3NY7A

Stas domain of ychm bound to acp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
118
structure length
118
Chain Sequence
GSHMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDLESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQPIPGRLAFFPNRRAAMADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Sulfate transporter
publication title Structure of a SLC26 Anion Transporter STAS Domain in Complex with Acyl Carrier Protein: Implications for E. coli YchM in Fatty Acid Metabolism.
pubmed doi rcsb
source organism Escherichia coli
total genus 36
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3ny7A00
3LKLA 3OIZA 3LLOA 3IF5A 1AUZA 5EUWA 1TIDB 4XS5A 3ZXNA 3IHAA 1H4ZA 4QTPA 3IHBA 1VC1A 3ZTBA 5EUXA 3AGEA 3OIRA 3F43A 1TH8B 3T6OA 4HYLA 1T6RA 1H4XA 3AGDA 4DGHA 1H4YA 2VY9A 1THNB 3IH8A 2KLNA 2KA5A 5EUSA 5EUUA 4DGFA 3MGLA 1SBOA 1TILB 3IH9A 3NY7A 5EZBA 1BUZA 5EUZA
chains in the Genus database with same CATH superfamily
3MOGA 3OIZA 2ZO9B 4XS5A 3DORA 3ZTBA 4HIZA 1N6EA 1WXXA 4GHNA 4DGHA 1H4YA 3IH8A 1THNB 3V8VA 4DGFA 3D03A 3QDQA 1FC9A 3IH9A 1V0FA 3VSEA 5EZBA 5EUZA 1BPLA 2B78A 3IF5A 1TIDB 3GVJA 1H4ZA 4QTPA 3C0KA 3IHBA 1VC1A 3AGEA 3T6OA 1T6RA 2VY9A 2RRLA 1N6FA 1SBOA 3LDFA 3EH7A 3GK7A 1FCFA 4AE2A 3LKLA 1AUZA 2ZOAA 3JU4A 5EUWA 1V0EA 3V97A 3D3UA 4JC0A 1FC7A 3GVKA 2DXNA 5EUXA 4AEJA 3F43A 4HYLA 1H4XA 1J7XA 4DMGA 2AS0A 2KLNA 3GMFA 2KA5A 5EUUA 3MGLA 3GVLA 1TILB 4L1CA 4L8KA 3GHFA 2CWWA 3DJAA 3LLOA 3ZXNA 3IHAA 1WXWA 3OIRA 1TH8B 1BUZA 3AGDA 1K32A 2OASA 3K50A 1HF2A 5EUSA 1FC6A 3DUPA 3NY7A 1N6DA 2DXLA
chains in the Genus database with same CATH topology
3LKLA 3OIZA 3LLOA 3IF5A 1AUZA 5EUWA 1TIDB 4XS5A 3ZXNA 3IHAA 1H4ZA 4QTPA 3IHBA 1VC1A 3ZTBA 5EUXA 3AGEA 3OIRA 3F43A 1TH8B 3T6OA 4HYLA 1T6RA 1H4XA 3AGDA 4DGHA 1H4YA 2VY9A 1THNB 3IH8A 2KLNA 2KA5A 5EUSA 5EUUA 4DGFA 3MGLA 1SBOA 1TILB 3IH9A 3NY7A 5EZBA 1BUZA 5EUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKL A;  3OIZ A;  3LLO A;  3IF5 A;  1AUZ A;  5EUW A;  1TID B;  4XS5 A;  3ZXN A;  3IHA A;  1H4Z A;  4QTP A;  3IHB A;  1VC1 A;  3ZTB A;  5EUX A;  3AGE A;  3OIR A;  3F43 A;  1TH8 B;  3T6O A;  4HYL A;  1T6R A;  1H4X A;  3AGD A;  4DGH A;  1H4Y A;  2VY9 A;  1THN B;  3IH8 A;  2KLN A;  2KA5 A;  5EUS A;  5EUU A;  4DGF A;  3MGL A;  1SBO A;  1TIL B;  3IH9 A;  3NY7 A;  5EZB A;  1BUZ A;  5EUZ A; 
#chains in the Genus database with same CATH topology
 3MOG A;  3OIZ A;  2ZO9 B;  4XS5 A;  3DOR A;  3ZTB A;  4HIZ A;  1N6E A;  1WXX A;  4GHN A;  4DGH A;  1H4Y A;  3IH8 A;  1THN B;  3V8V A;  4DGF A;  3D03 A;  3QDQ A;  1FC9 A;  3IH9 A;  1V0F A;  3VSE A;  5EZB A;  5EUZ A;  1BPL A;  2B78 A;  3IF5 A;  1TID B;  3GVJ A;  1H4Z A;  4QTP A;  3C0K A;  3IHB A;  1VC1 A;  3AGE A;  3T6O A;  1T6R A;  2VY9 A;  2RRL A;  1N6F A;  1SBO A;  3LDF A;  3EH7 A;  3GK7 A;  1FCF A;  4AE2 A;  3LKL A;  1AUZ A;  2ZOA A;  3JU4 A;  5EUW A;  1V0E A;  3V97 A;  3D3U A;  4JC0 A;  1FC7 A;  3GVK A;  2DXN A;  5EUX A;  4AEJ A;  3F43 A;  4HYL A;  1H4X A;  1J7X A;  4DMG A;  2AS0 A;  2KLN A;  3GMF A;  2KA5 A;  5EUU A;  3MGL A;  3GVL A;  1TIL B;  4L1C A;  4L8K A;  3GHF A;  2CWW A;  3DJA A;  3LLO A;  3ZXN A;  3IHA A;  1WXW A;  3OIR A;  1TH8 B;  1BUZ A;  3AGD A;  1K32 A;  2OAS A;  3K50 A;  1HF2 A;  5EUS A;  1FC6 A;  3DUP A;  3NY7 A;  1N6D A;  2DXL A; 
#chains in the Genus database with same CATH homology
 3LKL A;  3OIZ A;  3LLO A;  3IF5 A;  1AUZ A;  5EUW A;  1TID B;  4XS5 A;  3ZXN A;  3IHA A;  1H4Z A;  4QTP A;  3IHB A;  1VC1 A;  3ZTB A;  5EUX A;  3AGE A;  3OIR A;  3F43 A;  1TH8 B;  3T6O A;  4HYL A;  1T6R A;  1H4X A;  3AGD A;  4DGH A;  1H4Y A;  2VY9 A;  1THN B;  3IH8 A;  2KLN A;  2KA5 A;  5EUS A;  5EUU A;  4DGF A;  3MGL A;  1SBO A;  1TIL B;  3IH9 A;  3NY7 A;  5EZB A;  1BUZ A;  5EUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...