9MA 4MZBA 4QL7A 3KXOA 3P8WA 4YQMA 5CAXA 4KUNA 3KM6A 4BWQA 3VFIA 1MD4A 2V6OA 3I69A 5G5FA 1U3IA 2OJLA 3TGZA 4TXOA 4XS4A 4I8BA 2HE3A 1THXA 2MMOA 3R2QA 1G0TA 3PH9A 4F0CA 4IS0A 2NDOA 4CW9A 1BYEA 4XIHA 4NV5A 2HRFA 4EUYA 3EU4A 2CV4A 1VF4A 1XIYA 3HKRA 4ZB6A 3Q18A 1A23A 1WPIA 2FA8A 1GSFA 2IMIA 1AC1A 2X64A 3ZLPA 2R6KA 1PN9A 5F0GA 5JWQB 3MSZA 5DBQA 1XW9A 1W89A 3LEFA 2P5RA 4P3YB 2I9HA 4KA0A 4D73B 1JZWA 1ZYQB 4WBJA 4V2NA 2VD0A 4GXZA 5D96A 4E8EA 1YY7A 3HJOA 1M99A 2BTOT 3G7JA 4IELA 4ZIJA 2LQOA 1QUWA 2ALBA 3ZVJA 1HNCA 1OVNA 2DBCA 5B8BA 4LA1A 4MH3A 2KP2A 2H73A 1Z5YE 5IM9A 3VLNA 2OKAA 3U6VA 3VI7A 5LD0A 2OBKA 2M80A 4PX1A 3ISOA 1Z9HA 3WT2A 1TI3A 4NHWA 2MMAA 2HLSA 1TXXA 5F06A 4O92A 4F82A 1KNGA 1TTZA 4PURA 3L4NA 1GNWA 3TB2A 3EWLA 1RK4A 1VF3A 4X1UA 1V58A 1WOUA 1VRSD 2O87A 2HRNA 1XOAA 4KSOA 4JR4A 8GSSA 5KEJA 2X99A 1RQMA 2B5XA 4PNFA 3HA9A 4IQ1A 4I6XA 4IN0A
chains in the Genus database with same CATH superfamily
1WXXA 1UC7A 1IYHA 1PA3A 3A2VA 4GQFA 3HVVA 2MBTA 1TRUA 1B48A 1XW5A 1GTAA 1OKTA 5KN3A 1SJIA 4XRDA 4KB3A 4MDCA 3I9V2 1Z6NA 5BMUA 2IN3A 1MEKA 3IBHA 4JE1A 1XCCA 2ON7A 2AUVA 2WGRA 4O5RA 4EIQA 3DMLA 6GSSA 1O8WA 1OC9B 1QXHA 2CVKA 3FZ9A 3C71A 4IVFA 3ZFBA 3CBUA 2JZSA 3PR8A 3KIJA 3EINA 5A5KA 5LNKe 1TJDA 2VM2A 3KZQA 3DORA 4KH7A 4ZILA 4MH2A 2LJAA 3KH7A 4BPYA 5L71A 1GL8A 3IHAA 5KOWA 4QTPA 2C3TA 2EC4A 3S9FA 4GLTA 1A2JA 1TDIA 4BIKA 2WS2A 3IC8A 4HU7A 4G0IA 5KN1A 5COHA 3MYDA 1F6MC 4BWSA 2R2JA 3GSSA 1LU4A 1A8YA 3CMIA 2H0IA 2QSIA 5ECHB 1N8JA 1MDJA 2CVBA 2MZCA 4RQRA 4LMWA 2DJ0A 1V0FA 3BOAA 1V57A 3BCKA 4GRFA 4Z7XA 4TW5A 2C3QA 4K2DA 4IJIA 2VL3A 4BL7B 3QFBC 1JLWA 2GQMA 3BD2A 1FO5A 4PGTA 1ERTA 3LJRA 3TKSE 4CY8A 1X9SB 3QDNA 2HRKA 4AJ8A 3M3MA 5ECOB 3ZVJD 1X9WB 2VY9A 3CYNA 5CREA 4K0NA 4G2EA 4Z2RA 2J23A 1QMVA 4MCUA 5BRTA 3FR6A 2R4VA 3IRAA 1WXWA 5IOWA 2R0PA 4PUAA 4ZL7A 2WRTA 4HS1A 3EH7A 3CRTA 2HZFA 4J2FA 2DMMA 2EIOA 1KTEA 2LV3A 3HVXA 1ZZYA 4F2IA 2GVPA 5E59A 2V32A 4TOPA 2L59A 4ZL9A 2KUCA 10GSA 3GVJA 5CRHA 1OAZA 4FIWA 3IXRA 1O6JA 4OO5A 1V0EA 1YKCA 5DAKB 5DVBA 2GQLA 4QQ7A 1Q4JA 4ULXA 4K0GA 2CT6A 2VOCA 3VSEA 4HZ2A 3GH9A 2CWWA 1XWGA 1YDKA 2VCXA 4K7OA 2CZ3A 1EEJA 2GLRA 4O5UA 2H74A 2VLUA 3OIRA 4ZXGA 3AGDA 5B6MA 3UVTA 1R4WA 4TR0A 3GTUA 2RUEA 4EIPA 5J3RA 2DJJA 2LUSA 3EU3A 1ZL9A 4DVCA 3F43A 1B4PA 2YPMA 5DALA 1JZRA 2YANA 4WF5A 4EL1A 2H75A 1GP1A 4JU5A 3ZL5A 3IA1A 4F0BA 5ID2A 2R0CA 3M8NA 4K6XA 5IMAA 3KMOA 1T6RA 3CTFA 2YOIA 4JEDA 3KEBA 1TOFA 1ST9A 3OIZA 17GSA 5GSSA 2K6VA 2DJ1A 4RUVA 4YQVA 3TKSC 2OE3A 2ZNMA 2YZHA 6GSTA 3GUSA 2G2QA 3TKQA 1H4YA 3IAM2 4HEA2 1MDKA 1M2BA 2Z9SA 4ZBDA 5C04A 1QK8A 1K0OA 3HY2A 2DSAA 2AV4A 2LRTA 3ZIJA 2BJXA 2H0GA 3IF5A 2JU5A 1NSWA 1E6BA 2DIZA 3TJJA 2I3YA 3HVSA 2FCHA 1TK5B 4OFNA 1K0BA 3FEUA 1YF0A 4DGHA 2B5YA 3UBKA 2CX3A 5LCZA 2C0FA 3L78A 5HFIA 1FHEA 2LRNA 3SBCA 1X5DA 2GQKA 2EIQA 3LFLA 2MMZA 4HJMA 4DSQA 4I5QA 5HFGA 1G6YA 2IMFA 1BX9A 4TR1B 4RQXA 2NBSA 3ZITA 2RRLA 2LQQA 1TK8B 3TJFA 3KP8A 5B6NA 3GFKA 1TH8B 1G6WA 1Y6EA 3K8NA 1EZKA 3WGXA 3OR5A 3RBTA 1FOHA 2YWNA 2I81A 2IMDA 4OO4A 5AISA 1T4YA 2VD1A 3HXSA 3WD6A 2VCWA 3GVKA 1M0UA 12GSA 1GLPA 1XWAA 1HYUA 4V1Ag 3BJ5A 2HSYA 1GNEA 1TW9A 1XWCA 4G0LA 3LYKA 2DIYA 4HU9A 1ZMAA 4ECJA 1TRSA 4PXOA 3MGLA 2ZUPA 2NVLA 1SYRA 1KBNA 2H70A 1SKWB 4E8HA 2OE1A 1GUMA 1YQ1A 3HCZA 5CYYA 3DVWA 3TUEA 2YN1A 3CQFA 1XPVA 3UJ1A 1K32A 3ED3A 5G31A 2RUFA 2HI7A 4FYBA 4K1FA 1B8XA 3C8EA 3ZFLA 3DKSA 3TKPA 4G10A 3F6FA 1V2AA 1OE8A 4PQ1A 2HSHA 9GSSA 3M0FA 2GZYA 2XC2A 5C00A 1ML6A 1M2DA 4NHZA 2DKIA 5EUUA 4WETA 1S3DA 4EDYA 3EVIA 4ECCA 3F4RA 2LJKA 1TILB 4AGSA 2GT5A 2V41A 5EL8A 3KCMA 2N5AA 1BQ7A 4MP4A 1DSBA 1HQOA 3JU4A 1T7PB 1Z7RA 4OCFA 11GSA 1PKWA 5D8IA 1FAAA 3UIWA 2L5LA 1SJZA 4LLRA 2FWEA 1SD8A 4L1CA 4AEJA 6GSVA 4JRRA 2YWIA 5F8BA 3VI5A 2YWMA 5DQSA 4KGIA 1PX6A 1H4XA 2B6MA 2HFDA 1G7OA 2C4JA 2ZCTA 1BJXA 4N0VA 2RM5A 3EMXA 2XBQA 1XXUA 6GSWA 2DXLA 2B1KA 2H1BA 1WE0A 1VF1A 3A5WA 4KCAA 4X43A 1AW9A 1OYJA 1WP0A 3RHBA 2VCTA 4I97A 2XBIA 4N30A 4KNDA 4WF4A 1A24A 3GIXA 3GL3A 5B7CA 1E2YA 4K5RA 4CHSA 2PGTA 1THOA 4POKA 1AIUA 3WGDA 4TXOB 5DCGA 3GV1A 4L8KA 4KSMA 1U87A 3G7YA 3D5JA 4OWYA 4K7IA 3T6OA 2B1LA 4TVEA 2B3SA 3KGKA 2GSSA 4GSNA 1UN2A 4CDOA 2WB9A 3C1SA 3UEMA 3HYPA 4PQIA 5JCUA 4K9ZA 1OC9A 2JADA 1O73A 4X4JA 2IPAA 3VWVA 1AQXA 1PQNA 3BBYA 3ME7A 5D73A 1YEPA 4GWRA 1FC6A 1TU8A 1XFLA 3QCPA 2O7KA 3NOFA 1GSDA 4L5OA 3CSIA 1BEDA 2H66A 3MNGA 2VCQA 4V2LA 2L6DA 5ECPB 6GSXA 3IR4A 2I4AA 1SK1A 3D6IA 2A2SA 3FKFA 4XS6A 4FH8A 3GKMA 4IJ3A 2VAFA 3UVHA 3QMXA 4IP6A 4ISDA 5F07A 4LL1B 4GQCA 2H6YA 1MDIA 2EIRA 1ZOFA 3P7XA 1A8LA 2KA5A 3IK7A 5GZZB 3LQ7A 1A0FA 4DSSA 2B7JA 3N5OA 3UOMA 3MAKA 1M3IA 5IO0A 4O7HA 1EWXA 5G1KA 3PINA 2ON5A 2WZ9A 6GSYA 1X5EA 2R0GA 5J41A 1I9DA 3IE3A 4BL7A 2M72A 1VF2A 2CAIA 2VO4A 2KLNA 1FC7A 3DEXA 5GSTA 1X9MB 1ERUA 2H30A 2O89A 5J9CA 3L9SA 4Q5QA 1AQVA 1EGOA 2M46A 2PVQA 5CNWA 3EMPA 3DGQA 1TKDB 3ZYWA 3FZ5A 5KN2A 1K0CA 20GSA 3HZ8A 5JCGA 1BPLA 1FC9A 4XHMA 2WJUA 2GSQA 1TI1A 4ML6A 3GH6A 5D9WA 3M9KA 2O8VB 4L5LA 1SU9A 3IHBA 5JWRB 2DJKA 3CTGA 1OE7A 3FY7A 3F9UA 3KTLA 4AJ6A 3LSZA 2DXNA 2H6XA 2N5BA 5ELGA 1EEMA 4WEYA 2I1UA 2K8VA 4MJAA 1PD21 3EC3A 4Z2TA 2DMLA 1DUGA 2K9FA 2OADA 2GZPA 2L57A 5DAKA 2IMEA 4IW9A 3Q19A 19GSA 3FZAA 1GWCA 1XVWA 1ZYNA 4MK3A 2DKHA 2HRAA 3TJGA 1I5GA 1YJ6A 3TJKA 2L4QA 4NAXA 2DJ2A 1F3BA 3CRUA 1Z3EA 2GSRA 1T8EB 3Q74A 1LJRA 4FQUA 2R5GA 18GSA 1GSQA 1WJKA 3AY8A 1A0RP 1RW1A 4Z2UA 4EF0A 1FB6A 1K0MA 1R5AA 2IFQB 4OFMA 4MMMA 2AYTA 2FNOA 2HSMA 2XPDA 1N6DA 2K18A 4BVYB 2AAWA 2FD3A 5AIXA 3ZZXA 5DCHA 5JWOB 3VURA 4YKGA 2REMA 3LLOA 2YJ7A 2YP6A 3GA4A 3IC4A 1T00A 1K3YA 1FCFA 5CRDA 5DDLA 5IMCA 4WXTA 1SD9A 1FVJA 3UL3A 4GHNA 1PGTA 5G2ZA 2ES7A 1GUKA 13GSA 1N6FA 2GS3A 5J9BA 1A2LA 4ID0A 1TK0B 3VK9A 4HI7A 1U3AA 3QD9A 4V2MA 3ZXNA 3RPNA 5EVOA 14GSA 3GX0A 5JCWA 2LS5A 1O85A 1VGLA 4ZBAA 1T4ZA 3ZRDA 1TRVA 4IP1A 4HQZA 1TU7A 3KJYA 3UBLA 3Q6OA 2N5FA 5D93A 5IMVA 1B9XC 3GSTA 3V1WA 3D4TA 1K0AA 2GT6A 3HHVA 4Q5FA 2UZ8A 2F8FA 4KCEA 3I6AA 5ECNB 4MPGA 3LG6A 2YJHA 4GF0A 1J0FA 5IMFA 1GSEA 1O7UA 4OCEA 4XTSA 5CO3A 2IMKA 4ECBA 1X0RA 2JSZA 4EXJA 4TR1A 1USBA 3F3RA 1QGVA 3TOTA 2OACA 3LXZA 1YEXA 4TR3A 5A4VA 3DYRA 1YKAA 4WR5A 5HFKA 2F8AA 1S3CA 1SENA 1SK0A 3EURA 3GTUB 3FZ4A 3NY7A 1LBKA 5CP1A 3F4SA 2F3MA 3IHGA 5H5QA 4LMVA 3QAVA 2E7PA 1PKZA 2NPBA 4MJBA 1J08A 1B4QA 2JZRA 2V1MA 4YAPA 1OC8A 2LRCA 4TKYA 3PGTA 2X8GA 3HJMA 4OMVA 1HNBA 4AJ7A 3F0IA 1EV4A 5HR3A 4KAEA 1GTBA 5ELAA 4YQUA 3WGEA 2QA2A 5J5NA 3DWVA 2LNTA 1WMJA 1XOBA 1ZYEA 2WDUA 2QKEA 4MABA 5AGYA 4IGJA 2QA1A 3GX8A 1AAZA 3DVXA 1K0DA 2OBIA 1DBYA 1HF2A 2X8CA 2K8SA 1GTIA 5HR1A 4YKFA 4H86A 4FYUA 1J9BA 4G19A 1V9WA 4BVXB 5IO2A 3RPPA 3APSA 3D22A 1V98A 3ERGA 5DJLA 5EZBA 4GCIA 3D3UA 1TP9A 5FHIA 3MDKA 2C80A 3CSJA 4PTSA 1PMTA 2H0HA 5G30A 3QFAC 2MYGA 4N11A 1K0NA 3GMFA 4MA9A 3U5RE 1URMA 4TXVA 4N0ZA 3A3TA 2VLVA 7GSSA 1NHYA 4I2UA 4KDYA 4K8MA 3H8QA 3UARA 1NW2A 3C73A 1GSYA 3DRNA 2E2GA 3E0UA 2VCZA 3H4KA 4IQAA 2R3XA 5HQPA 5AIVA 3FW2A 3HDCA 3GHAA 1AUCA 5G5EA 4DGFA 3LW9A 3LYPA 3F3QA 4JR6A 4MJCA 2GSTA 5EUWA 4EVMA 3BCIA 5H5SA 1XVQA 2HZEB 3E9JB 2C3NA 1M3JA 4D73A 2YWOA 1PL2A 1KEBA 1TRWA 3IH8A 2KLXA 3UMAA 5CRGA 2D2ZA 3QR6A 2IL3A 1SL1B 2HT9A 4MLYA 2H1AA 1JZOA 1PRXA 3J7Yk 2WFCA 1EV9A 6GSUA 1XBSA 3D21A 2VIMA 2HXKA 4FYCA 4EC0A 2MMNA 4EO3A 3GURA 2H6ZA 4XRAA 1AQWA 1XZOA 3GKXA 1BAYA 1YF1A 2JZTA 3J7Yb 2NTOA 2TRXA 3FR9A 5ECLB 5INYA 4NPBA 1U88A 3W8SA 3DD3A 1ILOA 2FGXA 3US3A 3GKNA 2ZOAA 1JLVA 2C0EA 3EPTA 1M9BA 2RIIA 5FT3A 2F51A 5KOXA 1R26A 3FRCA 4KW6A 1SBOA 3DJAA 2CA8A 1THNB 3KTBA 3TRPA 1TIDB 3WT1A 4TRXA 2H76A 3F8UA 2KP1A 3GRXA 3TKSA 2VL2C 3P2AA 4XS4B 4KE3A 3QPMA 1FVKA 2LJRA 3IV4A 4TR4A 2P31A 2VM1A 3TDGA 4QL9A 2RLIA 1XG8A 3LWAA 4NV2A 1R7HA 2C0DA 2FWFA 3JCML 4HDEA 3QOUA 1T1VA 5EPFA 3W6GA 3O76A 4F03A 4MF7A 1GULA 5KN0A 2QGVA 1ZYPA 1V40A 2L6CA 4Q5RA 1WIKA 1MD3A 4ILFA 2LNSA 4JZQA 4RI7A 3KD0A 5GAND 2C8UA 4GSSA 3DXBA 1O8XA 5IPGA 3TKRA 3KP9A 4AE2A 4ZB9A 3MOGA 2ZO9B 1JZDA 4K2XA 5IMZA 3G9BA 3H1NA 1GLQA 2XHFA 4EDZA 1A2MA 1O81A 3APQA 4PUFC 3VPQA 3GYKA 1Z7PA 4RI6A 2PBJA 5B8AA 3D03A 4DMGA 1F3AA 1M9AA 3O3TA 2IWTA 4I2TA 1ERWA 4DSRA 16GSA 4N10A 1UA5A 5IIZA 3C1RA 1G7EA 2LSTA 3FHKA 3HZ4A 3GKKA 4POBA 4MNNA 2F9SA 1J7XA 2AJQB 4MF6A 2RM6A 2IJYA 4USSA 1F2EA 1UVZA 4MZWA 3D0ZA 2HNLA 1PSQA 1PX7A 2PVOC 3RDWA 1AXDA 3IHQA 3LGCA 2LTKA 3F6DA 2FWHA 5ABRA 3EYTA 2XPEA 2V6KA 3GHFA 3FYGA 3GN3A 1SYXA 1SL2B 1WRYA 3WYWA 1XWKA 3G7IA 2FUG2 2VCVA 3L9VA 1M2AA 4NMUA 5DQYA 3ME8A 4IHUA 4HQSA 3IDVA 4OFTA 2IFQA 3C0KA 2BMXA 1N2AA 5D9TA 3M1GA 3C7MA 3CSHA 2AHEA 4BVYA 2VLTA 1NM3A 4K5SA 2AB6A 4DEJA 2PUKC 4HJ2A 3VWUA 2H1GA 2H19A 3F63A 4DSSB 2PPTA 2H01A 4G0KA 1BG5A 4WR4A 2TRCP 3ERFA 3RAZA 4EE0A 1H4OA 1YZXA 2A2RA 4POLA 1DE2A 3H93A 2WCIA 3F4TA 3IPZA 3L0HA 2YCDA 4F9ZA 2PMTA 2OA7A 1WWJA 2QC7A 3IH9A 4PNGA 2J9HA 5ECIB 1FB0A 3LKLA 4KDUA 1K3OA 4ICYA 2G0FA 2MBSA 4L0UA 4HOJA 3GVLA 2H1DA 1M7TA 3UAPA 3EE2A 2GDRA 5CRWA 1ON4A 5D9XA 4NXIA 3K50A 5ECQB 1HNAA 3GNJA 1GTUA 4XS5A 2FY6A 1EP7A 3FR3A 5GAPD 3V97A 1GUHA 2X8HA 3TJBA 2B78A 4ACSA 2CVDA 2H72A 1JFUA 4JC0A 1EP8A 1HD2A 2PWJA 4MPFA 3LXTA 4HSCX 3RHCA 3MWHA 5IPHA 1GSSA 5DJMA 1ZCPA 3NZNA 2KHPA 2PN8A 2LEGA 1XWBA 1QQ2A 2FWGA 3L9UA 2VL2A 3P90A 1OC3A 3IK9A 1T3BA 2A4HA 1FG4A 1EOHA 2C1YA 4XS1A 2B7KA 5EY6A 1F37A 3PPUA 4HYLA 2P0GA 4OD7A 1EGRA 2E2MA 5IQYA 2O85A 3HVNA 4L0WA 4TN8A 2L5OA 1ACVA 3TOUA 2FLSA 2CAQA 3W8JA 3HD5A 3GL5A 2X4AA 4XCSA 2HYXA 2PERA 1Q98A 1XW6A 1ABAA 1IYIA 3N9JA 3D4MA 5ECKB 3ZTLA 4K7NA 5HR0A 3MIXA 3A2WA 2KOKA 3E3EA 1QFNA 4IKHA 2P5QA 5ECMB 1DE1A 2DJ3A 3SWLA 1SJ6A 1FW1A 2E0QA 3H79A 4MZCA 2C0GA 2JACA 4JBBA 5H5RA 2WULA 1GRXA 1SKRB 2L4CA 2GGTA 3VWXA 2PU9C 2YV9A 2YV7A 5HR2A 5D9VA 3ZMLA 1NHOA 3TCOA 4L8EA 5IOXA 3DIEA 2IIYA 5E4WA 5A4WA 4BA7A 5DALB 4BVXA 2DC5A 3CXGA 5AN1A 2CZ2A 4MF5A 2VL9A 4AF2A 2JL4A 2R37A 1N6EA 4HZ4A 2H8LA 1SL0B 3QAGA 5ID2B 4EKZA 2TIRA 1ZGNA 5J4UA 1GH2A 1JHBA 4ML1A 4J57E 1B9YC 1BUZA 1CQHA 4YH2A 3GK7A 2YZUA 1X5CA 3I43A 4G9HA 22GSA 2VUPA 5IMDA 3VPTA 5FWGA 3KMNA 4V1Ap 2FHEA 1ERVA 2OASA 2LKUA 1SK2A 3A2XA 4Q5NA 4IBPA 4J56E 5ECRB 3TRQA 5ENUA 4PQHA 2V2GA 3KH9A 5ECSA 3M9JA 1GSUA 4WKWA 1CQGA 4ZB8A 4KDXA 5A4UA 2CX4A 2H71A 2JSYA 5F05A 4ECIA 3IOSA 1FOVA 2OE0A 3O6TA 4KX4A 1SKSB 1EOGA 2FA4A 4KF9A 2HZEA 4O32A 2DLXA 3VWWA 1Y25A 4ZBBA 4GTUA 1R5PA 3ZREA 2GZZA 4LL4B 3TRXA 4NWYA 1S3AA 1PN0A 3IAS2 3NIVA 4O5QA 2CQ9A 3QAWA 4ZL8A 3FMWA 3FK8A 3HJPA 4YAVA 4A5PA 4FO5A 2GTUA 2B5EA 1S3RA 3LORA 1MTCA 3ERWA 1W4VA 3ZMKA 4WBRD 1PL1A 2X49A 1C72A 1Z6MA 4GSTA 1H75A 3ZIVA 1OKDA 3DUPA 1K3LA 3A5IA 5G1LA 4POMA 3APOA 4X0XA 1U6TA 4HUAA 4MJEA 2YNXA 2A4VA 1F9MA 4MZBA 4QL7A 3KXOA 3P8WA 4YQMA 3V8VA 5CAXA 4KUNA 1AUZA 3KM6A 4BWQA 3VFIA 3LDFA 1MD4A 2V6OA 3I69A 5G5FA 1U3IA 2OJLA 3AGEA 3R3EA 3TGZA 3QDQA 4TXOA 4XS4A 4I8BA 2HE3A 1THXA 2MMOA 3R2QA 1G0TA 1PFOA 2AS0A 3PH9A 4F0CA 4IS0A 2NDOA 4CW9A 4HIZA 1BYEA 4XIHA 4NV5A 2HRFA 4EUYA 3EU4A 2CV4A 1VF4A 5EUSA 1XIYA 3HKRA 4ZB6A 3Q18A 1A23A 1WPIA 2FA8A 1GSFA 2IMIA 5EUXA 1AC1A 2X64A 3ZLPA 2R6KA 1PN9A 5F0GA 5JWQB 3MSZA 5DBQA 1XW9A 1W89A 3LEFA 2P5RA 4P3YB 2I9HA 4KA0A 4D73B 1JZWA 1ZYQB 4WBJA 4V2NA 2VD0A 4GXZA 5D96A 4E8EA 1YY7A 3HJOA 1M99A 2BTOT 3G7JA 4IELA 4ZIJA 2LQOA 1QUWA 2ALBA 3ZVJA 1H4ZA 1HNCA 1OVNA 2DBCA 5B8BA 4LA1A 4MH3A 2KP2A 2H73A 1Z5YE 4CY6A 5IM9A 3VLNA 2OKAA 3U6VA 3VI7A 5LD0A 2OBKA 2M80A 4PX1A 3ZTBA 3ISOA 1Z9HA 3WT2A 1TI3A 4NHWA 2MMAA 2HLSA 1TXXA 5EUZA 5F06A 2A2PA 4O92A 4F82A 1VC1A 1KNGA 1TTZA 4PURA 3L4NA 1GNWA 3TB2A 3EWLA 1RK4A 1VF3A 4X1UA 1V58A 1WOUA 1VRSD 2O87A 2HRNA 1XOAA 4KSOA 4JR4A 8GSSA 5KEJA 2X99A 1RQMA 2B5XA 4PNFA 3HA9A 4IQ1A 4I6XA 4IN0A
chains in the Genus database with same CATH topology
1UC7A 1IYHA 1PA3A 3A2VA 4GQFA 3HVVA 2MBTA 1TRUA 1B48A 1XW5A 1GTAA 1OKTA 5KN3A 1SJIA 4XRDA 4KB3A 4MDCA 3I9V2 1Z6NA 5BMUA 2IN3A 1MEKA 3IBHA 4JE1A 1XCCA 2ON7A 2AUVA 2WGRA 4O5RA 4EIQA 3DMLA 6GSSA 1O8WA 1OC9B 1QXHA 2CVKA 3FZ9A 3C71A 4IVFA 3ZFBA 3CBUA 2JZSA 3PR8A 3KIJA 3EINA 5A5KA 5LNKe 1TJDA 2VM2A 3KZQA 3DORA 4KH7A 4ZILA 4MH2A 2LJAA 3KH7A 4BPYA 5L71A 1GL8A 5KOWA 2C3TA 2EC4A 3S9FA 4GLTA 1A2JA 1TDIA 2WS2A 3IC8A 4HU7A 4G0IA 5KN1A 5COHA 3MYDA 1F6MC 4BWSA 2R2JA 3GSSA 1LU4A 1A8YA 3CMIA 2H0IA 2QSIA 5ECHB 1N8JA 1MDJA 2CVBA 2MZCA 4RQRA 4LMWA 2DJ0A 3BOAA 1V57A 3BCKA 4GRFA 4Z7XA 4TW5A 2C3QA 4K2DA 4IJIA 2VL3A 4BL7B 3QFBC 1JLWA 2GQMA 3BD2A 1FO5A 4PGTA 1ERTA 3LJRA 3TKSE 4CY8A 1X9SB 3QDNA 2HRKA 4AJ8A 3M3MA 5ECOB 3ZVJD 1X9WB 3CYNA 5CREA 4K0NA 4G2EA 4Z2RA 2J23A 1QMVA 4MCUA 5BRTA 3FR6A 2R4VA 3IRAA 5IOWA 2R0PA 4PUAA 4ZL7A 2WRTA 4HS1A 3CRTA 2HZFA 4J2FA 2DMMA 2EIOA 1KTEA 2LV3A 3HVXA 1ZZYA 4F2IA 2GVPA 5E59A 2V32A 4TOPA 2L59A 4ZL9A 2KUCA 10GSA 5CRHA 1OAZA 4FIWA 3IXRA 1O6JA 4OO5A 1YKCA 5DAKB 5DVBA 2GQLA 4QQ7A 1Q4JA 4ULXA 4K0GA 2CT6A 2VOCA 4HZ2A 3GH9A 1XWGA 1YDKA 2VCXA 4K7OA 2CZ3A 1EEJA 2GLRA 4O5UA 2H74A 2VLUA 4ZXGA 5B6MA 3UVTA 1R4WA 4TR0A 3GTUA 2RUEA 4EIPA 5J3RA 2DJJA 2LUSA 3EU3A 1ZL9A 4DVCA 1B4PA 2YPMA 5DALA 1JZRA 2YANA 4WF5A 4EL1A 2H75A 1GP1A 4JU5A 3ZL5A 3IA1A 4F0BA 5ID2A 2R0CA 3M8NA 4K6XA 5IMAA 3KMOA 3CTFA 2YOIA 4JEDA 3KEBA 1TOFA 1ST9A 17GSA 5GSSA 2K6VA 2DJ1A 4RUVA 4YQVA 3TKSC 2OE3A 2ZNMA 2YZHA 6GSTA 3GUSA 2G2QA 3TKQA 3IAM2 4HEA2 1MDKA 1M2BA 2Z9SA 4ZBDA 5C04A 1QK8A 1K0OA 3HY2A 2DSAA 2AV4A 2LRTA 3ZIJA 2BJXA 2H0GA 2JU5A 1NSWA 1E6BA 2DIZA 3TJJA 2I3YA 3HVSA 2FCHA 1TK5B 4OFNA 1K0BA 3FEUA 1YF0A 2B5YA 3UBKA 2CX3A 5LCZA 2C0FA 3L78A 5HFIA 1FHEA 2LRNA 3SBCA 1X5DA 2GQKA 2EIQA 3LFLA 2MMZA 4HJMA 4DSQA 4I5QA 5HFGA 1G6YA 2IMFA 1BX9A 4TR1B 4RQXA 2NBSA 3ZITA 2RRLA 2LQQA 1TK8B 3TJFA 3KP8A 5B6NA 3GFKA 1G6WA 1Y6EA 3K8NA 1EZKA 3WGXA 3OR5A 3RBTA 1FOHA 2YWNA 2I81A 2IMDA 4OO4A 5AISA 1T4YA 2VD1A 3HXSA 3WD6A 2VCWA 1M0UA 12GSA 1GLPA 1XWAA 1HYUA 4V1Ag 3BJ5A 2HSYA 1GNEA 1TW9A 1XWCA 4G0LA 3LYKA 2DIYA 4HU9A 1ZMAA 4ECJA 1TRSA 4PXOA 2ZUPA 2NVLA 1SYRA 1KBNA 2H70A 1SKWB 4E8HA 2OE1A 1GUMA 1YQ1A 3HCZA 5CYYA 3DVWA 3TUEA 2YN1A 1XPVA 3UJ1A 1K32A 3ED3A 5G31A 2RUFA 2HI7A 4FYBA 4K1FA 1B8XA 3C8EA 3ZFLA 3DKSA 3TKPA 4G10A 3F6FA 1V2AA 1OE8A 4PQ1A 2HSHA 9GSSA 3M0FA 2GZYA 2XC2A 5C00A 1ML6A 1M2DA 4NHZA 2DKIA 4WETA 1S3DA 4EDYA 3EVIA 4ECCA 3F4RA 2LJKA 4AGSA 2GT5A 2V41A 5EL8A 3KCMA 2N5AA 1BQ7A 4MP4A 1DSBA 1HQOA 1T7PB 1Z7RA 4OCFA 11GSA 1PKWA 5D8IA 1FAAA 3UIWA 2L5LA 1SJZA 4LLRA 2FWEA 1SD8A 4L1CA 4AEJA 6GSVA 4JRRA 2YWIA 5F8BA 3VI5A 2YWMA 5DQSA 4KGIA 1PX6A 2B6MA 2HFDA 1G7OA 2C4JA 2ZCTA 1BJXA 4N0VA 2RM5A 3EMXA 2XBQA 1XXUA 6GSWA 2DXLA 2B1KA 2H1BA 1WE0A 1VF1A 3A5WA 4KCAA 4X43A 1AW9A 1OYJA 1WP0A 3RHBA 2VCTA 4I97A 2XBIA 4N30A 4KNDA 4WF4A 1A24A 3GIXA 3GL3A 5B7CA 1E2YA 4K5RA 4CHSA 2PGTA 1THOA 4POKA 1AIUA 3WGDA 4TXOB 5DCGA 3GV1A 4L8KA 4KSMA 1U87A 3G7YA 3D5JA 4OWYA 4K7IA 2B1LA 4TVEA 2B3SA 3KGKA 2GSSA 4GSNA 1UN2A 4CDOA 2WB9A 3C1SA 3UEMA 3HYPA 4PQIA 5JCUA 4K9ZA 1OC9A 2JADA 1O73A 4X4JA 2IPAA 3VWVA 1AQXA 1PQNA 3BBYA 3ME7A 5D73A 1YEPA 4GWRA 1FC6A 1TU8A 1XFLA 3QCPA 2O7KA 3NOFA 1GSDA 4L5OA 3CSIA 1BEDA 2H66A 3MNGA 4V2LA 2VCQA 2L6DA 5ECPB 6GSXA 3IR4A 2I4AA 1SK1A 3D6IA 2A2SA 3FKFA 4XS6A 4FH8A 3GKMA 4IJ3A 2VAFA 3UVHA 3QMXA 4IP6A 4ISDA 5F07A 4LL1B 4GQCA 2H6YA 1MDIA 2EIRA 1ZOFA 3P7XA 1A8LA 3IK7A 5GZZB 3LQ7A 1A0FA 4DSSA 2B7JA 3N5OA 3UOMA 3MAKA 5IO0A 4O7HA 1EWXA 5G1KA 3PINA 2ON5A 2WZ9A 6GSYA 1X5EA 2R0GA 5J41A 1I9DA 3IE3A 4BL7A 2M72A 1VF2A 2CAIA 2VO4A 1FC7A 3DEXA 5GSTA 1X9MB 1ERUA 2H30A 2O89A 5J9CA 3L9SA 4Q5QA 1AQVA 1EGOA 2M46A 2PVQA 5CNWA 3EMPA 3DGQA 1TKDB 3ZYWA 3FZ5A 5KN2A 1K0CA 20GSA 3HZ8A 5JCGA 1BPLA 1FC9A 4XHMA 2WJUA 2GSQA 1TI1A 4ML6A 3GH6A 5D9WA 3M9KA 2O8VB 4L5LA 1SU9A 5JWRB 2DJKA 3CTGA 1OE7A 3FY7A 3F9UA 3KTLA 4AJ6A 3LSZA 2DXNA 2H6XA 2N5BA 5ELGA 1EEMA 4WEYA 2I1UA 2K8VA 4MJAA 1PD21 3EC3A 4Z2TA 2DMLA 1DUGA 2K9FA 2OADA 2GZPA 2L57A 5DAKA 2IMEA 4IW9A 3Q19A 19GSA 3FZAA 1GWCA 1XVWA 1ZYNA 4MK3A 2DKHA 2HRAA 3TJGA 1I5GA 1YJ6A 3TJKA 2L4QA 4NAXA 2DJ2A 1F3BA 3CRUA 1Z3EA 2GSRA 1T8EB 3Q74A 1LJRA 4FQUA 2R5GA 18GSA 1GSQA 1WJKA 3AY8A 1A0RP 1RW1A 4Z2UA 4EF0A 1FB6A 1K0MA 1R5AA 2IFQB 4OFMA 4MMMA 2AYTA 2FNOA 2HSMA 2XPDA 1N6DA 2K18A 4BVYB 2AAWA 2FD3A 5AIXA 3ZZXA 5DCHA 5JWOB 3VURA 4YKGA 2REMA 2YJ7A 2YP6A 3GA4A 3IC4A 1T00A 1K3YA 1FCFA 5CRDA 5DDLA 5IMCA 4WXTA 1SD9A 1FVJA 3UL3A 4GHNA 1PGTA 5G2ZA 2ES7A 1GUKA 13GSA 1N6FA 2GS3A 5J9BA 1A2LA 4ID0A 1TK0B 3VK9A 4HI7A 1U3AA 3QD9A 4V2MA 3RPNA 5EVOA 14GSA 3GX0A 5JCWA 2LS5A 1O85A 1VGLA 4ZBAA 1T4ZA 3ZRDA 1TRVA 4IP1A 4HQZA 1TU7A 3KJYA 3UBLA 3Q6OA 2N5FA 5D93A 5IMVA 1B9XC 3GSTA 3V1WA 3D4TA 1K0AA 2GT6A 3HHVA 4Q5FA 2UZ8A 2F8FA 4KCEA 3I6AA 5ECNB 4MPGA 3LG6A 2YJHA 4GF0A 1J0FA 5IMFA 1GSEA 1O7UA 4OCEA 4XTSA 5CO3A 2IMKA 4ECBA 1X0RA 2JSZA 4EXJA 4TR1A 1USBA 3F3RA 1QGVA 3TOTA 2OACA 3LXZA 1YEXA 4TR3A 5A4VA 3DYRA 1YKAA 4WR5A 5HFKA 2F8AA 1S3CA 1SENA 1SK0A 3EURA 3GTUB 3FZ4A 1LBKA 5CP1A 3F4SA 2F3MA 3IHGA 5H5QA 4LMVA 3QAVA 2E7PA 1PKZA 2NPBA 4MJBA 1J08A 1B4QA 2JZRA 2V1MA 4YAPA 1OC8A 2LRCA 4TKYA 3PGTA 2X8GA 3HJMA 4OMVA 1HNBA 4AJ7A 3F0IA 1EV4A 5HR3A 4KAEA 1GTBA 5ELAA 4YQUA 3WGEA 2QA2A 5J5NA 3DWVA 2LNTA 1WMJA 1XOBA 1ZYEA 2WDUA 2QKEA 4MABA 5AGYA 4IGJA 2QA1A 3GX8A 1AAZA 3DVXA 1K0DA 2OBIA 1DBYA 2X8CA 2K8SA 1GTIA 5HR1A 4YKFA 4H86A 4FYUA 1J9BA 4G19A 1V9WA 4BVXB 5IO2A 3RPPA 3APSA 3D22A 1V98A 3ERGA 5DJLA 4GCIA 1TP9A 5FHIA 3MDKA 2C80A 3CSJA 4PTSA 1PMTA 2H0HA 5G30A 3QFAC 2MYGA 4N11A 1K0NA 3GMFA 4MA9A 3U5RE 1URMA 4TXVA 4N0ZA 3A3TA 2VLVA 7GSSA 1NHYA 4I2UA 4KDYA 4K8MA 3H8QA 3UARA 1NW2A 3C73A 1GSYA 3DRNA 2E2GA 3E0UA 2VCZA 3H4KA 4IQAA 2R3XA 5HQPA 5AIVA 3FW2A 3HDCA 3GHAA 1AUCA 5G5EA 3LW9A 3LYPA 3F3QA 4JR6A 4MJCA 2GSTA 4EVMA 3BCIA 5H5SA 1XVQA 2HZEB 3E9JB 2C3NA 4D73A 2YWOA 1PL2A 1KEBA 1TRWA 2KLXA 3UMAA 5CRGA 2D2ZA 3QR6A 2IL3A 1SL1B 2HT9A 4MLYA 2H1AA 1JZOA 1PRXA 3J7Yk 2WFCA 1EV9A 6GSUA 1XBSA 3D21A 2VIMA 2HXKA 4FYCA 4EC0A 2MMNA 4EO3A 3GURA 2H6ZA 4XRAA 1AQWA 1XZOA 3GKXA 1BAYA 1YF1A 2JZTA 3J7Yb 2NTOA 2TRXA 3FR9A 5ECLB 5INYA 4NPBA 1U88A 3W8SA 3DD3A 1ILOA 2FGXA 3US3A 3GKNA 2ZOAA 1JLVA 2C0EA 3EPTA 1M9BA 2RIIA 5FT3A 2F51A 5KOXA 1R26A 3FRCA 4KW6A 3DJAA 2CA8A 3KTBA 3TRPA 3WT1A 4TRXA 2H76A 3F8UA 2KP1A 3GRXA 3TKSA 2VL2C 3P2AA 4XS4B 4KE3A 3QPMA 1FVKA 2LJRA 3IV4A 4TR4A 2P31A 2VM1A 3TDGA 4QL9A 2RLIA 3LWAA 4NV2A 1R7HA 2C0DA 2FWFA 3JCML 4HDEA 3QOUA 1T1VA 5EPFA 3W6GA 3O76A 4F03A 4MF7A 1GULA 5KN0A 2QGVA 1ZYPA 1V40A 2L6CA 4Q5RA 1WIKA 1MD3A 4ILFA 2LNSA 4JZQA 4RI7A 3KD0A 5GAND 2C8UA 4GSSA 3DXBA 1O8XA 5IPGA 3TKRA 3KP9A 4AE2A 4ZB9A 3MOGA 2ZO9B 1JZDA 4K2XA 5IMZA 3G9BA 3H1NA 1GLQA 2XHFA 4EDZA 1A2MA 1O81A 3APQA 4PUFC 3VPQA 3GYKA 1Z7PA 4RI6A 2PBJA 5B8AA 3D03A 1F3AA 1M9AA 3O3TA 2IWTA 4I2TA 1ERWA 4DSRA 16GSA 4N10A 1UA5A 5IIZA 3C1RA 1G7EA 2LSTA 3FHKA 3HZ4A 3GKKA 4POBA 4MNNA 2F9SA 1J7XA 2AJQB 4MF6A 2RM6A 2IJYA 4USSA 1F2EA 1UVZA 4MZWA 3D0ZA 2HNLA 1PSQA 1PX7A 2PVOC 3RDWA 1AXDA 3IHQA 3LGCA 2LTKA 3F6DA 2FWHA 5ABRA 3EYTA 2XPEA 2V6KA 3GHFA 3FYGA 3GN3A 1SYXA 1SL2B 1WRYA 3WYWA 1XWKA 3G7IA 2FUG2 2VCVA 3L9VA 1M2AA 4NMUA 5DQYA 3ME8A 4IHUA 4HQSA 3IDVA 4OFTA 2IFQA 2BMXA 1N2AA 5D9TA 3M1GA 3C7MA 3CSHA 2AHEA 4BVYA 2VLTA 1NM3A 4K5SA 2AB6A 4DEJA 2PUKC 4HJ2A 3VWUA 2H1GA 2H19A 3F63A 4DSSB 2PPTA 2H01A 4G0KA 1BG5A 4WR4A 2TRCP 3ERFA 3RAZA 4EE0A 1H4OA 1YZXA 2A2RA 4POLA 1DE2A 2WCIA 3F4TA 3H93A 3IPZA 3L0HA 2YCDA 4F9ZA 2PMTA 2OA7A 1WWJA 2QC7A 4PNGA 2J9HA 5ECIB 1FB0A 4KDUA 1K3OA 4ICYA 2G0FA 2MBSA 4L0UA 4HOJA 2H1DA 1M7TA 3UAPA 3EE2A 2GDRA 5CRWA 1ON4A 5D9XA 4NXIA 3K50A 5ECQB 1HNAA 3GNJA 1GTUA 2FY6A 1EP7A 3FR3A 5GAPD 1GUHA 2X8HA 3TJBA 4ACSA 2CVDA 2H72A 1JFUA 4JC0A 1EP8A 1HD2A 2PWJA 4MPFA 3LXTA 3RHCA 3MWHA 5IPHA 1GSSA 5DJMA 1ZCPA 3NZNA 2KHPA 2PN8A 2LEGA 1XWBA 1QQ2A 2FWGA 3L9UA 2VL2A 3P90A 1OC3A 3IK9A 1T3BA 2A4HA 1FG4A 1EOHA 2C1YA 4XS1A 2B7KA 5EY6A 1F37A 3PPUA 2P0GA 4OD7A 1EGRA 2E2MA 5IQYA 2O85A 4L0WA 4TN8A 2L5OA 1ACVA 3TOUA 2FLSA 2CAQA 3W8JA 3HD5A 3GL5A 2X4AA 4XCSA 2HYXA 2PERA 1Q98A 1XW6A 1ABAA 1IYIA 3N9JA 3D4MA 5ECKB 3ZTLA 4K7NA 5HR0A 3MIXA 3A2WA 2KOKA 3E3EA 1QFNA 4IKHA 2P5QA 5ECMB 1DE1A 2DJ3A 3SWLA 1SJ6A 1FW1A 2E0QA 3H79A 4MZCA 2C0GA 2JACA 4JBBA 5H5RA 2WULA 1GRXA 1SKRB 2L4CA 2GGTA 3VWXA 2PU9C 2YV9A 2YV7A 5HR2A 5D9VA 3ZMLA 1NHOA 3TCOA 4L8EA 5IOXA 3DIEA 2IIYA 5E4WA 5A4WA 4BA7A 5DALB 4BVXA 2DC5A 3CXGA 5AN1A 2CZ2A 4MF5A 2VL9A 4AF2A 2JL4A 2R37A 1N6EA 4HZ4A 2H8LA 1SL0B 3QAGA 5ID2B 4EKZA 2TIRA 1ZGNA 5J4UA 1GH2A 1JHBA 4ML1A 4J57E 1B9YC 1CQHA 4YH2A 2YZUA 1X5CA 3I43A 4G9HA 22GSA 2VUPA 5IMDA 3VPTA 5FWGA 3KMNA 4V1Ap 2FHEA 1ERVA 2LKUA 1SK2A 3A2XA 4Q5NA 4IBPA 4J56E 5ECRB 3TRQA 5ENUA 4PQHA 2V2GA 3KH9A 5ECSA 3M9JA 1GSUA 4WKWA 1CQGA 4ZB8A 4KDXA 5A4UA 2CX4A 2H71A 2JSYA 5F05A 4ECIA 3IOSA 1FOVA 2OE0A 3O6TA 4KX4A 1SKSB 1EOGA 2FA4A 4KF9A 2HZEA 4O32A 2DLXA 3VWWA 1Y25A 4ZBBA 4GTUA 1R5PA 3ZREA 2GZZA 4LL4B 3TRXA 4NWYA 1S3AA 1PN0A 3IAS2 3NIVA 4O5QA 2CQ9A 3QAWA 4ZL8A 3FMWA 3FK8A 3HJPA 4YAVA 4A5PA 4FO5A 2GTUA 2B5EA 3LORA 1MTCA 3ERWA 1W4VA 3ZMKA 4WBRD 1PL1A 2X49A 1C72A 1Z6MA 4GSTA 1H75A 3ZIVA 1OKDA 3DUPA 1K3LA 3A5IA 5G1LA 4POMA 3APOA 4X0XA 1U6TA 4HUAA 4MJEA 2YNXA 2A4VA 1F9MA 4MZBA 4QL7A 3KXOA 3P8WA 4YQMA 5CAXA 4KUNA 3KM6A 4BWQA 3VFIA 1MD4A 2V6OA 3I69A 5G5FA 1U3IA 2OJLA 3R3EA 3TGZA 4TXOA 4XS4A 4I8BA 2HE3A 1THXA 2MMOA 3R2QA 1G0TA 3PH9A 4F0CA 4IS0A 2NDOA 4CW9A 4XIHA 1BYEA 4NV5A 2HRFA 4EUYA 3EU4A 2CV4A 1VF4A 1XIYA 3HKRA 4ZB6A 3Q18A 1A23A 1WPIA 2FA8A 1GSFA 2IMIA 1AC1A 2X64A 3ZLPA 2R6KA 1PN9A 5F0GA 5JWQB 3MSZA 5DBQA 1XW9A 1W89A 3LEFA 2P5RA 4P3YB 2I9HA 4KA0A 4D73B 1JZWA 1ZYQB 4WBJA 4V2NA 2VD0A 4GXZA 5D96A 4E8EA 1YY7A 3HJOA 1M99A 2BTOT 3G7JA 4IELA 4ZIJA 2LQOA 1QUWA 2ALBA 3ZVJA 1HNCA 1OVNA 2DBCA 5B8BA 4LA1A 4MH3A 2KP2A 2H73A 1Z5YE 4CY6A 5IM9A 3VLNA 2OKAA 3U6VA 3VI7A 5LD0A 2OBKA 2M80A 4PX1A 3ISOA 1Z9HA 3WT2A 1TI3A 4NHWA 2MMAA 2HLSA 1TXXA 5F06A 2A2PA 4O92A 4F82A 1KNGA 1TTZA 4PURA 3L4NA 1GNWA 3TB2A 3EWLA 1RK4A 1VF3A 4X1UA 1V58A 1WOUA 1VRSD 2O87A 2HRNA 1XOAA 4KSOA 4JR4A 8GSSA 5KEJA 2X99A 1RQMA 2B5XA 4PNFA 3HA9A 4IQ1A 4I6XA 4IN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UC7 A;  1IYH A;  1PA3 A;  3A2V A;  4GQF A;  3HVV A;  2MBT A;  1TRU A;  1B48 A;  1XW5 A;  1GTA A;  1OKT A;  5KN3 A;  1SJI A;  4XRD A;  4KB3 A;  4MDC A;  3I9V 2;  1Z6N A;  2IN3 A;  1MEK A;  3IBH A;  4JE1 A;  1XCC A;  2ON7 A;  2AUV A;  2WGR A;  4O5R A;  3DML A;  6GSS A;  1O8W A;  1OC9 B;  1QXH A;  2CVK A;  3FZ9 A;  3C71 A;  4IVF A;  3ZFB A;  3CBU A;  2JZS A;  3PR8 A;  3KIJ A;  3EIN A;  5A5K A;  5LNK e;  1TJD A;  2VM2 A;  3KZQ A;  4KH7 A;  4ZIL A;  4MH2 A;  2LJA A;  3KH7 A;  4BPY A;  5L71 A;  1GL8 A;  2C3T A;  2EC4 A;  3S9F A;  4GLT A;  1A2J A;  1TDI A;  2WS2 A;  4HU7 A;  5KN1 A;  5COH A;  1F6M C;  4BWS A;  2R2J A;  3GSS A;  1LU4 A;  1A8Y A;  3CMI A;  2H0I A;  2QSI A;  5ECH B;  1N8J A;  1MDJ A;  2CVB A;  2MZC A;  4RQR A;  4LMW A;  2DJ0 A;  3BOA A;  1V57 A;  3BCK A;  4GRF A;  4Z7X A;  4TW5 A;  2C3Q A;  4K2D A;  4IJI A;  2VL3 A;  3QFB C;  1JLW A;  2GQM A;  3BD2 A;  1FO5 A;  4PGT A;  1ERT A;  3LJR A;  3TKS E;  1X9S B;  3QDN A;  4AJ8 A;  3M3M A;  5ECO B;  3ZVJ D;  1X9W B;  3CYN A;  5CRE A;  4K0N A;  4G2E A;  2J23 A;  1QMV A;  4MCU A;  3FR6 A;  2R4V A;  3IRA A;  5IOW A;  4PUA A;  4ZL7 A;  2WRT A;  4HS1 A;  3CRT A;  2HZF A;  4J2F A;  2DMM A;  2EIO A;  1KTE A;  2LV3 A;  3HVX A;  1ZZY A;  4F2I A;  2GVP A;  5E59 A;  2V32 A;  4TOP A;  2L59 A;  4ZL9 A;  2KUC A;  10GS A;  5CRH A;  1OAZ A;  4FIW A;  3IXR A;  1O6J A;  4OO5 A;  1YKC A;  5DAK B;  5DVB A;  2GQL A;  4QQ7 A;  1Q4J A;  4ULX A;  4K0G A;  2CT6 A;  2VOC A;  4HZ2 A;  3GH9 A;  1XWG A;  1YDK A;  2VCX A;  4K7O A;  2CZ3 A;  1EEJ A;  2GLR A;  2H74 A;  2VLU A;  4ZXG A;  5B6M A;  3UVT A;  1R4W A;  4TR0 A;  3GTU A;  2RUE A;  5J3R A;  2DJJ A;  2LUS A;  3EU3 A;  1ZL9 A;  4DVC A;  1B4P A;  2YPM A;  5DAL A;  1JZR A;  2YAN A;  4WF5 A;  4EL1 A;  2H75 A;  1GP1 A;  4JU5 A;  3ZL5 A;  3IA1 A;  4F0B A;  5ID2 A;  3M8N A;  4K6X A;  5IMA A;  3KMO A;  3CTF A;  2YOI A;  4JED A;  3KEB A;  1TOF A;  1ST9 A;  17GS A;  5GSS A;  2K6V A;  2DJ1 A;  4RUV A;  4YQV A;  3TKS C;  2OE3 A;  2ZNM A;  2YZH A;  6GST A;  3GUS A;  2G2Q A;  3TKQ A;  3IAM 2;  4HEA 2;  1MDK A;  1M2B A;  2Z9S A;  4ZBD A;  5C04 A;  1QK8 A;  1K0O A;  3HY2 A;  2DSA A;  2AV4 A;  2LRT A;  3ZIJ A;  2BJX A;  2H0G A;  2JU5 A;  1NSW A;  1E6B A;  2DIZ A;  3TJJ A;  2I3Y A;  3HVS A;  2FCH A;  1TK5 B;  4OFN A;  1K0B A;  3FEU A;  1YF0 A;  2B5Y A;  3UBK A;  2CX3 A;  5LCZ A;  2C0F A;  3L78 A;  5HFI A;  1FHE A;  2LRN A;  3SBC A;  1X5D A;  2GQK A;  2EIQ A;  3LFL A;  2MMZ A;  4HJM A;  4DSQ A;  4I5Q A;  5HFG A;  1G6Y A;  2IMF A;  1BX9 A;  4TR1 B;  4RQX A;  2NBS A;  3ZIT A;  2LQQ A;  1TK8 B;  3TJF A;  3KP8 A;  5B6N A;  3GFK A;  1G6W A;  1Y6E A;  3K8N A;  1EZK A;  3WGX A;  3OR5 A;  3RBT A;  2YWN A;  2I81 A;  2IMD A;  4OO4 A;  5AIS A;  1T4Y A;  2VD1 A;  3HXS A;  3WD6 A;  2VCW A;  1M0U A;  12GS A;  1GLP A;  1XWA A;  1HYU A;  4V1A g;  3BJ5 A;  2HSY A;  1GNE A;  1TW9 A;  1XWC A;  3LYK A;  2DIY A;  4HU9 A;  1ZMA A;  4ECJ A;  1TRS A;  4PXO A;  2ZUP A;  2NVL A;  1SYR A;  1KBN A;  2H70 A;  1SKW B;  4E8H A;  2OE1 A;  1GUM A;  1YQ1 A;  3HCZ A;  5CYY A;  3DVW A;  3TUE A;  2YN1 A;  1XPV A;  3UJ1 A;  3ED3 A;  5G31 A;  2RUF A;  2HI7 A;  4FYB A;  4K1F A;  1B8X A;  3C8E A;  3ZFL A;  3DKS A;  3TKP A;  4G10 A;  3F6F A;  1V2A A;  1OE8 A;  4PQ1 A;  2HSH A;  9GSS A;  3M0F A;  2GZY A;  2XC2 A;  5C00 A;  1ML6 A;  1M2D A;  4NHZ A;  4WET A;  1S3D A;  4EDY A;  3EVI A;  4ECC A;  3F4R A;  2LJK A;  4AGS A;  2GT5 A;  2V41 A;  5EL8 A;  3KCM A;  2N5A A;  1BQ7 A;  4MP4 A;  1DSB A;  1HQO A;  1T7P B;  1Z7R A;  4OCF A;  11GS A;  1PKW A;  5D8I A;  1FAA A;  3UIW A;  2L5L A;  1SJZ A;  4LLR A;  2FWE A;  1SD8 A;  6GSV A;  4JRR A;  2YWI A;  5F8B A;  3VI5 A;  2YWM A;  5DQS A;  4KGI A;  1PX6 A;  2B6M A;  2HFD A;  1G7O A;  2C4J A;  2ZCT A;  1BJX A;  4N0V A;  2RM5 A;  3EMX A;  2XBQ A;  1XXU A;  6GSW A;  2B1K A;  2H1B A;  1WE0 A;  1VF1 A;  3A5W A;  4KCA A;  4X43 A;  1AW9 A;  1OYJ A;  1WP0 A;  3RHB A;  2VCT A;  4I97 A;  2XBI A;  4N30 A;  4KND A;  4WF4 A;  1A24 A;  3GIX A;  3GL3 A;  5B7C A;  1E2Y A;  4CHS A;  2PGT A;  1THO A;  4POK A;  1AIU A;  3WGD A;  4TXO B;  5DCG A;  3GV1 A;  4KSM A;  1U87 A;  3G7Y A;  3D5J A;  4OWY A;  4K7I A;  2B1L A;  4TVE A;  2B3S A;  3KGK A;  2GSS A;  4GSN A;  1UN2 A;  4CDO A;  2WB9 A;  3C1S A;  3UEM A;  3HYP A;  4PQI A;  5JCU A;  4K9Z A;  1OC9 A;  2JAD A;  1O73 A;  2IPA A;  3VWV A;  1AQX A;  1PQN A;  3BBY A;  3ME7 A;  5D73 A;  1YEP A;  4GWR A;  1TU8 A;  1XFL A;  3QCP A;  2O7K A;  3NOF A;  1GSD A;  4L5O A;  3CSI A;  1BED A;  2H66 A;  3MNG A;  4V2L A;  2VCQ A;  2L6D A;  5ECP B;  6GSX A;  3IR4 A;  2I4A A;  1SK1 A;  3D6I A;  2A2S A;  3FKF A;  4XS6 A;  4FH8 A;  3GKM A;  4IJ3 A;  2VAF A;  3UVH A;  3QMX A;  4IP6 A;  4ISD A;  5F07 A;  4LL1 B;  4GQC A;  2H6Y A;  1MDI A;  2EIR A;  1ZOF A;  3P7X A;  1A8L A;  3IK7 A;  5GZZ B;  3LQ7 A;  1A0F A;  4DSS A;  2B7J A;  3N5O A;  3UOM A;  3MAK A;  5IO0 A;  4O7H A;  1EWX A;  5G1K A;  3PIN A;  2ON5 A;  2WZ9 A;  6GSY A;  1X5E A;  5J41 A;  1I9D A;  3IE3 A;  4BL7 A;  2M72 A;  1VF2 A;  2CAI A;  2VO4 A;  3DEX A;  5GST A;  1X9M B;  1ERU A;  2H30 A;  2O89 A;  5J9C A;  3L9S A;  4Q5Q A;  1AQV A;  1EGO A;  2M46 A;  2PVQ A;  5CNW A;  3EMP A;  3DGQ A;  1TKD B;  3ZYW A;  3FZ5 A;  5KN2 A;  1K0C A;  20GS A;  3HZ8 A;  5JCG A;  4XHM A;  2WJU A;  2GSQ A;  1TI1 A;  4ML6 A;  3GH6 A;  5D9W A;  3M9K A;  2O8V B;  4L5L A;  1SU9 A;  5JWR B;  2DJK A;  3CTG A;  1OE7 A;  3FY7 A;  3F9U A;  3KTL A;  4AJ6 A;  3LSZ A;  2H6X A;  2N5B A;  5ELG A;  1EEM A;  4WEY A;  2I1U A;  2K8V A;  4MJA A;  1PD2 1;  3EC3 A;  2DML A;  1DUG A;  2K9F A;  2OAD A;  2GZP A;  2L57 A;  5DAK A;  2IME A;  4IW9 A;  3Q19 A;  19GS A;  3FZA A;  1GWC A;  1XVW A;  4MK3 A;  3TJG A;  1I5G A;  1YJ6 A;  3TJK A;  2L4Q A;  4NAX A;  2DJ2 A;  1F3B A;  3CRU A;  1Z3E A;  2GSR A;  1T8E B;  3Q74 A;  1LJR A;  2R5G A;  18GS A;  1GSQ A;  1WJK A;  3AY8 A;  1A0R P;  1RW1 A;  4EF0 A;  1FB6 A;  1K0M A;  1R5A A;  2IFQ B;  4OFM A;  4MMM A;  2AYT A;  2FNO A;  2XPD A;  2K18 A;  2AAW A;  2FD3 A;  5AIX A;  3ZZX A;  5DCH A;  5JWO B;  3VUR A;  2REM A;  2YJ7 A;  2YP6 A;  3GA4 A;  3IC4 A;  1T00 A;  1K3Y A;  5CRD A;  5DDL A;  5IMC A;  4WXT A;  1SD9 A;  1FVJ A;  3UL3 A;  1PGT A;  5G2Z A;  2ES7 A;  1GUK A;  13GS A;  2GS3 A;  5J9B A;  1A2L A;  4ID0 A;  1TK0 B;  3VK9 A;  4HI7 A;  1U3A A;  3QD9 A;  4V2M A;  3RPN A;  5EVO A;  14GS A;  3GX0 A;  5JCW A;  2LS5 A;  1O85 A;  1VGL A;  4ZBA A;  1T4Z A;  3ZRD A;  1TRV A;  4IP1 A;  4HQZ A;  1TU7 A;  3KJY A;  3UBL A;  3Q6O A;  2N5F A;  5D93 A;  5IMV A;  1B9X C;  3GST A;  3V1W A;  3D4T A;  1K0A A;  2GT6 A;  3HHV A;  4Q5F A;  2F8F A;  4KCE A;  3I6A A;  5ECN B;  4MPG A;  3LG6 A;  2YJH A;  4GF0 A;  1J0F A;  5IMF A;  1GSE A;  1O7U A;  4OCE A;  4XTS A;  5CO3 A;  2IMK A;  4ECB A;  1X0R A;  2JSZ A;  4EXJ A;  4TR1 A;  1USB A;  3F3R A;  1QGV A;  3TOT A;  2OAC A;  3LXZ A;  1YEX A;  4TR3 A;  5A4V A;  3DYR A;  1YKA A;  4WR5 A;  5HFK A;  2F8A A;  1S3C A;  1SEN A;  1SK0 A;  3EUR A;  3GTU B;  3FZ4 A;  1LBK A;  5CP1 A;  3F4S A;  2F3M A;  5H5Q A;  4LMV A;  3QAV A;  2E7P A;  1PKZ A;  2NPB A;  4MJB A;  1J08 A;  1B4Q A;  2JZR A;  2V1M A;  4YAP A;  1OC8 A;  2LRC A;  4TKY A;  3PGT A;  2X8G A;  3HJM A;  4OMV A;  1HNB A;  4AJ7 A;  3F0I A;  1EV4 A;  5HR3 A;  4KAE A;  1GTB A;  5ELA A;  4YQU A;  3WGE A;  5J5N A;  3DWV A;  2LNT A;  1WMJ A;  1XOB A;  1ZYE A;  2WDU A;  2QKE A;  4MAB A;  5AGY A;  4IGJ A;  3GX8 A;  1AAZ A;  3DVX A;  1K0D A;  2OBI A;  1DBY A;  2X8C A;  2K8S A;  1GTI A;  5HR1 A;  4H86 A;  4FYU A;  1J9B A;  4G19 A;  1V9W A;  5IO2 A;  3RPP A;  3APS A;  3D22 A;  1V98 A;  3ERG A;  5DJL A;  4GCI A;  1TP9 A;  5FHI A;  3MDK A;  2C80 A;  3CSJ A;  1PMT A;  2H0H A;  5G30 A;  3QFA C;  2MYG A;  4N11 A;  1K0N A;  3GMF A;  4MA9 A;  3U5R E;  1URM A;  4TXV A;  4N0Z A;  3A3T A;  2VLV A;  7GSS A;  1NHY A;  4I2U A;  4KDY A;  4K8M A;  3H8Q A;  3UAR A;  1NW2 A;  3C73 A;  1GSY A;  3DRN A;  2E2G A;  3E0U A;  2VCZ A;  3H4K A;  4IQA A;  2R3X A;  5HQP A;  5AIV A;  3FW2 A;  3HDC A;  3GHA A;  1AUC A;  5G5E A;  3LYP A;  3F3Q A;  4JR6 A;  4MJC A;  2GST A;  4EVM A;  3BCI A;  5H5S A;  1XVQ A;  2HZE B;  3E9J B;  2C3N A;  4D73 A;  2YWO A;  1PL2 A;  1KEB A;  1TRW A;  2KLX A;  3UMA A;  5CRG A;  2D2Z A;  3QR6 A;  2IL3 A;  1SL1 B;  2HT9 A;  4MLY A;  2H1A A;  1JZO A;  1PRX A;  3J7Y k;  2WFC A;  1EV9 A;  6GSU A;  1XBS A;  3D21 A;  2VIM A;  2HXK A;  4FYC A;  4EC0 A;  2MMN A;  4EO3 A;  3GUR A;  2H6Z A;  4XRA A;  1AQW A;  1XZO A;  3GKX A;  1BAY A;  1YF1 A;  2JZT A;  3J7Y b;  2NTO A;  2TRX A;  3FR9 A;  5ECL B;  5INY A;  4NPB A;  1U88 A;  3W8S A;  3DD3 A;  1ILO A;  2FGX A;  3US3 A;  3GKN A;  1JLV A;  2C0E A;  1M9B A;  2RII A;  5FT3 A;  2F51 A;  1R26 A;  3FRC A;  4KW6 A;  2CA8 A;  3KTB A;  3TRP A;  3WT1 A;  4TRX A;  2H76 A;  3F8U A;  2KP1 A;  3GRX A;  3TKS A;  2VL2 C;  3P2A A;  4XS4 B;  4KE3 A;  3QPM A;  1FVK A;  2LJR A;  3IV4 A;  4TR4 A;  2P31 A;  2VM1 A;  3TDG A;  4QL9 A;  2RLI A;  3LWA A;  4NV2 A;  1R7H A;  2C0D A;  2FWF A;  3JCM L;  4HDE A;  3QOU A;  1T1V A;  5EPF A;  3W6G A;  3O76 A;  4F03 A;  4MF7 A;  1GUL A;  5KN0 A;  2QGV A;  1V40 A;  2L6C A;  4Q5R A;  1WIK A;  1MD3 A;  4ILF A;  2LNS A;  4JZQ A;  4RI7 A;  3KD0 A;  5GAN D;  2C8U A;  4GSS A;  3DXB A;  1O8X A;  5IPG A;  3TKR A;  3KP9 A;  4ZB9 A;  1JZD A;  5IMZ A;  3G9B A;  3H1N A;  1GLQ A;  2XHF A;  4EDZ A;  1A2M A;  1O81 A;  3APQ A;  4PUF C;  3VPQ A;  3GYK A;  1Z7P A;  4RI6 A;  2PBJ A;  5B8A A;  1F3A A;  1M9A A;  3O3T A;  2IWT A;  4I2T A;  1ERW A;  4DSR A;  16GS A;  4N10 A;  1UA5 A;  5IIZ A;  3C1R A;  1G7E A;  2LST A;  3FHK A;  3HZ4 A;  3GKK A;  4POB A;  2F9S A;  2AJQ B;  4MF6 A;  2RM6 A;  2IJY A;  1F2E A;  1UVZ A;  4MZW A;  3D0Z A;  2HNL A;  1PSQ A;  1PX7 A;  2PVO C;  3RDW A;  1AXD A;  3IHQ A;  3LGC A;  2LTK A;  3F6D A;  2FWH A;  5ABR A;  3EYT A;  2XPE A;  2V6K A;  3FYG A;  3GN3 A;  1SYX A;  1SL2 B;  1WRY A;  3WYW A;  1XWK A;  3G7I A;  2FUG 2;  2VCV A;  3L9V A;  1M2A A;  4NMU A;  5DQY A;  3ME8 A;  4IHU A;  4HQS A;  3IDV A;  4OFT A;  2IFQ A;  2BMX A;  1N2A A;  5D9T A;  3M1G A;  3C7M A;  3CSH A;  2AHE A;  4BVY A;  2VLT A;  1NM3 A;  2AB6 A;  4DEJ A;  2PUK C;  4HJ2 A;  3VWU A;  2H1G A;  2H19 A;  3F63 A;  4DSS B;  2PPT A;  2H01 A;  1BG5 A;  4WR4 A;  2TRC P;  3ERF A;  3RAZ A;  4EE0 A;  1H4O A;  1YZX A;  2A2R A;  4POL A;  1DE2 A;  2WCI A;  3F4T A;  3H93 A;  3IPZ A;  3L0H A;  2YCD A;  4F9Z A;  2PMT A;  2OA7 A;  1WWJ A;  2QC7 A;  4PNG A;  2J9H A;  5ECI B;  1FB0 A;  4KDU A;  1K3O A;  2G0F A;  2MBS A;  4L0U A;  4HOJ A;  2H1D A;  1M7T A;  3UAP A;  3EE2 A;  2GDR A;  5CRW A;  1ON4 A;  5D9X A;  4NXI A;  5ECQ B;  1HNA A;  3GNJ A;  1GTU A;  2FY6 A;  1EP7 A;  3FR3 A;  5GAP D;  1GUH A;  2X8H A;  3TJB A;  4ACS A;  2CVD A;  2H72 A;  1JFU A;  1EP8 A;  1HD2 A;  2PWJ A;  4MPF A;  3LXT A;  3RHC A;  3MWH A;  5IPH A;  1GSS A;  5DJM A;  1ZCP A;  3NZN A;  2KHP A;  2PN8 A;  2LEG A;  1XWB A;  1QQ2 A;  2FWG A;  3L9U A;  2VL2 A;  3P90 A;  1OC3 A;  3IK9 A;  1T3B A;  1FG4 A;  1EOH A;  2C1Y A;  4XS1 A;  2B7K A;  5EY6 A;  1F37 A;  2P0G A;  4OD7 A;  1EGR A;  2E2M A;  5IQY A;  2O85 A;  4L0W A;  4TN8 A;  2L5O A;  1ACV A;  3TOU A;  2FLS A;  2CAQ A;  3W8J A;  3HD5 A;  3GL5 A;  4XCS A;  2HYX A;  2PER A;  1Q98 A;  1XW6 A;  1ABA A;  1IYI A;  3N9J A;  3D4M A;  5ECK B;  3ZTL A;  4K7N A;  5HR0 A;  3A2W A;  2KOK A;  3E3E A;  1QFN A;  4IKH A;  2P5Q A;  5ECM B;  1DE1 A;  2DJ3 A;  3SWL A;  1SJ6 A;  1FW1 A;  2E0Q A;  3H79 A;  4MZC A;  2C0G A;  2JAC A;  4JBB A;  5H5R A;  2WUL A;  1GRX A;  1SKR B;  2L4C A;  2GGT A;  3VWX A;  2PU9 C;  2YV9 A;  2YV7 A;  5HR2 A;  5D9V A;  3ZML A;  1NHO A;  3TCO A;  4L8E A;  5IOX A;  3DIE A;  2IIY A;  5E4W A;  5A4W A;  4BA7 A;  5DAL B;  4BVX A;  2DC5 A;  3CXG A;  5AN1 A;  2CZ2 A;  4MF5 A;  2VL9 A;  4AF2 A;  2JL4 A;  2R37 A;  4HZ4 A;  2H8L A;  1SL0 B;  3QAG A;  5ID2 B;  4EKZ A;  2TIR A;  1ZGN A;  5J4U A;  1GH2 A;  1JHB A;  4ML1 A;  4J57 E;  1B9Y C;  1CQH A;  4YH2 A;  2YZU A;  1X5C A;  3I43 A;  4G9H A;  22GS A;  2VUP A;  5IMD A;  3VPT A;  5FWG A;  3KMN A;  4V1A p;  2FHE A;  1ERV A;  2LKU A;  1SK2 A;  3A2X A;  4Q5N A;  4IBP A;  4J56 E;  5ECR B;  3TRQ A;  5ENU A;  4PQH A;  2V2G A;  3KH9 A;  5ECS A;  3M9J A;  1GSU A;  4WKW A;  1CQG A;  4ZB8 A;  4KDX A;  5A4U A;  2CX4 A;  2H71 A;  2JSY A;  5F05 A;  4ECI A;  3IOS A;  1FOV A;  2OE0 A;  3O6T A;  4KX4 A;  1SKS B;  1EOG A;  2FA4 A;  2HZE A;  4O32 A;  2DLX A;  3VWW A;  1Y25 A;  4ZBB A;  4GTU A;  1R5P A;  3ZRE A;  2GZZ A;  4LL4 B;  3TRX A;  4NWY A;  1S3A A;  3IAS 2;  3NIV A;  2CQ9 A;  3QAW A;  4ZL8 A;  3FK8 A;  3HJP A;  4YAV A;  4FO5 A;  2GTU A;  2B5E A;  3LOR A;  1MTC A;  3ERW A;  1W4V A;  3ZMK A;  4WBR D;  1PL1 A;  1C72 A;  1Z6M A;  4GST A;  1H75 A;  3ZIV A;  1OKD A;  1K3L A;  5G1L A;  4POM A;  3APO A;  4X0X A;  1U6T A;  4HUA A;  4MJE A;  2YNX A;  2A4V A;  1F9M A;  4MZB A;  4QL7 A;  3KXO A;  3P8W A;  4YQM A;  5CAX A;  4KUN A;  3KM6 A;  4BWQ A;  3VFI A;  1MD4 A;  2V6O A;  3I69 A;  5G5F A;  1U3I A;  2OJL A;  3TGZ A;  4TXO A;  4XS4 A;  4I8B A;  2HE3 A;  1THX A;  2MMO A;  3R2Q A;  1G0T A;  3PH9 A;  4F0C A;  4IS0 A;  2NDO A;  4CW9 A;  1BYE A;  4XIH A;  4NV5 A;  2HRF A;  4EUY A;  3EU4 A;  2CV4 A;  1VF4 A;  1XIY A;  3HKR A;  4ZB6 A;  3Q18 A;  1A23 A;  1WPI A;  2FA8 A;  1GSF A;  2IMI A;  1AC1 A;  2X64 A;  3ZLP A;  2R6K A;  1PN9 A;  5F0G A;  5JWQ B;  3MSZ A;  5DBQ A;  1XW9 A;  1W89 A;  3LEF A;  2P5R A;  4P3Y B;  2I9H A;  4KA0 A;  4D73 B;  1JZW A;  1ZYQ B;  4WBJ A;  4V2N A;  2VD0 A;  4GXZ A;  5D96 A;  4E8E A;  1YY7 A;  3HJO A;  1M99 A;  2BTO T;  3G7J A;  4IEL A;  4ZIJ A;  2LQO A;  1QUW A;  2ALB A;  3ZVJ A;  1HNC A;  1OVN A;  2DBC A;  5B8B A;  4LA1 A;  4MH3 A;  2KP2 A;  2H73 A;  1Z5Y E;  5IM9 A;  3VLN A;  2OKA A;  3U6V A;  3VI7 A;  5LD0 A;  2OBK A;  2M80 A;  4PX1 A;  3ISO A;  1Z9H A;  3WT2 A;  1TI3 A;  4NHW A;  2MMA A;  2HLS A;  1TXX A;  5F06 A;  4O92 A;  4F82 A;  1KNG A;  1TTZ A;  4PUR A;  3L4N A;  1GNW A;  3TB2 A;  3EWL A;  1RK4 A;  1VF3 A;  4X1U A;  1V58 A;  1WOU A;  1VRS D;  2O87 A;  2HRN A;  1XOA A;  4KSO A;  4JR4 A;  8GSS A;  5KEJ A;  2X99 A;  1RQM A;  2B5X A;  4PNF A;  3HA9 A;  4IQ1 A;  4I6X A;  4IN0 A; 
#chains in the Genus database with same CATH topology
 1WXX A;  1UC7 A;  1IYH A;  1PA3 A;  3A2V A;  4GQF A;  3HVV A;  2MBT A;  1TRU A;  1B48 A;  1XW5 A;  1GTA A;  1OKT A;  5KN3 A;  1SJI A;  4XRD A;  4KB3 A;  4MDC A;  3I9V 2;  1Z6N A;  5BMU A;  2IN3 A;  1MEK A;  3IBH A;  4JE1 A;  1XCC A;  2ON7 A;  2AUV A;  2WGR A;  4O5R A;  4EIQ A;  3DML A;  6GSS A;  1O8W A;  1OC9 B;  1QXH A;  2CVK A;  3FZ9 A;  3C71 A;  4IVF A;  3ZFB A;  3CBU A;  2JZS A;  3PR8 A;  3KIJ A;  3EIN A;  5A5K A;  5LNK e;  1TJD A;  2VM2 A;  3KZQ A;  3DOR A;  4KH7 A;  4ZIL A;  4MH2 A;  2LJA A;  3KH7 A;  4BPY A;  5L71 A;  1GL8 A;  3IHA A;  5KOW A;  4QTP A;  2C3T A;  2EC4 A;  3S9F A;  4GLT A;  1A2J A;  1TDI A;  4BIK A;  2WS2 A;  3IC8 A;  4HU7 A;  4G0I A;  5KN1 A;  5COH A;  3MYD A;  1F6M C;  4BWS A;  2R2J A;  3GSS A;  1LU4 A;  1A8Y A;  3CMI A;  2H0I A;  2QSI A;  5ECH B;  1N8J A;  1MDJ A;  2CVB A;  2MZC A;  4RQR A;  4LMW A;  2DJ0 A;  1V0F A;  3BOA A;  1V57 A;  3BCK A;  4GRF A;  4Z7X A;  4TW5 A;  2C3Q A;  4K2D A;  4IJI A;  2VL3 A;  4BL7 B;  3QFB C;  1JLW A;  2GQM A;  3BD2 A;  1FO5 A;  4PGT A;  1ERT A;  3LJR A;  3TKS E;  4CY8 A;  1X9S B;  3QDN A;  2HRK A;  4AJ8 A;  3M3M A;  5ECO B;  3ZVJ D;  1X9W B;  2VY9 A;  3CYN A;  5CRE A;  4K0N A;  4G2E A;  4Z2R A;  2J23 A;  1QMV A;  4MCU A;  5BRT A;  3FR6 A;  2R4V A;  3IRA A;  1WXW A;  5IOW A;  2R0P A;  4PUA A;  4ZL7 A;  2WRT A;  4HS1 A;  3EH7 A;  3CRT A;  2HZF A;  4J2F A;  2DMM A;  2EIO A;  1KTE A;  2LV3 A;  3HVX A;  1ZZY A;  4F2I A;  2GVP A;  5E59 A;  2V32 A;  4TOP A;  2L59 A;  4ZL9 A;  2KUC A;  10GS A;  3GVJ A;  5CRH A;  1OAZ A;  4FIW A;  3IXR A;  1O6J A;  4OO5 A;  1V0E A;  1YKC A;  5DAK B;  5DVB A;  2GQL A;  4QQ7 A;  1Q4J A;  4ULX A;  4K0G A;  2CT6 A;  2VOC A;  3VSE A;  4HZ2 A;  3GH9 A;  2CWW A;  1XWG A;  1YDK A;  2VCX A;  4K7O A;  2CZ3 A;  1EEJ A;  2GLR A;  4O5U A;  2H74 A;  2VLU A;  3OIR A;  4ZXG A;  3AGD A;  5B6M A;  3UVT A;  1R4W A;  4TR0 A;  3GTU A;  2RUE A;  4EIP A;  5J3R A;  2DJJ A;  2LUS A;  3EU3 A;  1ZL9 A;  4DVC A;  3F43 A;  1B4P A;  2YPM A;  5DAL A;  1JZR A;  2YAN A;  4WF5 A;  4EL1 A;  2H75 A;  1GP1 A;  4JU5 A;  3ZL5 A;  3IA1 A;  4F0B A;  5ID2 A;  2R0C A;  3M8N A;  4K6X A;  5IMA A;  3KMO A;  1T6R A;  3CTF A;  2YOI A;  4JED A;  3KEB A;  1TOF A;  1ST9 A;  3OIZ A;  17GS A;  5GSS A;  2K6V A;  2DJ1 A;  4RUV A;  4YQV A;  3TKS C;  2OE3 A;  2ZNM A;  2YZH A;  6GST A;  3GUS A;  2G2Q A;  3TKQ A;  1H4Y A;  3IAM 2;  4HEA 2;  1MDK A;  1M2B A;  2Z9S A;  4ZBD A;  5C04 A;  1QK8 A;  1K0O A;  3HY2 A;  2DSA A;  2AV4 A;  2LRT A;  3ZIJ A;  2BJX A;  2H0G A;  3IF5 A;  2JU5 A;  1NSW A;  1E6B A;  2DIZ A;  3TJJ A;  2I3Y A;  3HVS A;  2FCH A;  1TK5 B;  4OFN A;  1K0B A;  3FEU A;  1YF0 A;  4DGH A;  2B5Y A;  3UBK A;  2CX3 A;  5LCZ A;  2C0F A;  3L78 A;  5HFI A;  1FHE A;  2LRN A;  3SBC A;  1X5D A;  2GQK A;  2EIQ A;  3LFL A;  2MMZ A;  4HJM A;  4DSQ A;  4I5Q A;  5HFG A;  1G6Y A;  2IMF A;  1BX9 A;  4TR1 B;  4RQX A;  2NBS A;  3ZIT A;  2RRL A;  2LQQ A;  1TK8 B;  3TJF A;  3KP8 A;  5B6N A;  3GFK A;  1TH8 B;  1G6W A;  1Y6E A;  3K8N A;  1EZK A;  3WGX A;  3OR5 A;  3RBT A;  1FOH A;  2YWN A;  2I81 A;  2IMD A;  4OO4 A;  5AIS A;  1T4Y A;  2VD1 A;  3HXS A;  3WD6 A;  2VCW A;  3GVK A;  1M0U A;  12GS A;  1GLP A;  1XWA A;  1HYU A;  4V1A g;  3BJ5 A;  2HSY A;  1GNE A;  1TW9 A;  1XWC A;  4G0L A;  3LYK A;  2DIY A;  4HU9 A;  1ZMA A;  4ECJ A;  1TRS A;  4PXO A;  3MGL A;  2ZUP A;  2NVL A;  1SYR A;  1KBN A;  2H70 A;  1SKW B;  4E8H A;  2OE1 A;  1GUM A;  1YQ1 A;  3HCZ A;  5CYY A;  3DVW A;  3TUE A;  2YN1 A;  3CQF A;  1XPV A;  3UJ1 A;  1K32 A;  3ED3 A;  5G31 A;  2RUF A;  2HI7 A;  4FYB A;  4K1F A;  1B8X A;  3C8E A;  3ZFL A;  3DKS A;  3TKP A;  4G10 A;  3F6F A;  1V2A A;  1OE8 A;  4PQ1 A;  2HSH A;  9GSS A;  3M0F A;  2GZY A;  2XC2 A;  5C00 A;  1ML6 A;  1M2D A;  4NHZ A;  2DKI A;  5EUU A;  4WET A;  1S3D A;  4EDY A;  3EVI A;  4ECC A;  3F4R A;  2LJK A;  1TIL B;  4AGS A;  2GT5 A;  2V41 A;  5EL8 A;  3KCM A;  2N5A A;  1BQ7 A;  4MP4 A;  1DSB A;  1HQO A;  3JU4 A;  1T7P B;  1Z7R A;  4OCF A;  11GS A;  1PKW A;  5D8I A;  1FAA A;  3UIW A;  2L5L A;  1SJZ A;  4LLR A;  2FWE A;  1SD8 A;  4L1C A;  4AEJ A;  6GSV A;  4JRR A;  2YWI A;  5F8B A;  3VI5 A;  2YWM A;  5DQS A;  4KGI A;  1PX6 A;  1H4X A;  2B6M A;  2HFD A;  1G7O A;  2C4J A;  2ZCT A;  1BJX A;  4N0V A;  2RM5 A;  3EMX A;  2XBQ A;  1XXU A;  6GSW A;  2DXL A;  2B1K A;  2H1B A;  1WE0 A;  1VF1 A;  3A5W A;  4KCA A;  4X43 A;  1AW9 A;  1OYJ A;  1WP0 A;  3RHB A;  2VCT A;  4I97 A;  2XBI A;  4N30 A;  4KND A;  4WF4 A;  1A24 A;  3GIX A;  3GL3 A;  5B7C A;  1E2Y A;  4K5R A;  4CHS A;  2PGT A;  1THO A;  4POK A;  1AIU A;  3WGD A;  4TXO B;  5DCG A;  3GV1 A;  4L8K A;  4KSM A;  1U87 A;  3G7Y A;  3D5J A;  4OWY A;  4K7I A;  3T6O A;  2B1L A;  4TVE A;  2B3S A;  3KGK A;  2GSS A;  4GSN A;  1UN2 A;  4CDO A;  2WB9 A;  3C1S A;  3UEM A;  3HYP A;  4PQI A;  5JCU A;  4K9Z A;  1OC9 A;  2JAD A;  1O73 A;  4X4J A;  2IPA A;  3VWV A;  1AQX A;  1PQN A;  3BBY A;  3ME7 A;  5D73 A;  1YEP A;  4GWR A;  1FC6 A;  1TU8 A;  1XFL A;  3QCP A;  2O7K A;  3NOF A;  1GSD A;  4L5O A;  3CSI A;  1BED A;  2H66 A;  3MNG A;  2VCQ A;  4V2L A;  2L6D A;  5ECP B;  6GSX A;  3IR4 A;  2I4A A;  1SK1 A;  3D6I A;  2A2S A;  3FKF A;  4XS6 A;  4FH8 A;  3GKM A;  4IJ3 A;  2VAF A;  3UVH A;  3QMX A;  4IP6 A;  4ISD A;  5F07 A;  4LL1 B;  4GQC A;  2H6Y A;  1MDI A;  2EIR A;  1ZOF A;  3P7X A;  1A8L A;  2KA5 A;  3IK7 A;  5GZZ B;  3LQ7 A;  1A0F A;  4DSS A;  2B7J A;  3N5O A;  3UOM A;  3MAK A;  1M3I A;  5IO0 A;  4O7H A;  1EWX A;  5G1K A;  3PIN A;  2ON5 A;  2WZ9 A;  6GSY A;  1X5E A;  2R0G A;  5J41 A;  1I9D A;  3IE3 A;  4BL7 A;  2M72 A;  1VF2 A;  2CAI A;  2VO4 A;  2KLN A;  1FC7 A;  3DEX A;  5GST A;  1X9M B;  1ERU A;  2H30 A;  2O89 A;  5J9C A;  3L9S A;  4Q5Q A;  1AQV A;  1EGO A;  2M46 A;  2PVQ A;  5CNW A;  3EMP A;  3DGQ A;  1TKD B;  3ZYW A;  3FZ5 A;  5KN2 A;  1K0C A;  20GS A;  3HZ8 A;  5JCG A;  1BPL A;  1FC9 A;  4XHM A;  2WJU A;  2GSQ A;  1TI1 A;  4ML6 A;  3GH6 A;  5D9W A;  3M9K A;  2O8V B;  4L5L A;  1SU9 A;  3IHB A;  5JWR B;  2DJK A;  3CTG A;  1OE7 A;  3FY7 A;  3F9U A;  3KTL A;  4AJ6 A;  3LSZ A;  2DXN A;  2H6X A;  2N5B A;  5ELG A;  1EEM A;  4WEY A;  2I1U A;  2K8V A;  4MJA A;  1PD2 1;  3EC3 A;  4Z2T A;  2DML A;  1DUG A;  2K9F A;  2OAD A;  2GZP A;  2L57 A;  5DAK A;  2IME A;  4IW9 A;  3Q19 A;  19GS A;  3FZA A;  1GWC A;  1XVW A;  1ZYN A;  4MK3 A;  2DKH A;  2HRA A;  3TJG A;  1I5G A;  1YJ6 A;  3TJK A;  2L4Q A;  4NAX A;  2DJ2 A;  1F3B A;  3CRU A;  1Z3E A;  2GSR A;  1T8E B;  3Q74 A;  1LJR A;  4FQU A;  2R5G A;  18GS A;  1GSQ A;  1WJK A;  3AY8 A;  1A0R P;  1RW1 A;  4Z2U A;  4EF0 A;  1FB6 A;  1K0M A;  1R5A A;  2IFQ B;  4OFM A;  4MMM A;  2AYT A;  2FNO A;  2HSM A;  2XPD A;  1N6D A;  2K18 A;  4BVY B;  2AAW A;  2FD3 A;  5AIX A;  3ZZX A;  5DCH A;  5JWO B;  3VUR A;  4YKG A;  2REM A;  3LLO A;  2YJ7 A;  2YP6 A;  3GA4 A;  3IC4 A;  1T00 A;  1K3Y A;  1FCF A;  5CRD A;  5DDL A;  5IMC A;  4WXT A;  1SD9 A;  1FVJ A;  3UL3 A;  4GHN A;  1PGT A;  5G2Z A;  2ES7 A;  1GUK A;  13GS A;  1N6F A;  2GS3 A;  5J9B A;  1A2L A;  4ID0 A;  1TK0 B;  3VK9 A;  4HI7 A;  1U3A A;  3QD9 A;  4V2M A;  3ZXN A;  3RPN A;  5EVO A;  14GS A;  3GX0 A;  5JCW A;  2LS5 A;  1O85 A;  1VGL A;  4ZBA A;  1T4Z A;  3ZRD A;  1TRV A;  4IP1 A;  4HQZ A;  1TU7 A;  3KJY A;  3UBL A;  3Q6O A;  2N5F A;  5D93 A;  5IMV A;  1B9X C;  3GST A;  3V1W A;  3D4T A;  1K0A A;  2GT6 A;  3HHV A;  4Q5F A;  2UZ8 A;  2F8F A;  4KCE A;  3I6A A;  5ECN B;  4MPG A;  3LG6 A;  2YJH A;  4GF0 A;  1J0F A;  5IMF A;  1GSE A;  1O7U A;  4OCE A;  4XTS A;  5CO3 A;  2IMK A;  4ECB A;  1X0R A;  2JSZ A;  4EXJ A;  4TR1 A;  1USB A;  3F3R A;  1QGV A;  3TOT A;  2OAC A;  3LXZ A;  1YEX A;  4TR3 A;  5A4V A;  3DYR A;  1YKA A;  4WR5 A;  5HFK A;  2F8A A;  1S3C A;  1SEN A;  1SK0 A;  3EUR A;  3GTU B;  3FZ4 A;  3NY7 A;  1LBK A;  5CP1 A;  3F4S A;  2F3M A;  3IHG A;  5H5Q A;  4LMV A;  3QAV A;  2E7P A;  1PKZ A;  2NPB A;  4MJB A;  1J08 A;  1B4Q A;  2JZR A;  2V1M A;  4YAP A;  1OC8 A;  2LRC A;  4TKY A;  3PGT A;  2X8G A;  3HJM A;  4OMV A;  1HNB A;  4AJ7 A;  3F0I A;  1EV4 A;  5HR3 A;  4KAE A;  1GTB A;  5ELA A;  4YQU A;  3WGE A;  2QA2 A;  5J5N A;  3DWV A;  2LNT A;  1WMJ A;  1XOB A;  1ZYE A;  2WDU A;  2QKE A;  4MAB A;  5AGY A;  4IGJ A;  2QA1 A;  3GX8 A;  1AAZ A;  3DVX A;  1K0D A;  2OBI A;  1DBY A;  1HF2 A;  2X8C A;  2K8S A;  1GTI A;  5HR1 A;  4YKF A;  4H86 A;  4FYU A;  1J9B A;  4G19 A;  1V9W A;  4BVX B;  5IO2 A;  3RPP A;  3APS A;  3D22 A;  1V98 A;  3ERG A;  5DJL A;  5EZB A;  4GCI A;  3D3U A;  1TP9 A;  5FHI A;  3MDK A;  2C80 A;  3CSJ A;  4PTS A;  1PMT A;  2H0H A;  5G30 A;  3QFA C;  2MYG A;  4N11 A;  1K0N A;  3GMF A;  4MA9 A;  3U5R E;  1URM A;  4TXV A;  4N0Z A;  3A3T A;  2VLV A;  7GSS A;  1NHY A;  4I2U A;  4KDY A;  4K8M A;  3H8Q A;  3UAR A;  1NW2 A;  3C73 A;  1GSY A;  3DRN A;  2E2G A;  3E0U A;  2VCZ A;  3H4K A;  4IQA A;  2R3X A;  5HQP A;  5AIV A;  3FW2 A;  3HDC A;  3GHA A;  1AUC A;  5G5E A;  4DGF A;  3LW9 A;  3LYP A;  3F3Q A;  4JR6 A;  4MJC A;  2GST A;  5EUW A;  4EVM A;  3BCI A;  5H5S A;  1XVQ A;  2HZE B;  3E9J B;  2C3N A;  1M3J A;  4D73 A;  2YWO A;  1PL2 A;  1KEB A;  1TRW A;  3IH8 A;  2KLX A;  3UMA A;  5CRG A;  2D2Z A;  3QR6 A;  2IL3 A;  1SL1 B;  2HT9 A;  4MLY A;  2H1A A;  1JZO A;  1PRX A;  3J7Y k;  2WFC A;  1EV9 A;  6GSU A;  1XBS A;  3D21 A;  2VIM A;  2HXK A;  4FYC A;  4EC0 A;  2MMN A;  4EO3 A;  3GUR A;  2H6Z A;  4XRA A;  1AQW A;  1XZO A;  3GKX A;  1BAY A;  1YF1 A;  2JZT A;  3J7Y b;  2NTO A;  2TRX A;  3FR9 A;  5ECL B;  5INY A;  4NPB A;  1U88 A;  3W8S A;  3DD3 A;  1ILO A;  2FGX A;  3US3 A;  3GKN A;  2ZOA A;  1JLV A;  2C0E A;  3EPT A;  1M9B A;  2RII A;  5FT3 A;  2F51 A;  5KOX A;  1R26 A;  3FRC A;  4KW6 A;  1SBO A;  3DJA A;  2CA8 A;  1THN B;  3KTB A;  3TRP A;  1TID B;  3WT1 A;  4TRX A;  2H76 A;  3F8U A;  2KP1 A;  3GRX A;  3TKS A;  2VL2 C;  3P2A A;  4XS4 B;  4KE3 A;  3QPM A;  1FVK A;  2LJR A;  3IV4 A;  4TR4 A;  2P31 A;  2VM1 A;  3TDG A;  4QL9 A;  2RLI A;  1XG8 A;  3LWA A;  4NV2 A;  1R7H A;  2C0D A;  2FWF A;  3JCM L;  4HDE A;  3QOU A;  1T1V A;  5EPF A;  3W6G A;  3O76 A;  4F03 A;  4MF7 A;  1GUL A;  5KN0 A;  2QGV A;  1ZYP A;  1V40 A;  2L6C A;  4Q5R A;  1WIK A;  1MD3 A;  4ILF A;  2LNS A;  4JZQ A;  4RI7 A;  3KD0 A;  5GAN D;  2C8U A;  4GSS A;  3DXB A;  1O8X A;  5IPG A;  3TKR A;  3KP9 A;  4AE2 A;  4ZB9 A;  3MOG A;  2ZO9 B;  1JZD A;  4K2X A;  5IMZ A;  3G9B A;  3H1N A;  1GLQ A;  2XHF A;  4EDZ A;  1A2M A;  1O81 A;  3APQ A;  4PUF C;  3VPQ A;  3GYK A;  1Z7P A;  4RI6 A;  2PBJ A;  5B8A A;  3D03 A;  4DMG A;  1F3A A;  1M9A A;  3O3T A;  2IWT A;  4I2T A;  1ERW A;  4DSR A;  16GS A;  4N10 A;  1UA5 A;  5IIZ A;  3C1R A;  1G7E A;  2LST A;  3FHK A;  3HZ4 A;  3GKK A;  4POB A;  4MNN A;  2F9S A;  1J7X A;  2AJQ B;  4MF6 A;  2RM6 A;  2IJY A;  4USS A;  1F2E A;  1UVZ A;  4MZW A;  3D0Z A;  2HNL A;  1PSQ A;  1PX7 A;  2PVO C;  3RDW A;  1AXD A;  3IHQ A;  3LGC A;  2LTK A;  3F6D A;  2FWH A;  5ABR A;  3EYT A;  2XPE A;  2V6K A;  3GHF A;  3FYG A;  3GN3 A;  1SYX A;  1SL2 B;  1WRY A;  3WYW A;  1XWK A;  3G7I A;  2FUG 2;  2VCV A;  3L9V A;  1M2A A;  4NMU A;  5DQY A;  3ME8 A;  4IHU A;  4HQS A;  3IDV A;  4OFT A;  2IFQ A;  3C0K A;  2BMX A;  1N2A A;  5D9T A;  3M1G A;  3C7M A;  3CSH A;  2AHE A;  4BVY A;  2VLT A;  1NM3 A;  4K5S A;  2AB6 A;  4DEJ A;  2PUK C;  4HJ2 A;  3VWU A;  2H1G A;  2H19 A;  3F63 A;  4DSS B;  2PPT A;  2H01 A;  4G0K A;  1BG5 A;  4WR4 A;  2TRC P;  3ERF A;  3RAZ A;  4EE0 A;  1H4O A;  1YZX A;  2A2R A;  4POL A;  1DE2 A;  3H93 A;  2WCI A;  3F4T A;  3IPZ A;  3L0H A;  2YCD A;  4F9Z A;  2PMT A;  2OA7 A;  1WWJ A;  2QC7 A;  3IH9 A;  4PNG A;  2J9H A;  5ECI B;  1FB0 A;  3LKL A;  4KDU A;  1K3O A;  4ICY A;  2G0F A;  2MBS A;  4L0U A;  4HOJ A;  3GVL A;  2H1D A;  1M7T A;  3UAP A;  3EE2 A;  2GDR A;  5CRW A;  1ON4 A;  5D9X A;  4NXI A;  3K50 A;  5ECQ B;  1HNA A;  3GNJ A;  1GTU A;  4XS5 A;  2FY6 A;  1EP7 A;  3FR3 A;  5GAP D;  3V97 A;  1GUH A;  2X8H A;  3TJB A;  2B78 A;  4ACS A;  2CVD A;  2H72 A;  1JFU A;  4JC0 A;  1EP8 A;  1HD2 A;  2PWJ A;  4MPF A;  3LXT A;  4HSC X;  3RHC A;  3MWH A;  5IPH A;  1GSS A;  5DJM A;  1ZCP A;  3NZN A;  2KHP A;  2PN8 A;  2LEG A;  1XWB A;  1QQ2 A;  2FWG A;  3L9U A;  2VL2 A;  3P90 A;  1OC3 A;  3IK9 A;  1T3B A;  2A4H A;  1FG4 A;  1EOH A;  2C1Y A;  4XS1 A;  2B7K A;  5EY6 A;  1F37 A;  3PPU A;  4HYL A;  2P0G A;  4OD7 A;  1EGR A;  2E2M A;  5IQY A;  2O85 A;  3HVN A;  4L0W A;  4TN8 A;  2L5O A;  1ACV A;  3TOU A;  2FLS A;  2CAQ A;  3W8J A;  3HD5 A;  3GL5 A;  2X4A A;  4XCS A;  2HYX A;  2PER A;  1Q98 A;  1XW6 A;  1ABA A;  1IYI A;  3N9J A;  3D4M A;  5ECK B;  3ZTL A;  4K7N A;  5HR0 A;  3MIX A;  3A2W A;  2KOK A;  3E3E A;  1QFN A;  4IKH A;  2P5Q A;  5ECM B;  1DE1 A;  2DJ3 A;  3SWL A;  1SJ6 A;  1FW1 A;  2E0Q A;  3H79 A;  4MZC A;  2C0G A;  2JAC A;  4JBB A;  5H5R A;  2WUL A;  1GRX A;  1SKR B;  2L4C A;  2GGT A;  3VWX A;  2PU9 C;  2YV9 A;  2YV7 A;  5HR2 A;  5D9V A;  3ZML A;  1NHO A;  3TCO A;  4L8E A;  5IOX A;  3DIE A;  2IIY A;  5E4W A;  5A4W A;  4BA7 A;  5DAL B;  4BVX A;  2DC5 A;  3CXG A;  5AN1 A;  2CZ2 A;  4MF5 A;  2VL9 A;  4AF2 A;  2JL4 A;  2R37 A;  1N6E A;  4HZ4 A;  2H8L A;  1SL0 B;  3QAG A;  5ID2 B;  4EKZ A;  2TIR A;  1ZGN A;  5J4U A;  1GH2 A;  1JHB A;  4ML1 A;  4J57 E;  1B9Y C;  1BUZ A;  1CQH A;  4YH2 A;  3GK7 A;  2YZU A;  1X5C A;  3I43 A;  4G9H A;  22GS A;  2VUP A;  5IMD A;  3VPT A;  5FWG A;  3KMN A;  4V1A p;  2FHE A;  1ERV A;  2OAS A;  2LKU A;  1SK2 A;  3A2X A;  4Q5N A;  4IBP A;  4J56 E;  5ECR B;  3TRQ A;  5ENU A;  4PQH A;  2V2G A;  3KH9 A;  5ECS A;  3M9J A;  1GSU A;  4WKW A;  1CQG A;  4ZB8 A;  4KDX A;  5A4U A;  2CX4 A;  2H71 A;  2JSY A;  5F05 A;  4ECI A;  3IOS A;  1FOV A;  2OE0 A;  3O6T A;  4KX4 A;  1SKS B;  1EOG A;  2FA4 A;  4KF9 A;  2HZE A;  4O32 A;  2DLX A;  3VWW A;  1Y25 A;  4ZBB A;  4GTU A;  1R5P A;  3ZRE A;  2GZZ A;  4LL4 B;  3TRX A;  4NWY A;  1S3A A;  1PN0 A;  3IAS 2;  3NIV A;  4O5Q A;  2CQ9 A;  3QAW A;  4ZL8 A;  3FMW A;  3FK8 A;  3HJP A;  4YAV A;  4A5P A;  4FO5 A;  2GTU A;  2B5E A;  1S3R A;  3LOR A;  1MTC A;  3ERW A;  1W4V A;  3ZMK A;  4WBR D;  1PL1 A;  2X49 A;  1C72 A;  1Z6M A;  4GST A;  1H75 A;  3ZIV A;  1OKD A;  3DUP A;  1K3L A;  3A5I A;  5G1L A;  4POM A;  3APO A;  4X0X A;  1U6T A;  4HUA A;  4MJE A;  2YNX A;  2A4V A;  1F9M A;  4MZB A;  4QL7 A;  3KXO A;  3P8W A;  4YQM A;  3V8V A;  5CAX A;  4KUN A;  1AUZ A;  3KM6 A;  4BWQ A;  3VFI A;  3LDF A;  1MD4 A;  2V6O A;  3I69 A;  5G5F A;  1U3I A;  2OJL A;  3AGE A;  3R3E A;  3TGZ A;  3QDQ A;  4TXO A;  4XS4 A;  4I8B A;  2HE3 A;  1THX A;  2MMO A;  3R2Q A;  1G0T A;  1PFO A;  2AS0 A;  3PH9 A;  4F0C A;  4IS0 A;  2NDO A;  4CW9 A;  4HIZ A;  1BYE A;  4XIH A;  4NV5 A;  2HRF A;  4EUY A;  3EU4 A;  2CV4 A;  1VF4 A;  5EUS A;  1XIY A;  3HKR A;  4ZB6 A;  3Q18 A;  1A23 A;  1WPI A;  2FA8 A;  1GSF A;  2IMI A;  5EUX A;  1AC1 A;  2X64 A;  3ZLP A;  2R6K A;  1PN9 A;  5F0G A;  5JWQ B;  3MSZ A;  5DBQ A;  1XW9 A;  1W89 A;  3LEF A;  2P5R A;  4P3Y B;  2I9H A;  4KA0 A;  4D73 B;  1JZW A;  1ZYQ B;  4WBJ A;  4V2N A;  2VD0 A;  4GXZ A;  5D96 A;  4E8E A;  1YY7 A;  3HJO A;  1M99 A;  2BTO T;  3G7J A;  4IEL A;  4ZIJ A;  2LQO A;  1QUW A;  2ALB A;  3ZVJ A;  1H4Z A;  1HNC A;  1OVN A;  2DBC A;  5B8B A;  4LA1 A;  4MH3 A;  2KP2 A;  2H73 A;  1Z5Y E;  4CY6 A;  5IM9 A;  3VLN A;  2OKA A;  3U6V A;  3VI7 A;  5LD0 A;  2OBK A;  2M80 A;  4PX1 A;  3ZTB A;  3ISO A;  1Z9H A;  3WT2 A;  1TI3 A;  4NHW A;  2MMA A;  2HLS A;  1TXX A;  5EUZ A;  5F06 A;  2A2P A;  4O92 A;  4F82 A;  1VC1 A;  1KNG A;  1TTZ A;  4PUR A;  3L4N A;  1GNW A;  3TB2 A;  3EWL A;  1RK4 A;  1VF3 A;  4X1U A;  1V58 A;  1WOU A;  1VRS D;  2O87 A;  2HRN A;  1XOA A;  4KSO A;  4JR4 A;  8GSS A;  5KEJ A;  2X99 A;  1RQM A;  2B5X A;  4PNF A;  3HA9 A;  4IQ1 A;  4I6X A;  4IN0 A; 
#chains in the Genus database with same CATH homology
 1UC7 A;  1IYH A;  1PA3 A;  3A2V A;  4GQF A;  3HVV A;  2MBT A;  1TRU A;  1B48 A;  1XW5 A;  1GTA A;  1OKT A;  5KN3 A;  1SJI A;  4XRD A;  4KB3 A;  4MDC A;  3I9V 2;  1Z6N A;  5BMU A;  2IN3 A;  1MEK A;  3IBH A;  4JE1 A;  1XCC A;  2ON7 A;  2AUV A;  2WGR A;  4O5R A;  4EIQ A;  3DML A;  6GSS A;  1O8W A;  1OC9 B;  1QXH A;  2CVK A;  3FZ9 A;  3C71 A;  4IVF A;  3ZFB A;  3CBU A;  2JZS A;  3PR8 A;  3KIJ A;  3EIN A;  5A5K A;  5LNK e;  1TJD A;  2VM2 A;  3KZQ A;  3DOR A;  4KH7 A;  4ZIL A;  4MH2 A;  2LJA A;  3KH7 A;  4BPY A;  5L71 A;  1GL8 A;  5KOW A;  2C3T A;  2EC4 A;  3S9F A;  4GLT A;  1A2J A;  1TDI A;  2WS2 A;  3IC8 A;  4HU7 A;  4G0I A;  5KN1 A;  5COH A;  3MYD A;  1F6M C;  4BWS A;  2R2J A;  3GSS A;  1LU4 A;  1A8Y A;  3CMI A;  2H0I A;  2QSI A;  5ECH B;  1N8J A;  1MDJ A;  2CVB A;  2MZC A;  4RQR A;  4LMW A;  2DJ0 A;  3BOA A;  1V57 A;  3BCK A;  4GRF A;  4Z7X A;  4TW5 A;  2C3Q A;  4K2D A;  4IJI A;  2VL3 A;  4BL7 B;  3QFB C;  1JLW A;  2GQM A;  3BD2 A;  1FO5 A;  4PGT A;  1ERT A;  3LJR A;  3TKS E;  4CY8 A;  1X9S B;  3QDN A;  2HRK A;  4AJ8 A;  3M3M A;  5ECO B;  3ZVJ D;  1X9W B;  3CYN A;  5CRE A;  4K0N A;  4G2E A;  4Z2R A;  2J23 A;  1QMV A;  4MCU A;  5BRT A;  3FR6 A;  2R4V A;  3IRA A;  5IOW A;  2R0P A;  4PUA A;  4ZL7 A;  2WRT A;  4HS1 A;  3CRT A;  2HZF A;  4J2F A;  2DMM A;  2EIO A;  1KTE A;  2LV3 A;  3HVX A;  1ZZY A;  4F2I A;  2GVP A;  5E59 A;  2V32 A;  4TOP A;  2L59 A;  4ZL9 A;  2KUC A;  10GS A;  5CRH A;  1OAZ A;  4FIW A;  3IXR A;  1O6J A;  4OO5 A;  1YKC A;  5DAK B;  5DVB A;  2GQL A;  4QQ7 A;  1Q4J A;  4ULX A;  4K0G A;  2CT6 A;  2VOC A;  4HZ2 A;  3GH9 A;  1XWG A;  1YDK A;  2VCX A;  4K7O A;  2CZ3 A;  1EEJ A;  2GLR A;  4O5U A;  2H74 A;  2VLU A;  4ZXG A;  5B6M A;  3UVT A;  1R4W A;  4TR0 A;  3GTU A;  2RUE A;  4EIP A;  5J3R A;  2DJJ A;  2LUS A;  3EU3 A;  1ZL9 A;  4DVC A;  1B4P A;  2YPM A;  5DAL A;  1JZR A;  2YAN A;  4WF5 A;  4EL1 A;  2H75 A;  1GP1 A;  4JU5 A;  3ZL5 A;  3IA1 A;  4F0B A;  5ID2 A;  2R0C A;  3M8N A;  4K6X A;  5IMA A;  3KMO A;  3CTF A;  2YOI A;  4JED A;  3KEB A;  1TOF A;  1ST9 A;  17GS A;  5GSS A;  2K6V A;  2DJ1 A;  4RUV A;  4YQV A;  3TKS C;  2OE3 A;  2ZNM A;  2YZH A;  6GST A;  3GUS A;  2G2Q A;  3TKQ A;  3IAM 2;  4HEA 2;  1MDK A;  1M2B A;  2Z9S A;  4ZBD A;  5C04 A;  1QK8 A;  1K0O A;  3HY2 A;  2DSA A;  2AV4 A;  2LRT A;  3ZIJ A;  2BJX A;  2H0G A;  2JU5 A;  1NSW A;  1E6B A;  2DIZ A;  3TJJ A;  2I3Y A;  3HVS A;  2FCH A;  1TK5 B;  4OFN A;  1K0B A;  3FEU A;  1YF0 A;  2B5Y A;  3UBK A;  2CX3 A;  5LCZ A;  2C0F A;  3L78 A;  5HFI A;  1FHE A;  2LRN A;  3SBC A;  1X5D A;  2GQK A;  2EIQ A;  3LFL A;  2MMZ A;  4HJM A;  4DSQ A;  4I5Q A;  5HFG A;  1G6Y A;  2IMF A;  1BX9 A;  4TR1 B;  4RQX A;  2NBS A;  3ZIT A;  2RRL A;  2LQQ A;  1TK8 B;  3TJF A;  3KP8 A;  5B6N A;  3GFK A;  1G6W A;  1Y6E A;  3K8N A;  1EZK A;  3WGX A;  3OR5 A;  3RBT A;  1FOH A;  2YWN A;  2I81 A;  2IMD A;  4OO4 A;  5AIS A;  1T4Y A;  2VD1 A;  3HXS A;  3WD6 A;  2VCW A;  1M0U A;  12GS A;  1GLP A;  1XWA A;  1HYU A;  4V1A g;  3BJ5 A;  2HSY A;  1GNE A;  1TW9 A;  1XWC A;  4G0L A;  3LYK A;  2DIY A;  4HU9 A;  1ZMA A;  4ECJ A;  1TRS A;  4PXO A;  2ZUP A;  2NVL A;  1SYR A;  1KBN A;  2H70 A;  1SKW B;  4E8H A;  2OE1 A;  1GUM A;  1YQ1 A;  3HCZ A;  5CYY A;  3DVW A;  3TUE A;  2YN1 A;  1XPV A;  3UJ1 A;  1K32 A;  3ED3 A;  5G31 A;  2RUF A;  2HI7 A;  4FYB A;  4K1F A;  1B8X A;  3C8E A;  3ZFL A;  3DKS A;  3TKP A;  4G10 A;  3F6F A;  1V2A A;  1OE8 A;  4PQ1 A;  2HSH A;  9GSS A;  3M0F A;  2GZY A;  2XC2 A;  5C00 A;  1ML6 A;  1M2D A;  4NHZ A;  2DKI A;  4WET A;  1S3D A;  4EDY A;  3EVI A;  4ECC A;  3F4R A;  2LJK A;  4AGS A;  2GT5 A;  2V41 A;  5EL8 A;  3KCM A;  2N5A A;  1BQ7 A;  4MP4 A;  1DSB A;  1HQO A;  1T7P B;  1Z7R A;  4OCF A;  11GS A;  1PKW A;  5D8I A;  1FAA A;  3UIW A;  2L5L A;  1SJZ A;  4LLR A;  2FWE A;  1SD8 A;  4L1C A;  4AEJ A;  6GSV A;  4JRR A;  2YWI A;  5F8B A;  3VI5 A;  2YWM A;  5DQS A;  4KGI A;  1PX6 A;  2B6M A;  2HFD A;  1G7O A;  2C4J A;  2ZCT A;  1BJX A;  4N0V A;  2RM5 A;  3EMX A;  2XBQ A;  1XXU A;  6GSW A;  2DXL A;  2B1K A;  2H1B A;  1WE0 A;  1VF1 A;  3A5W A;  4KCA A;  4X43 A;  1AW9 A;  1OYJ A;  1WP0 A;  3RHB A;  2VCT A;  4I97 A;  2XBI A;  4N30 A;  4KND A;  4WF4 A;  1A24 A;  3GIX A;  3GL3 A;  5B7C A;  1E2Y A;  4K5R A;  4CHS A;  2PGT A;  1THO A;  4POK A;  1AIU A;  3WGD A;  4TXO B;  5DCG A;  3GV1 A;  4L8K A;  4KSM A;  1U87 A;  3G7Y A;  3D5J A;  4OWY A;  4K7I A;  2B1L A;  4TVE A;  2B3S A;  3KGK A;  2GSS A;  4GSN A;  1UN2 A;  4CDO A;  2WB9 A;  3C1S A;  3UEM A;  3HYP A;  4PQI A;  5JCU A;  4K9Z A;  1OC9 A;  2JAD A;  1O73 A;  4X4J A;  2IPA A;  3VWV A;  1AQX A;  1PQN A;  3BBY A;  3ME7 A;  5D73 A;  1YEP A;  4GWR A;  1FC6 A;  1TU8 A;  1XFL A;  3QCP A;  2O7K A;  3NOF A;  1GSD A;  4L5O A;  3CSI A;  1BED A;  2H66 A;  3MNG A;  4V2L A;  2VCQ A;  2L6D A;  5ECP B;  6GSX A;  3IR4 A;  2I4A A;  1SK1 A;  3D6I A;  2A2S A;  3FKF A;  4XS6 A;  4FH8 A;  3GKM A;  4IJ3 A;  2VAF A;  3UVH A;  3QMX A;  4IP6 A;  4ISD A;  5F07 A;  4LL1 B;  4GQC A;  2H6Y A;  1MDI A;  2EIR A;  1ZOF A;  3P7X A;  1A8L A;  3IK7 A;  5GZZ B;  3LQ7 A;  1A0F A;  4DSS A;  2B7J A;  3N5O A;  3UOM A;  3MAK A;  5IO0 A;  4O7H A;  1EWX A;  5G1K A;  3PIN A;  2ON5 A;  2WZ9 A;  6GSY A;  1X5E A;  2R0G A;  5J41 A;  1I9D A;  3IE3 A;  4BL7 A;  2M72 A;  1VF2 A;  2CAI A;  2VO4 A;  1FC7 A;  3DEX A;  5GST A;  1X9M B;  1ERU A;  2H30 A;  2O89 A;  5J9C A;  3L9S A;  4Q5Q A;  1AQV A;  1EGO A;  2M46 A;  2PVQ A;  5CNW A;  3EMP A;  3DGQ A;  1TKD B;  3ZYW A;  3FZ5 A;  5KN2 A;  1K0C A;  20GS A;  3HZ8 A;  5JCG A;  1BPL A;  1FC9 A;  4XHM A;  2WJU A;  2GSQ A;  1TI1 A;  4ML6 A;  3GH6 A;  5D9W A;  3M9K A;  2O8V B;  4L5L A;  1SU9 A;  5JWR B;  2DJK A;  3CTG A;  1OE7 A;  3FY7 A;  3F9U A;  3KTL A;  4AJ6 A;  3LSZ A;  2DXN A;  2H6X A;  2N5B A;  5ELG A;  1EEM A;  4WEY A;  2I1U A;  2K8V A;  4MJA A;  1PD2 1;  3EC3 A;  4Z2T A;  2DML A;  1DUG A;  2K9F A;  2OAD A;  2GZP A;  2L57 A;  5DAK A;  2IME A;  4IW9 A;  3Q19 A;  19GS A;  3FZA A;  1GWC A;  1XVW A;  1ZYN A;  4MK3 A;  2DKH A;  2HRA A;  3TJG A;  1I5G A;  1YJ6 A;  3TJK A;  2L4Q A;  4NAX A;  2DJ2 A;  1F3B A;  3CRU A;  1Z3E A;  2GSR A;  1T8E B;  3Q74 A;  1LJR A;  4FQU A;  2R5G A;  18GS A;  1GSQ A;  1WJK A;  3AY8 A;  1A0R P;  1RW1 A;  4Z2U A;  4EF0 A;  1FB6 A;  1K0M A;  1R5A A;  2IFQ B;  4OFM A;  4MMM A;  2AYT A;  2FNO A;  2HSM A;  2XPD A;  1N6D A;  2K18 A;  4BVY B;  2AAW A;  2FD3 A;  5AIX A;  3ZZX A;  5DCH A;  5JWO B;  3VUR A;  4YKG A;  2REM A;  2YJ7 A;  2YP6 A;  3GA4 A;  3IC4 A;  1T00 A;  1K3Y A;  1FCF A;  5CRD A;  5DDL A;  5IMC A;  4WXT A;  1SD9 A;  1FVJ A;  3UL3 A;  4GHN A;  1PGT A;  5G2Z A;  2ES7 A;  1GUK A;  13GS A;  1N6F A;  2GS3 A;  5J9B A;  1A2L A;  4ID0 A;  1TK0 B;  3VK9 A;  4HI7 A;  1U3A A;  3QD9 A;  4V2M A;  3RPN A;  5EVO A;  14GS A;  3GX0 A;  5JCW A;  2LS5 A;  1O85 A;  1VGL A;  4ZBA A;  1T4Z A;  3ZRD A;  1TRV A;  4IP1 A;  4HQZ A;  1TU7 A;  3KJY A;  3UBL A;  3Q6O A;  2N5F A;  5D93 A;  5IMV A;  1B9X C;  3GST A;  3V1W A;  3D4T A;  1K0A A;  2GT6 A;  3HHV A;  4Q5F A;  2UZ8 A;  2F8F A;  4KCE A;  3I6A A;  5ECN B;  4MPG A;  3LG6 A;  2YJH A;  4GF0 A;  1J0F A;  5IMF A;  1GSE A;  1O7U A;  4OCE A;  4XTS A;  5CO3 A;  2IMK A;  4ECB A;  1X0R A;  2JSZ A;  4EXJ A;  4TR1 A;  1USB A;  3F3R A;  1QGV A;  3TOT A;  2OAC A;  3LXZ A;  1YEX A;  4TR3 A;  5A4V A;  3DYR A;  1YKA A;  4WR5 A;  5HFK A;  2F8A A;  1S3C A;  1SEN A;  1SK0 A;  3EUR A;  3GTU B;  3FZ4 A;  1LBK A;  5CP1 A;  3F4S A;  2F3M A;  3IHG A;  5H5Q A;  4LMV A;  3QAV A;  2E7P A;  1PKZ A;  2NPB A;  4MJB A;  1J08 A;  1B4Q A;  2JZR A;  2V1M A;  4YAP A;  1OC8 A;  2LRC A;  4TKY A;  3PGT A;  2X8G A;  3HJM A;  4OMV A;  1HNB A;  4AJ7 A;  3F0I A;  1EV4 A;  5HR3 A;  4KAE A;  1GTB A;  5ELA A;  4YQU A;  3WGE A;  2QA2 A;  5J5N A;  3DWV A;  2LNT A;  1WMJ A;  1XOB A;  1ZYE A;  2WDU A;  2QKE A;  4MAB A;  5AGY A;  4IGJ A;  2QA1 A;  3GX8 A;  1AAZ A;  3DVX A;  1K0D A;  2OBI A;  1DBY A;  2X8C A;  2K8S A;  1GTI A;  5HR1 A;  4YKF A;  4H86 A;  4FYU A;  1J9B A;  4G19 A;  1V9W A;  4BVX B;  5IO2 A;  3RPP A;  3APS A;  3D22 A;  1V98 A;  3ERG A;  5DJL A;  4GCI A;  1TP9 A;  5FHI A;  3MDK A;  2C80 A;  3CSJ A;  4PTS A;  1PMT A;  2H0H A;  5G30 A;  3QFA C;  2MYG A;  4N11 A;  1K0N A;  3GMF A;  4MA9 A;  3U5R E;  1URM A;  4TXV A;  4N0Z A;  3A3T A;  2VLV A;  7GSS A;  1NHY A;  4I2U A;  4KDY A;  4K8M A;  3H8Q A;  3UAR A;  1NW2 A;  3C73 A;  1GSY A;  3DRN A;  2E2G A;  3E0U A;  2VCZ A;  3H4K A;  4IQA A;  2R3X A;  5HQP A;  5AIV A;  3FW2 A;  3HDC A;  3GHA A;  1AUC A;  5G5E A;  3LW9 A;  3LYP A;  3F3Q A;  4JR6 A;  4MJC A;  2GST A;  4EVM A;  3BCI A;  5H5S A;  1XVQ A;  2HZE B;  3E9J B;  2C3N A;  4D73 A;  2YWO A;  1PL2 A;  1KEB A;  1TRW A;  2KLX A;  3UMA A;  5CRG A;  2D2Z A;  3QR6 A;  2IL3 A;  1SL1 B;  2HT9 A;  4MLY A;  2H1A A;  1JZO A;  1PRX A;  3J7Y k;  2WFC A;  1EV9 A;  6GSU A;  1XBS A;  3D21 A;  2VIM A;  2HXK A;  4FYC A;  4EC0 A;  2MMN A;  4EO3 A;  3GUR A;  2H6Z A;  4XRA A;  1AQW A;  1XZO A;  3GKX A;  1BAY A;  1YF1 A;  2JZT A;  3J7Y b;  2NTO A;  2TRX A;  3FR9 A;  5ECL B;  5INY A;  4NPB A;  1U88 A;  3W8S A;  3DD3 A;  1ILO A;  2FGX A;  3US3 A;  3GKN A;  2ZOA A;  1JLV A;  2C0E A;  3EPT A;  1M9B A;  2RII A;  5FT3 A;  2F51 A;  5KOX A;  1R26 A;  3FRC A;  4KW6 A;  3DJA A;  2CA8 A;  3KTB A;  3TRP A;  3WT1 A;  4TRX A;  2H76 A;  3F8U A;  2KP1 A;  3GRX A;  3TKS A;  2VL2 C;  3P2A A;  4XS4 B;  4KE3 A;  3QPM A;  1FVK A;  2LJR A;  3IV4 A;  4TR4 A;  2P31 A;  2VM1 A;  3TDG A;  4QL9 A;  2RLI A;  3LWA A;  4NV2 A;  1R7H A;  2C0D A;  2FWF A;  3JCM L;  4HDE A;  3QOU A;  1T1V A;  5EPF A;  3W6G A;  3O76 A;  4F03 A;  4MF7 A;  1GUL A;  5KN0 A;  2QGV A;  1ZYP A;  1V40 A;  2L6C A;  4Q5R A;  1WIK A;  1MD3 A;  4ILF A;  2LNS A;  4JZQ A;  4RI7 A;  3KD0 A;  5GAN D;  2C8U A;  4GSS A;  3DXB A;  1O8X A;  5IPG A;  3TKR A;  3KP9 A;  4AE2 A;  4ZB9 A;  3MOG A;  2ZO9 B;  1JZD A;  4K2X A;  5IMZ A;  3G9B A;  3H1N A;  1GLQ A;  2XHF A;  4EDZ A;  1A2M A;  1O81 A;  3APQ A;  4PUF C;  3VPQ A;  3GYK A;  1Z7P A;  4RI6 A;  2PBJ A;  5B8A A;  3D03 A;  1F3A A;  1M9A A;  3O3T A;  2IWT A;  4I2T A;  1ERW A;  4DSR A;  16GS A;  4N10 A;  1UA5 A;  5IIZ A;  3C1R A;  1G7E A;  2LST A;  3FHK A;  3HZ4 A;  3GKK A;  4POB A;  4MNN A;  2F9S A;  1J7X A;  2AJQ B;  4MF6 A;  2RM6 A;  2IJY A;  4USS A;  1F2E A;  1UVZ A;  4MZW A;  3D0Z A;  2HNL A;  1PSQ A;  1PX7 A;  2PVO C;  3RDW A;  1AXD A;  3IHQ A;  3LGC A;  2LTK A;  3F6D A;  2FWH A;  5ABR A;  3EYT A;  2XPE A;  2V6K A;  3GHF A;  3FYG A;  3GN3 A;  1SYX A;  1SL2 B;  1WRY A;  3WYW A;  1XWK A;  3G7I A;  2FUG 2;  2VCV A;  3L9V A;  1M2A A;  4NMU A;  5DQY A;  3ME8 A;  4IHU A;  4HQS A;  3IDV A;  4OFT A;  2IFQ A;  2BMX A;  1N2A A;  5D9T A;  3M1G A;  3C7M A;  3CSH A;  2AHE A;  4BVY A;  2VLT A;  1NM3 A;  4K5S A;  2AB6 A;  4DEJ A;  2PUK C;  4HJ2 A;  3VWU A;  2H1G A;  2H19 A;  3F63 A;  4DSS B;  2PPT A;  2H01 A;  4G0K A;  1BG5 A;  4WR4 A;  2TRC P;  3ERF A;  3RAZ A;  4EE0 A;  1H4O A;  1YZX A;  2A2R A;  4POL A;  1DE2 A;  2WCI A;  3F4T A;  3H93 A;  3IPZ A;  3L0H A;  2YCD A;  4F9Z A;  2PMT A;  2OA7 A;  1WWJ A;  2QC7 A;  4PNG A;  2J9H A;  5ECI B;  1FB0 A;  4KDU A;  1K3O A;  4ICY A;  2G0F A;  2MBS A;  4L0U A;  4HOJ A;  2H1D A;  1M7T A;  3UAP A;  3EE2 A;  2GDR A;  5CRW A;  1ON4 A;  5D9X A;  4NXI A;  3K50 A;  5ECQ B;  1HNA A;  3GNJ A;  1GTU A;  2FY6 A;  1EP7 A;  3FR3 A;  5GAP D;  1GUH A;  2X8H A;  3TJB A;  4ACS A;  2CVD A;  2H72 A;  1JFU A;  4JC0 A;  1EP8 A;  1HD2 A;  2PWJ A;  4MPF A;  3LXT A;  3RHC A;  3MWH A;  5IPH A;  1GSS A;  5DJM A;  1ZCP A;  3NZN A;  2KHP A;  2PN8 A;  2LEG A;  1XWB A;  1QQ2 A;  2FWG A;  3L9U A;  2VL2 A;  3P90 A;  1OC3 A;  3IK9 A;  1T3B A;  2A4H A;  1FG4 A;  1EOH A;  2C1Y A;  4XS1 A;  2B7K A;  5EY6 A;  1F37 A;  3PPU A;  2P0G A;  4OD7 A;  1EGR A;  2E2M A;  5IQY A;  2O85 A;  4L0W A;  4TN8 A;  2L5O A;  1ACV A;  3TOU A;  2FLS A;  2CAQ A;  3W8J A;  3HD5 A;  3GL5 A;  2X4A A;  4XCS A;  2HYX A;  2PER A;  1Q98 A;  1XW6 A;  1ABA A;  1IYI A;  3N9J A;  3D4M A;  5ECK B;  3ZTL A;  4K7N A;  5HR0 A;  3MIX A;  3A2W A;  2KOK A;  3E3E A;  1QFN A;  4IKH A;  2P5Q A;  5ECM B;  1DE1 A;  2DJ3 A;  3SWL A;  1SJ6 A;  1FW1 A;  2E0Q A;  3H79 A;  4MZC A;  2C0G A;  2JAC A;  4JBB A;  5H5R A;  2WUL A;  1GRX A;  1SKR B;  2L4C A;  2GGT A;  3VWX A;  2PU9 C;  2YV9 A;  2YV7 A;  5HR2 A;  5D9V A;  3ZML A;  1NHO A;  3TCO A;  4L8E A;  5IOX A;  3DIE A;  2IIY A;  5E4W A;  5A4W A;  4BA7 A;  5DAL B;  4BVX A;  2DC5 A;  3CXG A;  5AN1 A;  2CZ2 A;  4MF5 A;  2VL9 A;  4AF2 A;  2JL4 A;  2R37 A;  1N6E A;  4HZ4 A;  2H8L A;  1SL0 B;  3QAG A;  5ID2 B;  4EKZ A;  2TIR A;  1ZGN A;  5J4U A;  1GH2 A;  1JHB A;  4ML1 A;  4J57 E;  1B9Y C;  1CQH A;  4YH2 A;  2YZU A;  1X5C A;  3I43 A;  4G9H A;  22GS A;  2VUP A;  5IMD A;  3VPT A;  5FWG A;  3KMN A;  4V1A p;  2FHE A;  1ERV A;  2LKU A;  1SK2 A;  3A2X A;  4Q5N A;  4IBP A;  4J56 E;  5ECR B;  3TRQ A;  5ENU A;  4PQH A;  2V2G A;  3KH9 A;  5ECS A;  3M9J A;  1GSU A;  4WKW A;  1CQG A;  4ZB8 A;  4KDX A;  5A4U A;  2CX4 A;  2H71 A;  2JSY A;  5F05 A;  4ECI A;  3IOS A;  1FOV A;  2OE0 A;  3O6T A;  4KX4 A;  1SKS B;  1EOG A;  2FA4 A;  4KF9 A;  2HZE A;  4O32 A;  2DLX A;  3VWW A;  1Y25 A;  4ZBB A;  4GTU A;  1R5P A;  3ZRE A;  2GZZ A;  4LL4 B;  3TRX A;  4NWY A;  1S3A A;  1PN0 A;  3IAS 2;  3NIV A;  4O5Q A;  2CQ9 A;  3QAW A;  4ZL8 A;  3FMW A;  3FK8 A;  3HJP A;  4YAV A;  4A5P A;  4FO5 A;  2GTU A;  2B5E A;  3LOR A;  1MTC A;  3ERW A;  1W4V A;  3ZMK A;  4WBR D;  1PL1 A;  2X49 A;  1C72 A;  1Z6M A;  4GST A;  1H75 A;  3ZIV A;  1OKD A;  3DUP A;  1K3L A;  3A5I A;  5G1L A;  4POM A;  3APO A;  4X0X A;  1U6T A;  4HUA A;  4MJE A;  2YNX A;  2A4V A;  1F9M A;  4MZB A;  4QL7 A;  3KXO A;  3P8W A;  4YQM A;  5CAX A;  4KUN A;  3KM6 A;  4BWQ A;  3VFI A;  1MD4 A;  2V6O A;  3I69 A;  5G5F A;  1U3I A;  2OJL A;  3R3E A;  3TGZ A;  4TXO A;  4XS4 A;  4I8B A;  2HE3 A;  1THX A;  2MMO A;  3R2Q A;  1G0T A;  3PH9 A;  4F0C A;  4IS0 A;  2NDO A;  4CW9 A;  4XIH A;  1BYE A;  4NV5 A;  2HRF A;  4EUY A;  3EU4 A;  2CV4 A;  1VF4 A;  1XIY A;  3HKR A;  4ZB6 A;  3Q18 A;  1A23 A;  1WPI A;  2FA8 A;  1GSF A;  2IMI A;  1AC1 A;  2X64 A;  3ZLP A;  2R6K A;  1PN9 A;  5F0G A;  5JWQ B;  3MSZ A;  5DBQ A;  1XW9 A;  1W89 A;  3LEF A;  2P5R A;  4P3Y B;  2I9H A;  4KA0 A;  4D73 B;  1JZW A;  1ZYQ B;  4WBJ A;  4V2N A;  2VD0 A;  4GXZ A;  5D96 A;  4E8E A;  1YY7 A;  3HJO A;  1M99 A;  2BTO T;  3G7J A;  4IEL A;  4ZIJ A;  2LQO A;  1QUW A;  2ALB A;  3ZVJ A;  1HNC A;  1OVN A;  2DBC A;  5B8B A;  4LA1 A;  4MH3 A;  2KP2 A;  2H73 A;  1Z5Y E;  4CY6 A;  5IM9 A;  3VLN A;  2OKA A;  3U6V A;  3VI7 A;  5LD0 A;  2OBK A;  2M80 A;  4PX1 A;  3ISO A;  1Z9H A;  3WT2 A;  1TI3 A;  4NHW A;  2MMA A;  2HLS A;  1TXX A;  5F06 A;  2A2P A;  4O92 A;  4F82 A;  1KNG A;  1TTZ A;  4PUR A;  3L4N A;  1GNW A;  3TB2 A;  3EWL A;  1RK4 A;  1VF3 A;  4X1U A;  1V58 A;  1WOU A;  1VRS D;  2O87 A;  2HRN A;  1XOA A;  4KSO A;  4JR4 A;  8GSS A;  5KEJ A;  2X99 A;  1RQM A;  2B5X A;  4PNF A;  3HA9 A;  4IQ1 A;  4I6X A;  4IN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...