The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
118
|
structure length |
118
|
Chain Sequence |
GSHMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDLESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQPIPGRLAFFPNRRAAMADL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of a SLC26 Anion Transporter STAS Domain in Complex with Acyl Carrier Protein: Implications for E. coli YchM in Fatty Acid Metabolism.
pubmed doi rcsb |
molecule keywords |
Sulfate transporter
|
molecule tags |
Membrane protein
|
source organism |
Escherichia coli
|
total genus |
36
|
structure length |
118
|
sequence length |
118
|
ec nomenclature | |
pdb deposition date | 2010-07-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01740 | STAS | STAS domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Transcription Regulator spoIIAA | STAS domain |
#chains in the Genus database with same CATH superfamily 5EUZ A; 4DGH A; 4DGF A; 4XS5 A; 2KLN A; 3OIZ A; 1T6R A; 5EUS A; 3NY7 A; 3MGL A; 1AUZ A; 3IHB A; 3AGD A; 1TH8 B; 4HYL A; 3IF5 A; 1H4X A; 2KA5 A; 3IH9 A; 3IHA A; 1THN B; 1TIL B; 1H4Z A; 4QTP A; 1H4Y A; 5EUU A; 1BUZ A; 5EUW A; 1SBO A; 3IH8 A; 3LKL A; 3F43 A; 1TID B; 3OIR A; 3LLO A; 1VC1 A; 3AGE A; 5EZB A; 3ZTB A; 3ZXN A; 2VY9 A; 3T6O A; 5EUX A; #chains in the Genus database with same CATH topology 2KLN A; 3MGL A; 3D3U A; 3V8V A; 1FCF A; 1K32 A; 1V0E A; 1N6E A; 2ZOA A; 2DXL A; 3EH7 A; 1H4Z A; 3VSE A; 3C0K A; 5EUW A; 5EZB A; 3QDQ A; 5EUX A; 4DGH A; 3NY7 A; 2OAS A; 1AUZ A; 3DUP A; 3AGD A; 1FC6 A; 3D03 A; 4L1C A; 2KA5 A; 3IH9 A; 3MOG A; 3IHA A; 3GVL A; 4JC0 A; 3GHF A; 1BUZ A; 3IH8 A; 3LKL A; 4AE2 A; 1TID B; 3OIR A; 1VC1 A; 3ZTB A; 4DMG A; 4HIZ A; 3IHB A; 3GVK A; 3GK7 A; 5EUZ A; 1N6F A; 1WXX A; 4XS5 A; 5EUS A; 3OIZ A; 1WXW A; 1BPL A; 1J7X A; 4L8K A; 1TH8 B; 4HYL A; 3IF5 A; 1TIL B; 1H4Y A; 1SBO A; 1FC7 A; 2DXN A; 3AGE A; 1FC9 A; 1V0F A; 4GHN A; 3ZXN A; 2CWW A; 3V97 A; 2VY9 A; 3T6O A; 3JU4 A; 2ZO9 B; 2B78 A; 4DGF A; 1T6R A; 2AS0 A; 3K50 A; 1HF2 A; 3GMF A; 1H4X A; 1THN B; 2RRL A; 1N6D A; 3LDF A; 4QTP A; 5EUU A; 3DJA A; 3F43 A; 3LLO A; 3DOR A; 4AEJ A; 3GVJ A; #chains in the Genus database with same CATH homology 5EUZ A; 4DGH A; 4DGF A; 4XS5 A; 2KLN A; 3OIZ A; 1T6R A; 5EUS A; 3NY7 A; 3MGL A; 1AUZ A; 3IHB A; 3AGD A; 1TH8 B; 4HYL A; 3IF5 A; 1H4X A; 2KA5 A; 3IH9 A; 3IHA A; 1THN B; 1TIL B; 1H4Z A; 4QTP A; 1H4Y A; 5EUU A; 1BUZ A; 5EUW A; 1SBO A; 3IH8 A; 3LKL A; 3F43 A; 1TID B; 3OIR A; 3LLO A; 1VC1 A; 3AGE A; 5EZB A; 3ZTB A; 3ZXN A; 2VY9 A; 3T6O A; 5EUX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...