4DGHA

Structure of sulp transporter stas domain from vibrio cholerae refined to 1.9 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
128
Chain Sequence
NAEMSYELAQHGRSTLPRELAVYALEGPFFFAAAETFERVMGSIQETPQILILRLKWVPFMDITGIQTLEEMIQSFHKRGIKVLISGANSRVSQKLVKAGIVKLVGEQNVYPVFEGALSAALTEIEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sulfate permease family protein
publication title Structure of SulP Transporter STAS Domain from Vibrio Cholerae Refined to 1.9 Angstrom Resolution
rcsb
source organism Vibrio cholerae
molecule tags Transport protein
total genus 41
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 4dghA00
3IF5A 5EUSA 1SBOA 1T6RA 4DGFA 1H4YA 3NY7A 4DGHA 1THNB 2KLNA 1TH8B 3ZTBA 3IH8A 3LLOA 5EZBA 5EUUA 1H4XA 3IH9A 1VC1A 1AUZA 1TIDB 1BUZA 3OIRA 3F43A 3T6OA 4QTPA 5EUWA 4HYLA 3IHBA 1H4ZA 3MGLA 3AGDA 5EUZA 3AGEA 3OIZA 2KA5A 1TILB 3ZXNA 3LKLA 2VY9A 4XS5A 5EUXA 3IHAA
chains in the Genus database with same CATH superfamily
3IF5A 1SBOA 4DGFA 3V8VA 1H4YA 3ZTBA 3C0KA 3GK7A 1VC1A 2AS0A 3F43A 3T6OA 3VSEA 4HYLA 3K50A 4DMGA 3GVLA 2RRLA 3MGLA 5EUZA 2KA5A 1N6DA 1N6EA 4AE2A 4GHNA 3DUPA 1K32A 3DORA 3NY7A 1THNB 3DJAA 2ZO9B 3LLOA 3GMFA 5EUUA 3IH9A 4L1CA 1AUZA 1WXXA 1TIDB 2DXLA 3JU4A 4QTPA 4JC0A 3EH7A 3AGDA 3AGEA 3LDFA 3OIZA 1FC6A 2ZOAA 3MOGA 4XS5A 4AEJA 2OASA 4HIZA 1FC9A 1H4XA 3QDQA 1BPLA 3OIRA 3IHBA 3GHFA 2DXNA 1H4ZA 1V0EA 3LKLA 1V0FA 1HF2A 2B78A 5EUXA 5EZBA 5EUSA 1J7XA 1N6FA 1T6RA 3GVKA 1FCFA 4DGHA 2KLNA 1WXWA 1TH8B 3IH8A 3D3UA 3GVJA 1BUZA 3V97A 3D03A 5EUWA 2CWWA 1TILB 3ZXNA 4L8KA 1FC7A 2VY9A 3IHAA
chains in the Genus database with same CATH topology
3IF5A 5EUSA 1SBOA 1T6RA 4DGFA 1H4YA 3NY7A 4DGHA 1THNB 2KLNA 1TH8B 3ZTBA 3IH8A 3LLOA 5EZBA 5EUUA 1H4XA 3IH9A 1VC1A 1AUZA 1TIDB 1BUZA 3OIRA 3F43A 3T6OA 4QTPA 5EUWA 4HYLA 3IHBA 1H4ZA 3MGLA 3AGDA 5EUZA 3AGEA 3OIZA 2KA5A 1TILB 3ZXNA 3LKLA 2VY9A 4XS5A 5EUXA 3IHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF5 A;  5EUS A;  1SBO A;  1T6R A;  4DGF A;  1H4Y A;  3NY7 A;  4DGH A;  1THN B;  2KLN A;  1TH8 B;  3ZTB A;  3IH8 A;  3LLO A;  5EZB A;  5EUU A;  1H4X A;  3IH9 A;  1VC1 A;  1AUZ A;  1TID B;  1BUZ A;  3OIR A;  3F43 A;  3T6O A;  4QTP A;  5EUW A;  4HYL A;  3IHB A;  1H4Z A;  3MGL A;  3AGD A;  5EUZ A;  3AGE A;  3OIZ A;  2KA5 A;  1TIL B;  3ZXN A;  3LKL A;  2VY9 A;  4XS5 A;  5EUX A;  3IHA A; 
#chains in the Genus database with same CATH topology
 3IF5 A;  1SBO A;  4DGF A;  3V8V A;  1H4Y A;  3ZTB A;  3C0K A;  3GK7 A;  1VC1 A;  2AS0 A;  3F43 A;  3T6O A;  3VSE A;  4HYL A;  3K50 A;  4DMG A;  3GVL A;  2RRL A;  3MGL A;  5EUZ A;  2KA5 A;  1N6D A;  1N6E A;  4AE2 A;  4GHN A;  3DUP A;  1K32 A;  3DOR A;  3NY7 A;  1THN B;  3DJA A;  2ZO9 B;  3LLO A;  3GMF A;  5EUU A;  3IH9 A;  4L1C A;  1AUZ A;  1WXX A;  1TID B;  2DXL A;  3JU4 A;  4QTP A;  4JC0 A;  3EH7 A;  3AGD A;  3AGE A;  3LDF A;  3OIZ A;  1FC6 A;  2ZOA A;  3MOG A;  4XS5 A;  4AEJ A;  2OAS A;  4HIZ A;  1FC9 A;  1H4X A;  3QDQ A;  1BPL A;  3OIR A;  3IHB A;  3GHF A;  2DXN A;  1H4Z A;  1V0E A;  3LKL A;  1V0F A;  1HF2 A;  2B78 A;  5EUX A;  5EZB A;  5EUS A;  1J7X A;  1N6F A;  1T6R A;  3GVK A;  1FCF A;  4DGH A;  2KLN A;  1WXW A;  1TH8 B;  3IH8 A;  3D3U A;  3GVJ A;  1BUZ A;  3V97 A;  3D03 A;  5EUW A;  2CWW A;  1TIL B;  3ZXN A;  4L8K A;  1FC7 A;  2VY9 A;  3IHA A; 
#chains in the Genus database with same CATH homology
 3IF5 A;  5EUS A;  1SBO A;  1T6R A;  4DGF A;  1H4Y A;  3NY7 A;  4DGH A;  1THN B;  2KLN A;  1TH8 B;  3ZTB A;  3IH8 A;  3LLO A;  5EZB A;  5EUU A;  1H4X A;  3IH9 A;  1VC1 A;  1AUZ A;  1TID B;  1BUZ A;  3OIR A;  3F43 A;  3T6O A;  4QTP A;  5EUW A;  4HYL A;  3IHB A;  1H4Z A;  3MGL A;  3AGD A;  5EUZ A;  3AGE A;  3OIZ A;  2KA5 A;  1TIL B;  3ZXN A;  3LKL A;  2VY9 A;  4XS5 A;  5EUX A;  3IHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...