4DGHA

Structure of sulp transporter stas domain from vibrio cholerae refined to 1.9 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
128
Chain Sequence
NAEMSYELAQHGRSTLPRELAVYALEGPFFFAAAETFERVMGSIQETPQILILRLKWVPFMDITGIQTLEEMIQSFHKRGIKVLISGANSRVSQKLVKAGIVKLVGEQNVYPVFEGALSAALTEIEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Sulfate permease family protein
publication title Structure of SulP Transporter STAS Domain from Vibrio Cholerae Refined to 1.9 Angstrom Resolution
rcsb
source organism Vibrio cholerae
total genus 41
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 4dghA00
3MGLA 3ZXNA 1TIDB 1T6RA 4DGHA 3AGEA 5EUXA 3F43A 4XS5A 3LKLA 3NY7A 1H4XA 2KA5A 1TILB 3OIRA 4QTPA 3LLOA 3T6OA 5EUWA 1H4YA 5EUUA 4DGFA 3IHAA 2VY9A 5EUZA 5EUSA 1BUZA 3ZTBA 1TH8B 1AUZA 2KLNA 3IH8A 1VC1A 3IH9A 4HYLA 5EZBA 1SBOA 3AGDA 3IF5A 1THNB 1H4ZA 3IHBA 3OIZA
chains in the Genus database with same CATH superfamily
1HF2A 4JC0A 3F43A 4XS5A 3OIRA 4AEJA 1H4YA 4GHNA 5EUUA 4DGFA 3V8VA 3ZTBA 1TH8B 1AUZA 3GMFA 1WXWA 4L8KA 3VSEA 2DXLA 3GVJA 3D3UA 3D03A 1FC9A 4DMGA 5EUWA 1N6DA 3LDFA 3MOGA 3DORA 1V0FA 2VY9A 3EH7A 5EUSA 2AS0A 3QDQA 3GVLA 2KLNA 1WXXA 3IH8A 1BPLA 3C0KA 4HIZA 1K32A 3K50A 3MGLA 1TIDB 4DGHA 4L1CA 3V97A 2KA5A 3GK7A 1TILB 3T6OA 3GVKA 2DXNA 3IHAA 1BUZA 2ZOAA 1FCFA 4HYLA 1J7XA 1SBOA 3AGDA 3DJAA 2OASA 3OIZA 3ZXNA 2ZO9B 3DUPA 1T6RA 3AGEA 5EUXA 3LKLA 1N6FA 3NY7A 1H4XA 1V0EA 4QTPA 2RRLA 3LLOA 4AE2A 1FC6A 5EUZA 2B78A 1VC1A 3IH9A 2CWWA 5EZBA 3IF5A 1N6EA 1FC7A 3GHFA 1THNB 1H4ZA 3IHBA 3JU4A
chains in the Genus database with same CATH topology
3MGLA 3ZXNA 1TIDB 1T6RA 4DGHA 3AGEA 5EUXA 3F43A 4XS5A 3LKLA 3NY7A 1H4XA 2KA5A 1TILB 3OIRA 4QTPA 3LLOA 3T6OA 5EUWA 1H4YA 5EUUA 4DGFA 3IHAA 2VY9A 5EUZA 5EUSA 1BUZA 3ZTBA 1TH8B 1AUZA 2KLNA 3IH8A 1VC1A 3IH9A 4HYLA 5EZBA 1SBOA 3AGDA 3IF5A 1THNB 1H4ZA 3IHBA 3OIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGL A;  3ZXN A;  1TID B;  1T6R A;  4DGH A;  3AGE A;  5EUX A;  3F43 A;  4XS5 A;  3LKL A;  3NY7 A;  1H4X A;  2KA5 A;  1TIL B;  3OIR A;  4QTP A;  3LLO A;  3T6O A;  5EUW A;  1H4Y A;  5EUU A;  4DGF A;  3IHA A;  2VY9 A;  5EUZ A;  5EUS A;  1BUZ A;  3ZTB A;  1TH8 B;  1AUZ A;  2KLN A;  3IH8 A;  1VC1 A;  3IH9 A;  4HYL A;  5EZB A;  1SBO A;  3AGD A;  3IF5 A;  1THN B;  1H4Z A;  3IHB A;  3OIZ A; 
#chains in the Genus database with same CATH topology
 1HF2 A;  4JC0 A;  3F43 A;  4XS5 A;  3OIR A;  4AEJ A;  1H4Y A;  4GHN A;  5EUU A;  4DGF A;  3V8V A;  3ZTB A;  1TH8 B;  1AUZ A;  3GMF A;  1WXW A;  4L8K A;  3VSE A;  2DXL A;  3GVJ A;  3D3U A;  3D03 A;  1FC9 A;  4DMG A;  5EUW A;  1N6D A;  3LDF A;  3MOG A;  3DOR A;  1V0F A;  2VY9 A;  3EH7 A;  5EUS A;  2AS0 A;  3QDQ A;  3GVL A;  2KLN A;  1WXX A;  3IH8 A;  1BPL A;  3C0K A;  4HIZ A;  1K32 A;  3K50 A;  3MGL A;  1TID B;  4DGH A;  4L1C A;  3V97 A;  2KA5 A;  3GK7 A;  1TIL B;  3T6O A;  3GVK A;  2DXN A;  3IHA A;  1BUZ A;  2ZOA A;  1FCF A;  4HYL A;  1J7X A;  1SBO A;  3AGD A;  3DJA A;  2OAS A;  3OIZ A;  3ZXN A;  2ZO9 B;  3DUP A;  1T6R A;  3AGE A;  5EUX A;  3LKL A;  1N6F A;  3NY7 A;  1H4X A;  1V0E A;  4QTP A;  2RRL A;  3LLO A;  4AE2 A;  1FC6 A;  5EUZ A;  2B78 A;  1VC1 A;  3IH9 A;  2CWW A;  5EZB A;  3IF5 A;  1N6E A;  1FC7 A;  3GHF A;  1THN B;  1H4Z A;  3IHB A;  3JU4 A; 
#chains in the Genus database with same CATH homology
 3MGL A;  3ZXN A;  1TID B;  1T6R A;  4DGH A;  3AGE A;  5EUX A;  3F43 A;  4XS5 A;  3LKL A;  3NY7 A;  1H4X A;  2KA5 A;  1TIL B;  3OIR A;  4QTP A;  3LLO A;  3T6O A;  5EUW A;  1H4Y A;  5EUU A;  4DGF A;  3IHA A;  2VY9 A;  5EUZ A;  5EUS A;  1BUZ A;  3ZTB A;  1TH8 B;  1AUZ A;  2KLN A;  3IH8 A;  1VC1 A;  3IH9 A;  4HYL A;  5EZB A;  1SBO A;  3AGD A;  3IF5 A;  1THN B;  1H4Z A;  3IHB A;  3OIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...