1TIDB

Crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: poised for phosphorylation complex with atp, crystal form i
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
GSHMSLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDASGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-sigma F factor
publication title Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 39
structure length 119
sequence length 119
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1tidB00
3T6OA 4DGHA 3NY7A 5EUZA 2KA5A 1T6RA 3F43A 5EUSA 3IHBA 1TH8B 1THNB 5EUXA 1H4YA 1SBOA 3LKLA 1TILB 1H4XA 5EZBA 1AUZA 3IH9A 4HYLA 3ZXNA 1BUZA 1VC1A 3AGEA 3AGDA 3MGLA 3LLOA 4XS5A 3ZTBA 2VY9A 1H4ZA 2KLNA 4DGFA 1TIDB 3IH8A 3IHAA 5EUUA 3OIZA 4QTPA 5EUWA 3IF5A 3OIRA
chains in the Genus database with same CATH superfamily
5EUSA 3GVLA 5EUXA 3VSEA 2CWWA 1J7XA 3LKLA 1FC9A 3IH9A 4XS5A 3ZTBA 1K32A 1H4ZA 3GK7A 3IH8A 3GVKA 1V0FA 3D03A 3DJAA 4L8KA 5EUZA 3GVJA 1T6RA 3F43A 2DXLA 3V8VA 1FC7A 3DUPA 3D3UA 3C0KA 5EZBA 4HYLA 3EH7A 4DGFA 4QTPA 5EUWA 3OIRA 2B78A 3NY7A 1N6DA 4GHNA 4L1CA 2KA5A 3IHBA 1TH8B 1THNB 1SBOA 3GMFA 3V97A 1TILB 1N6EA 3ZXNA 1VC1A 3AGEA 3AGDA 3MGLA 3LLOA 3MOGA 3QDQA 2KLNA 1TIDB 3JU4A 4AE2A 1FC6A 1WXWA 1HF2A 2DXNA 3T6OA 4DGHA 1N6FA 3LDFA 1WXXA 1FCFA 1V0EA 4HIZA 2RRLA 1H4YA 3DORA 4AEJA 2AS0A 1H4XA 2OASA 1AUZA 4JC0A 2ZO9B 1BUZA 2VY9A 3GHFA 2ZOAA 3IHAA 5EUUA 3OIZA 1BPLA 4DMGA 3IF5A 3K50A
chains in the Genus database with same CATH topology
3T6OA 4DGHA 3NY7A 5EUZA 2KA5A 1T6RA 3F43A 5EUSA 3IHBA 1TH8B 1THNB 5EUXA 1H4YA 1SBOA 3LKLA 1TILB 1H4XA 5EZBA 1AUZA 3IH9A 4HYLA 3ZXNA 1BUZA 1VC1A 3AGEA 3AGDA 3MGLA 3LLOA 4XS5A 3ZTBA 2VY9A 1H4ZA 2KLNA 4DGFA 1TIDB 3IH8A 3IHAA 5EUUA 3OIZA 4QTPA 5EUWA 3IF5A 3OIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6O A;  4DGH A;  3NY7 A;  5EUZ A;  2KA5 A;  1T6R A;  3F43 A;  5EUS A;  3IHB A;  1TH8 B;  1THN B;  5EUX A;  1H4Y A;  1SBO A;  3LKL A;  1TIL B;  1H4X A;  5EZB A;  1AUZ A;  3IH9 A;  4HYL A;  3ZXN A;  1BUZ A;  1VC1 A;  3AGE A;  3AGD A;  3MGL A;  3LLO A;  4XS5 A;  3ZTB A;  2VY9 A;  1H4Z A;  2KLN A;  4DGF A;  1TID B;  3IH8 A;  3IHA A;  5EUU A;  3OIZ A;  4QTP A;  5EUW A;  3IF5 A;  3OIR A; 
#chains in the Genus database with same CATH topology
 5EUS A;  3GVL A;  5EUX A;  3VSE A;  2CWW A;  1J7X A;  3LKL A;  1FC9 A;  3IH9 A;  4XS5 A;  3ZTB A;  1K32 A;  1H4Z A;  3GK7 A;  3IH8 A;  3GVK A;  1V0F A;  3D03 A;  3DJA A;  4L8K A;  5EUZ A;  3GVJ A;  1T6R A;  3F43 A;  2DXL A;  3V8V A;  1FC7 A;  3DUP A;  3D3U A;  3C0K A;  5EZB A;  4HYL A;  3EH7 A;  4DGF A;  4QTP A;  5EUW A;  3OIR A;  2B78 A;  3NY7 A;  1N6D A;  4GHN A;  4L1C A;  2KA5 A;  3IHB A;  1TH8 B;  1THN B;  1SBO A;  3GMF A;  3V97 A;  1TIL B;  1N6E A;  3ZXN A;  1VC1 A;  3AGE A;  3AGD A;  3MGL A;  3LLO A;  3MOG A;  3QDQ A;  2KLN A;  1TID B;  3JU4 A;  4AE2 A;  1FC6 A;  1WXW A;  1HF2 A;  2DXN A;  3T6O A;  4DGH A;  1N6F A;  3LDF A;  1WXX A;  1FCF A;  1V0E A;  4HIZ A;  2RRL A;  1H4Y A;  3DOR A;  4AEJ A;  2AS0 A;  1H4X A;  2OAS A;  1AUZ A;  4JC0 A;  2ZO9 B;  1BUZ A;  2VY9 A;  3GHF A;  2ZOA A;  3IHA A;  5EUU A;  3OIZ A;  1BPL A;  4DMG A;  3IF5 A;  3K50 A; 
#chains in the Genus database with same CATH homology
 3T6O A;  4DGH A;  3NY7 A;  5EUZ A;  2KA5 A;  1T6R A;  3F43 A;  5EUS A;  3IHB A;  1TH8 B;  1THN B;  5EUX A;  1H4Y A;  1SBO A;  3LKL A;  1TIL B;  1H4X A;  5EZB A;  1AUZ A;  3IH9 A;  4HYL A;  3ZXN A;  1BUZ A;  1VC1 A;  3AGE A;  3AGD A;  3MGL A;  3LLO A;  4XS5 A;  3ZTB A;  2VY9 A;  1H4Z A;  2KLN A;  4DGF A;  1TID B;  3IH8 A;  3IHA A;  5EUU A;  3OIZ A;  4QTP A;  5EUW A;  3IF5 A;  3OIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...