1TIDB

Crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: poised for phosphorylation complex with atp, crystal form i
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
GSHMSLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDASGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Anti-sigma F factor
publication title Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 39
structure length 119
sequence length 119
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1tidB00
1T6RA 3MGLA 2KA5A 3T6OA 5EUUA 1VC1A 3IH8A 3AGDA 1AUZA 5EZBA 2KLNA 3IF5A 1H4ZA 5EUXA 4XS5A 1THNB 3AGEA 2VY9A 1SBOA 3F43A 3IH9A 3IHBA 3NY7A 3ZTBA 1H4XA 5EUSA 1TIDB 4HYLA 3IHAA 4DGHA 1H4YA 1TILB 3LLOA 3OIZA 5EUWA 1TH8B 5EUZA 4QTPA 3OIRA 3LKLA 1BUZA 3ZXNA 4DGFA
chains in the Genus database with same CATH superfamily
1N6EA 3MGLA 2CWWA 4AEJA 3GK7A 3IF5A 1H4ZA 1SBOA 1J7XA 3GHFA 1FCFA 4HYLA 2ZOAA 1H4YA 4QTPA 1WXXA 1BUZA 1T6RA 3T6OA 3V8VA 5EZBA 4AE2A 2KLNA 2DXLA 5EUXA 1N6DA 4L8KA 3GVKA 1THNB 4L1CA 2VY9A 3D03A 2ZO9B 3IHAA 4DGHA 1HF2A 3LLOA 1TH8B 3LKLA 3GVJA 1FC9A 3LDFA 2KA5A 1FC6A 1VC1A 1AUZA 4HIZA 2AS0A 2RRLA 4XS5A 3ZTBA 3F43A 3DUPA 3NY7A 1BPLA 2B78A 3GMFA 1H4XA 1N6FA 1TIDB 1K32A 3EH7A 3MOGA 1TILB 3C0KA 1FC7A 5EUZA 3DORA 3V97A 1V0EA 3K50A 5EUUA 3IH8A 3JU4A 3AGDA 1V0FA 4GHNA 3VSEA 4DMGA 3AGEA 3IH9A 3IHBA 5EUSA 3D3UA 4JC0A 2DXNA 2OASA 3OIZA 5EUWA 3GVLA 3DJAA 3OIRA 3QDQA 1WXWA 3ZXNA 4DGFA
chains in the Genus database with same CATH topology
1T6RA 3MGLA 2KA5A 3T6OA 5EUUA 1VC1A 3IH8A 3AGDA 1AUZA 5EZBA 2KLNA 3IF5A 1H4ZA 5EUXA 4XS5A 1THNB 3AGEA 2VY9A 1SBOA 3F43A 3IH9A 3IHBA 3NY7A 3ZTBA 1H4XA 5EUSA 1TIDB 4HYLA 3IHAA 4DGHA 1H4YA 1TILB 3LLOA 3OIZA 5EUWA 1TH8B 5EUZA 4QTPA 3OIRA 3LKLA 1BUZA 3ZXNA 4DGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6R A;  3MGL A;  2KA5 A;  3T6O A;  5EUU A;  1VC1 A;  3IH8 A;  3AGD A;  1AUZ A;  5EZB A;  2KLN A;  3IF5 A;  1H4Z A;  5EUX A;  4XS5 A;  1THN B;  3AGE A;  2VY9 A;  1SBO A;  3F43 A;  3IH9 A;  3IHB A;  3NY7 A;  3ZTB A;  1H4X A;  5EUS A;  1TID B;  4HYL A;  3IHA A;  4DGH A;  1H4Y A;  1TIL B;  3LLO A;  3OIZ A;  5EUW A;  1TH8 B;  5EUZ A;  4QTP A;  3OIR A;  3LKL A;  1BUZ A;  3ZXN A;  4DGF A; 
#chains in the Genus database with same CATH topology
 1N6E A;  3MGL A;  2CWW A;  4AEJ A;  3GK7 A;  3IF5 A;  1H4Z A;  1SBO A;  1J7X A;  3GHF A;  1FCF A;  4HYL A;  2ZOA A;  1H4Y A;  4QTP A;  1WXX A;  1BUZ A;  1T6R A;  3T6O A;  3V8V A;  5EZB A;  4AE2 A;  2KLN A;  2DXL A;  5EUX A;  1N6D A;  4L8K A;  3GVK A;  1THN B;  4L1C A;  2VY9 A;  3D03 A;  2ZO9 B;  3IHA A;  4DGH A;  1HF2 A;  3LLO A;  1TH8 B;  3LKL A;  3GVJ A;  1FC9 A;  3LDF A;  2KA5 A;  1FC6 A;  1VC1 A;  1AUZ A;  4HIZ A;  2AS0 A;  2RRL A;  4XS5 A;  3ZTB A;  3F43 A;  3DUP A;  3NY7 A;  1BPL A;  2B78 A;  3GMF A;  1H4X A;  1N6F A;  1TID B;  1K32 A;  3EH7 A;  3MOG A;  1TIL B;  3C0K A;  1FC7 A;  5EUZ A;  3DOR A;  3V97 A;  1V0E A;  3K50 A;  5EUU A;  3IH8 A;  3JU4 A;  3AGD A;  1V0F A;  4GHN A;  3VSE A;  4DMG A;  3AGE A;  3IH9 A;  3IHB A;  5EUS A;  3D3U A;  4JC0 A;  2DXN A;  2OAS A;  3OIZ A;  5EUW A;  3GVL A;  3DJA A;  3OIR A;  3QDQ A;  1WXW A;  3ZXN A;  4DGF A; 
#chains in the Genus database with same CATH homology
 1T6R A;  3MGL A;  2KA5 A;  3T6O A;  5EUU A;  1VC1 A;  3IH8 A;  3AGD A;  1AUZ A;  5EZB A;  2KLN A;  3IF5 A;  1H4Z A;  5EUX A;  4XS5 A;  1THN B;  3AGE A;  2VY9 A;  1SBO A;  3F43 A;  3IH9 A;  3IHB A;  3NY7 A;  3ZTB A;  1H4X A;  5EUS A;  1TID B;  4HYL A;  3IHA A;  4DGH A;  1H4Y A;  1TIL B;  3LLO A;  3OIZ A;  5EUW A;  1TH8 B;  5EUZ A;  4QTP A;  3OIR A;  3LKL A;  1BUZ A;  3ZXN A;  4DGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...