1BPLA

Glycosyltransferase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
179
Chain Sequence
LNGTLMQYFEWYMPNDGQHWKRLQNDSAYLAEHGITAVWIPPAYKGTSQADVGYGAYDLYDLGEFHQKGTVRTKYGTKGELQSAIKSLHSRDINVYGDVVINHKGGADATEDVTAVEVDPADRNRVISGEHLIKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKLNRIYKFQGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycosyltransferase
molecule keywords ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
publication title Crystal structure of calcium-depleted Bacillus licheniformis alpha-amylase at 2.2 A resolution.
pubmed doi rcsb
total genus 53
structure length 179
sequence length 179
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1bplA02
3.30.750.90 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1bplA01
2GJRA 2D3NA 1WPCA 2DIEA 1VJSA 1HVXA 3BH4A 3BCDA 1UD4A 2GJPA 1W9XA 1UD8A 1E3XA 1E3ZA 1UD5A 1OB0A 3BC9A 4UZUA 1UD6A 1WP6A 1E43A 2D3LA 1BPLA 1UD3A 3BCFA 1BLIA 1UD2A
chains in the Genus database with same CATH superfamily
5B6IA 2XZLA 1WPCA 5J35A 4YXWA 2ZO9B 3PA2A 5EUWA 3NE5B 1GJRA 1EFRA 1N6EA 3T56B 4X07A 4ACBA 3K50A 1BQEA 3V97A 1W9XA 1XFOA 3QFTA 1KK0A 3G6EB 4MYTA 1SBOA 2WZPP 1N05A 2D9RA 2VNIA 4DK1A 4GHNA 1D2EA 2ZTNA 3R6KA 2BMWA 1ZM2A 1QFYA 2CF4A 2V7TA 1VQNB 1VQ9B 4QUZA 2ZL5A 2KLNA 1UD6A 2X53S 3LO8A 4P2NA 4XM3A 1YX2A 3ASSA 3U6KA 2XNDA 2D74A 1EP1B 2QDXA 3PUNA 3Q38A 4OOVA 1NB0A 2X0KA 2WPDA 3B8HA 3ZUGA 5LMZA 2LZJA 1H4YA 2GQFA 1NJID 4HYLA 1YITB 4RPDA 4XL9A 3W2IA 1FNDA 3ONUA 3A35A 1CQXA 2VBTA 2BPOA 3U2QA 3VMFA 3W2EA 5HZAA 1VQ8B 3CCRB 3EH7A 2Q6KA 5FNZA 3MGLA 1UD8A 2GPJA 3ZBUA 1F60A 4QVJA 4Y9RA 4DQKA 1KQSB 3SJZA 4ZGNB 3AVWA 4YELA 3LKLA 2F1MA 3I55B 3W2FA 1VQKB 2BSAA 3CP2A 1YJWB 2DXLA 2C4TA 3OEEA 2X8KA 3D26A 4DQLA 4PABA 3U6BA 3JQQA 4P25A 4XD7A 3LQEA 1G7RA 4BPRA 5KSWB 2JDIA 1SKYB 2GREA 1SM4A 2ZITA 4GQNA 4P3YA 1U2RA 1CNEA 2CW5A 3CW2A 5F4MA 2VJIA 4LBWA 1K32A 3OJXA 2DERA 4ACAA 4XKVA 2ZZFA 1N6FA 1W0KA 3ZZUA 4X0CA 4QFMA 4M1KA 3CCEB 4UAJA 2EIXA 2ZZEA 1N06A 4RPBA 3ASTA 1BX0A 3A3GA 3OZVA 2QEXB 1W35A 4TMZA 3JQRA 2XNCA 4Z4TA 3PA1A 2C77A 4G1BA 3WNCA 1QFZA 3QFSA 5IYWA 3AVUA 1QGYA 5TR9A 2C4UA 1TH8B 1JJ2B 2ZBVA 2JJ1A 4PGOA 1RQRA 1W87A 1NB9A 3WXMA 4B3FX 2RRLA 1XQBA 1I8DA 1MABA 4H9GA 4R71A 1K8AD 4II2A 1EXMA 2XOKA 1G7CA 1H4XA 3PVDA 2WYRA 3GIRA 4PC7A 3SKBA 2BM0A 4PC6A 4Z4WA 1W2BB 2VNKA 2GK7A 2W6IA 4RLZA 3DJAA 3ZXNA 2FVGA 1WOOA 2NPFA 2D3LA 1PKVA 1ZM3A 2F1LA 2XEXA 1BPLA 1GO2A 3CB4A 3BCFA 3AVTA 3Q3AA 1AIPA 1EFTA 2NV4A 3A3BA 3GVKA 4QVAA 2D3NA 4XLEA 4AE2A 1VQMB 4P9SA 2QA4B 4XN0A 1DDGA 4Z4SA 2C5BA 2WJYA 1E64A 1JB9A 1YI2B 1FRQA 2J7KA 3QE2A 3BNWA 3LQ6A 4Z4ZA 1VQLB 3J81k 2X6YA 1H85A 3FPKA 4FWTA 4YAOA 2B7CA 5IYPA 2HCJB 5IYNA 4WWVA 2JN9A 4NNJA 1FC7A 4OPSA 4Z4VA 3CCUB 3WQZA 2E1BA 2CNDA 3OE7A 1H42A 2GJKA 1BLIA 1GAWA 1H8EA 1WSVA 1VQPB 1PJ5A 2Q6IA 4LBZA 2BV3A 1EWYA 1ELOA 4LBVA 4FK8A 1Q82D 3LNNA 3DDYA 3VNUA 4B3XA 2V7VA 1WORA 4P6YA 4RD3A 3SLNA 1I18A 4YALA 1VQ4B 3D3UA 2YWHA 4XOTA 4RJLA 4OOXA 3P26A 1K73D 4P6VF 1EFUA 2OASA 4XQFA 5IYRA 1KRHA 3FPPA 2ZL7A 1E1QA 5HKKA 4HE6A 4DK0A 3VR6A 1V0EA 5EUUA 1DARA 2E1RA 4X8IA 4XS5A 3PENA 1FNBA 1VQOB 1UMKA 1VF7A 3LVBA 3ZIAA 3IH8A 1T5EA 4P12A 1UD2A 2GJRA 4B44A 2ZTGA 4WZLA 1WOSA 2EFGA 4DGHA 2QTLA 1AMOA 1EP2B 4RD2A 1SKQA 3A8JA 4M0LA 4P1VA 2HDNB 2XZPA 4XLAA 3WBJA 1TLLA 5JBQA 2QTZA 2BN4A 3OZWA 1HZEA 4LC0A 3CMAB 4UZEA 3KEWA 3CTAA 2Q6OA 4X7DA 2R9VA 3WY9A 2GJPA 4PC3A 3I56B 1J7XA 1ZM4A 4Y7CA 5HZBA 2BGJA 4XNFA 1J9ZA 1FDRA 2QMUA 2C2WA 2Q6LA 2QE7A 5FO0A 3SJPA 1R5OA 4U9UA 3NY7A 4WQMA 2QGGA 4Q7JB 4TN1A 3OW7A 1JNYA 4EH1A 1S72B 4B43A 3AVVA 1ZM9A 3CRZA 1KD1D 4P3IA 1HF2A 1CNFA 3BH4A 1DG1G 4K1XA 1YJ9B 3LLOA 5EUZA 1M1KD 1WXWA 4B47A 1QGZA 4YAUA 1EFCA 3G4SB 1BX1A 2X6XA 3DUPA 2PIAA 1QG0A 3CXCB 4RD0A 3V76A 2ZZGA 1KK1A 4KKUA 4AVZA 2I1LA 3BY2A 1KK3A 2B7BA 5TV2A 3CC7B 1OB5A 3LDFA 2CBXA 4ZGQB 4CQJA 4FN5A 3GVLA 1QX4A 4ZCIA 2CK3A 2X3UA 3A8IA 4UZUA 2R6HA 4AC9A 2ZBUA 3CCQB 1BJKA 1W0JA 4X05A 5GV8A 3T53B 2C5HA 1IJFA 4ZCMA 4PC2A 4G5GA 4YAWA 4QHYA 2BVNA 2YWFA 4TMWA 2GK6A 4L1CA 4WZKA 5TRDA 4E0FA 1HVXA 2RC6A 4RDLA 1UD4A 3ES9A 1COWA 3CPWB 5J3OA 1ZUNB 3ISXA 3QSYA 1E1RA 4OPVA 1VHOA 1V5VA 1WDTA 3ASPA 4OOSA 1FC9A 4XN3A 5EMNA 2WJVA 3QFRA 4M4SA 5DN6A 1XB2A 3VSEA 1T6ZA 4RDKA 3CD6B 2PLFA 4NCNA 3R6JA 2HMAA 1NDHA 1OB2A 4TMTA 3P27A 3AGEA 1AUZA 2OBSA 3OPOA 4QV2A 1R5BA 3MMPA 4M53A 4OP7A 2VNHA 2KVOA 4XLCA 4XLHA 3IF5A 4PAAA 2DIEA 1Q7YD 4XORA 4II3A 3W5VA 1H4ZA 1YHQB 1OGJA 1Y0RA 3E20A 1N0VC 3OP1A 1Q86D 3IHAA 3QDQA 1EP3B 3OKXA 3ZZ0A 4JC0A 3G05A 4B4DA 3C0KA 5EUXA 4YEJA 3Q6QA 5BSXA 3I1FA 3GVJA 1D8TA 3AVYA 3OJWA 1VC1A 4AEJA 3OOCA 1QFJA 4XONA 1THNB 4WZEA 2OK7A 1QUEA 4RDJA 3FJOA 3H94A 3SLDA 3CMMA 2VY9A 1B2RA 1TTTA 1WU8A 2AS0A 2VYQA 2B78A 1QH0A 3W2GA 3AGQA 3KL9A 4Y9UA 3Q6RA 2F4NA 2V7QA 4J0QA 1JA1A 4N3GA 3ZTBA 3VO1A 2OBRA 2VBSA 5IK2A 4HE5A 3WNBA 1BMFA 1TIDB 3QFCA 2CWWA 3OFNA 4M2LA 2XZOA 1FX0A 2QN6A 4RCZA 1GVHA 5H5JA 3T51B 1TUIA 2DY1A 4DNRB 1FNMA 4YHBA 1K9MD 5GV7A 1OHHA 2DETA 3CCMB 3IH9A 5L46A 5EZBA 2V4DA 3V7AA 5DSZA 2OYNA 3AGPA 1OB0A 4RD1A 4RCYA 3CC2B 1IHMA 1KMHA 2ZZQA 5FIUA 4Z4YA 3PUMA 1UD3A 2KA5A 3B78A 3BQJA 4G7XA 1VHEA 4TKOB 5F4OA 4KKTA 1RQPA 1WOPA 4LBYA 2OTLB 2V7WA 1Q81D 1N6DA 3HAGA 3OZUA 4N3NA 5AN9A 2BGIA 2DCUA 4RM0A 1FRNA 1N08A 2C78A 2X85A 4G6IA 1E79A 4P22A 4Z4RA 4XMYA 1QVGB 1G7SA 2ZL6A 3MOGA 1T6RA 2YWEA 1H8HA 4IW3B 1VQ5B 1E3ZA 2XGJA 1WXXA 2VBUA 1A8PA 2ZOAA 1E63A 2DOGA 1PJ7A 3CCJB 5THXA 3GHFA 4JMQA 3WYAA 2WR8A 1KK2A 5A8AA 3CCVB 4TT3A 2BF4A 3ZPNA 5F4JA 1YJNB 3ASRA 4X06A 2DYIA 3G71B 1B23P 3W5HA 5KW9A 1I7PA 4RD6A 1QVFB 5H59A 3E1YE 2Z6BD 4G1VA 1IB0A 1S4MA 2OTJB 5IYQA 2YWGA 5HXBA 3CMEB 1WSRA 2VJJA 3CCLB 1P4MA 1WTHD 1QGAA 1KZLA 2V7UA 4XR6A 3OIZA 1N07A 4L8JA 4ROXA 2VNJA 3MCAA 3OEHA 3A1PA 1TILB 1G7TA 3GQBA 3AVXA 1WP6A 3ONYA 2X6WA 5TY0A 1Y0YA 3W5UA 1FC6A 3F43A 2VBVA 2F43A 3CP8A 3GSIA 4WZTA 5DS0A 3IHBA 1JA0A 4L8KA 2V31A 3OAAA 4Z1MA 1VJSA 2BM1A 5BSYA 4XOPA 1KJZA 4RD4A 2DEUA 1BUZA 3OW2B 3H9NA 3WBKA 4TMXA 1M90D 3FKSA 1S0UA 3ZBTA 1GAQA 3SEJA 4ZCLA 4DGFA 1W34A 2AHOA 1PJ6A 4ASUA 1XE1A 2VZLA 2JJ2A 4B48A 1N8RD 2V7XA 3JU4A 2ZXIA 2PE3A 1VLOA 4TSFA 1OGIA 2W6JA 3BC9A 4MYUA 4FXUA 2M5SA 3A8KA 4UZFA 1V0FA 2FX3A 2WZNA 3B82A 1DDIA 3MHPA 4OPOA 5A88A 3RY8A 3D03A 1VQ6B 4DNTB 4NBSA 4C43A 2CRVA 3CESA 4X7EA 4XKWA 3OIRA 1GR1A 4XLFA 1HA3A 3ASQA 3DORA 4G7WA 2RC5A 3Q39A 2WSSA 1E3XA 4Z4UA 3W2HA 3V8VA 2JIZA 3CC4B 3JQPA 4PC1A 1TVCA 1VLYA 5CDFA 3WNDA 3ZC3A 1FCFA 1QUFA 4HIZA 4AF7A 1YIJB 4DMGA 2PMDA 3GK7A 3T6OA 2HLDA 4X7FA 1Q9SA 1R5NA 3BY1A 4TMVA 4P26A 4B3GA 1E62A 4C0SA 1VQ7B 3GMFA 5A89A 4AF6A 3VO2A 5E6TA 1T6YA 3BCDA 3ZZTA 1KC8D 5FL7A 1T6XA 3CPXA 4YAFA 2CC2A 1IJEA 2XNJA 2OK8A 4ZV4A 1FNCA 4X7CA 3VNVA 5EUSA 1F20A 2OBTA 1KTVA 2ZXHA 3AGDA 1YLOA 1N0UA 1MRZA 2P3MA 1NBMA 4F7DA 1UD5A 2DXNA 3CCSB 1E43A 1NRKA 4KKSA 5FO1A 4QTPA 5FA6A 1D1NA 5KNLA 1K28D 2B5OA
chains in the Genus database with same CATH topology
2D3NA 2XZLA 1WPCA 2GK6A 4YXWA 2ZO9B 4L1CA 4XN0A 4E0FA 2WJYA 1HVXA 3NE5B 2Z6BD 1EFRA 1N6EA 1UD4A 1COWA 3T56B 3K50A 1E1RA 2VJJA 2X6YA 1W9XA 4L8KA 1WTHD 1KZLA 1FC9A 4GHNA 4XN3A 2WZPP 2WJVA 2ZTNA 4XR6A 5DN6A 4L8JA 3OEHA 4NNJA 1FC7A 3GQBA 3WQZA 1UD6A 2E1BA 1WP6A 2X53S 3OE7A 2X6WA 4XM3A 2GJKA 3OPOA 1FC6A 1BLIA 1H8EA 2F43A 3CP8A 2XNDA 2KVOA 4XLCA 4XLHA 2DIEA 2WPDA 3DDYA 3LNNA 2V31A 3OAAA 4II3A 1VJSA 4XORA 4Z1MA 4XOPA 2LZJA 1I18A 4XL9A 4XOTA 3A35A 4JC0A 3FKSA 3G05A 4XQFA 4YEJA 3FPPA 1UD8A 3GVJA 1E1QA 4ASUA 5HKKA 2JJ2A 4AEJA 4DK0A 3JU4A 3OOCA 4YELA 4XONA 1V0EA 2ZXIA 3VR6A 4TSFA 2F1MA 3BC9A 3CP2A 4FXUA 1VF7A 2DXLA 3ZIAA 3H94A 3OEEA 1T5EA 3CMMA 2M5SA 2X8KA 1UD2A 1V0FA 2GJRA 2ZTGA 4XD7A 2V7QA 3D03A 4XLAA 2JDIA 4DK1A 1SKYB 4GQNA 5IK2A 2XZPA 1BMFA 4DNTB 1HZEA 3OFNA 2VJIA 2XZOA 1FX0A 1K32A 3T51B 3KEWA 3CESA 4DNRB 4XKVA 2ZZFA 2R9VA 4XKWA 2GJPA 4AE2A 1J7XA 1N6FA 4XLFA 3DORA 1OHHA 1W0KA 4G7WA 2WSSA 1E3XA 4XNFA 2JIZA 2ZZEA 2V4DA 1VLYA 5CDFA 1OB0A 1FCFA 2QE7A 4HIZA 1KMHA 3A3GA 2ZZQA 2HLDA 1UD3A 3GVKA 4G7XA 3OW7A 4TKOB 4KKTA 4B3GA 3GMFA 1N6DA 2JJ1A 3BCDA 3BH4A 3HAGA 4B3FX 2RRLA 5FL7A 1I8DA 1MABA 3DUPA 2X6XA 2X85A 4G6IA 1E79A 4P22A 4II2A 4XMYA 2XOKA 3ZPNA 3MOGA 2ZZGA 4KKUA 4AVZA 1H8HA 2ZXHA 1E3ZA 2XGJA 3GVLA 1NBMA 2ZOAA 1UD5A 2CK3A 2GK7A 2W6IA 4UZUA 2DXNA 3DJAA 3GHFA 4JMQA 1E43A 1NRKA 1PKVA 2D3LA 1W0JA 4KKSA 1BPLA 4TT3A 5KNLA 3T53B 3BCFA 1K28D 2W6JA 3A3BA 4XLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJR A;  2D3N A;  1WPC A;  2DIE A;  1VJS A;  1HVX A;  3BH4 A;  3BCD A;  1UD4 A;  2GJP A;  1W9X A;  1UD8 A;  1E3X A;  1E3Z A;  1UD5 A;  1OB0 A;  3BC9 A;  4UZU A;  1UD6 A;  1WP6 A;  1E43 A;  2D3L A;  1BPL A;  1UD3 A;  3BCF A;  1BLI A;  1UD2 A; 
#chains in the Genus database with same CATH topology
 5B6I A;  2XZL A;  1WPC A;  5J35 A;  4YXW A;  2ZO9 B;  3PA2 A;  5EUW A;  3NE5 B;  1GJR A;  1EFR A;  1N6E A;  3T56 B;  4X07 A;  4ACB A;  3K50 A;  1BQE A;  3V97 A;  1W9X A;  1XFO A;  3QFT A;  1KK0 A;  3G6E B;  4MYT A;  1SBO A;  2WZP P;  1N05 A;  2D9R A;  2VNI A;  4DK1 A;  4GHN A;  1D2E A;  2ZTN A;  3R6K A;  2BMW A;  1ZM2 A;  1QFY A;  2CF4 A;  2V7T A;  1VQN B;  1VQ9 B;  4QUZ A;  2ZL5 A;  2KLN A;  1UD6 A;  2X53 S;  3LO8 A;  4P2N A;  4XM3 A;  1YX2 A;  3ASS A;  3U6K A;  2XND A;  2D74 A;  1EP1 B;  2QDX A;  3PUN A;  3Q38 A;  4OOV A;  1NB0 A;  2X0K A;  2WPD A;  3B8H A;  3ZUG A;  5LMZ A;  2LZJ A;  1H4Y A;  2GQF A;  1NJI D;  4HYL A;  1YIT B;  4RPD A;  4XL9 A;  3W2I A;  1FND A;  3ONU A;  3A35 A;  1CQX A;  2VBT A;  2BPO A;  3U2Q A;  3VMF A;  3W2E A;  5HZA A;  1VQ8 B;  3CCR B;  3EH7 A;  2Q6K A;  5FNZ A;  3MGL A;  1UD8 A;  2GPJ A;  3ZBU A;  1F60 A;  4QVJ A;  4Y9R A;  4DQK A;  1KQS B;  3SJZ A;  4ZGN B;  3AVW A;  4YEL A;  3LKL A;  2F1M A;  3I55 B;  3W2F A;  1VQK B;  2BSA A;  3CP2 A;  1YJW B;  2DXL A;  2C4T A;  3OEE A;  2X8K A;  3D26 A;  4DQL A;  4PAB A;  3U6B A;  3JQQ A;  4P25 A;  4XD7 A;  3LQE A;  1G7R A;  4BPR A;  5KSW B;  2JDI A;  1SKY B;  2GRE A;  1SM4 A;  2ZIT A;  4GQN A;  4P3Y A;  1U2R A;  1CNE A;  2CW5 A;  3CW2 A;  5F4M A;  2VJI A;  4LBW A;  1K32 A;  3OJX A;  2DER A;  4ACA A;  4XKV A;  2ZZF A;  1N6F A;  1W0K A;  3ZZU A;  4X0C A;  4QFM A;  4M1K A;  3CCE B;  4UAJ A;  2EIX A;  2ZZE A;  1N06 A;  4RPB A;  3AST A;  1BX0 A;  3A3G A;  3OZV A;  2QEX B;  1W35 A;  4TMZ A;  3JQR A;  2XNC A;  4Z4T A;  3PA1 A;  2C77 A;  4G1B A;  3WNC A;  1QFZ A;  3QFS A;  5IYW A;  3AVU A;  1QGY A;  5TR9 A;  2C4U A;  1TH8 B;  1JJ2 B;  2ZBV A;  2JJ1 A;  4PGO A;  1RQR A;  1W87 A;  1NB9 A;  3WXM A;  4B3F X;  2RRL A;  1XQB A;  1I8D A;  1MAB A;  4H9G A;  4R71 A;  1K8A D;  4II2 A;  1EXM A;  2XOK A;  1G7C A;  1H4X A;  3PVD A;  2WYR A;  3GIR A;  4PC7 A;  3SKB A;  2BM0 A;  4PC6 A;  4Z4W A;  1W2B B;  2VNK A;  2GK7 A;  2W6I A;  4RLZ A;  3DJA A;  3ZXN A;  2FVG A;  1WOO A;  2NPF A;  2D3L A;  1PKV A;  1ZM3 A;  2F1L A;  2XEX A;  1BPL A;  1GO2 A;  3CB4 A;  3BCF A;  3AVT A;  3Q3A A;  1AIP A;  1EFT A;  2NV4 A;  3A3B A;  3GVK A;  4QVA A;  2D3N A;  4XLE A;  4AE2 A;  1VQM B;  4P9S A;  2QA4 B;  4XN0 A;  1DDG A;  4Z4S A;  2C5B A;  2WJY A;  1E64 A;  1JB9 A;  1YI2 B;  1FRQ A;  2J7K A;  3QE2 A;  3BNW A;  3LQ6 A;  4Z4Z A;  1VQL B;  3J81 k;  2X6Y A;  1H85 A;  3FPK A;  4FWT A;  4YAO A;  2B7C A;  5IYP A;  2HCJ B;  5IYN A;  4WWV A;  2JN9 A;  4NNJ A;  1FC7 A;  4OPS A;  4Z4V A;  3CCU B;  3WQZ A;  2E1B A;  2CND A;  3OE7 A;  1H42 A;  2GJK A;  1BLI A;  1GAW A;  1H8E A;  1WSV A;  1VQP B;  1PJ5 A;  2Q6I A;  4LBZ A;  2BV3 A;  1EWY A;  1ELO A;  4LBV A;  4FK8 A;  1Q82 D;  3LNN A;  3DDY A;  3VNU A;  4B3X A;  2V7V A;  1WOR A;  4P6Y A;  4RD3 A;  3SLN A;  1I18 A;  4YAL A;  1VQ4 B;  3D3U A;  2YWH A;  4XOT A;  4RJL A;  4OOX A;  3P26 A;  1K73 D;  4P6V F;  1EFU A;  2OAS A;  4XQF A;  5IYR A;  1KRH A;  3FPP A;  2ZL7 A;  1E1Q A;  5HKK A;  4HE6 A;  4DK0 A;  3VR6 A;  1V0E A;  5EUU A;  1DAR A;  2E1R A;  4X8I A;  4XS5 A;  3PEN A;  1FNB A;  1VQO B;  1UMK A;  1VF7 A;  3LVB A;  3ZIA A;  3IH8 A;  1T5E A;  4P12 A;  1UD2 A;  2GJR A;  4B44 A;  2ZTG A;  4WZL A;  1WOS A;  2EFG A;  4DGH A;  2QTL A;  1AMO A;  1EP2 B;  4RD2 A;  1SKQ A;  3A8J A;  4M0L A;  4P1V A;  2HDN B;  2XZP A;  4XLA A;  3WBJ A;  1TLL A;  5JBQ A;  2QTZ A;  2BN4 A;  3OZW A;  1HZE A;  4LC0 A;  3CMA B;  4UZE A;  3KEW A;  3CTA A;  2Q6O A;  4X7D A;  2R9V A;  3WY9 A;  2GJP A;  4PC3 A;  3I56 B;  1J7X A;  1ZM4 A;  4Y7C A;  5HZB A;  2BGJ A;  4XNF A;  1J9Z A;  1FDR A;  2QMU A;  2C2W A;  2Q6L A;  2QE7 A;  5FO0 A;  3SJP A;  1R5O A;  4U9U A;  3NY7 A;  4WQM A;  2QGG A;  4Q7J B;  4TN1 A;  3OW7 A;  1JNY A;  4EH1 A;  1S72 B;  4B43 A;  3AVV A;  1ZM9 A;  3CRZ A;  1KD1 D;  4P3I A;  1HF2 A;  1CNF A;  3BH4 A;  1DG1 G;  4K1X A;  1YJ9 B;  3LLO A;  5EUZ A;  1M1K D;  1WXW A;  4B47 A;  1QGZ A;  4YAU A;  1EFC A;  3G4S B;  1BX1 A;  2X6X A;  3DUP A;  2PIA A;  1QG0 A;  3CXC B;  4RD0 A;  3V76 A;  2ZZG A;  1KK1 A;  4KKU A;  4AVZ A;  2I1L A;  3BY2 A;  1KK3 A;  2B7B A;  5TV2 A;  3CC7 B;  1OB5 A;  3LDF A;  2CBX A;  4ZGQ B;  4CQJ A;  4FN5 A;  3GVL A;  1QX4 A;  4ZCI A;  2CK3 A;  2X3U A;  3A8I A;  4UZU A;  2R6H A;  4AC9 A;  2ZBU A;  3CCQ B;  1BJK A;  1W0J A;  4X05 A;  5GV8 A;  3T53 B;  2C5H A;  1IJF A;  4ZCM A;  4PC2 A;  4G5G A;  4YAW A;  4QHY A;  2BVN A;  2YWF A;  4TMW A;  2GK6 A;  4L1C A;  4WZK A;  5TRD A;  4E0F A;  1HVX A;  2RC6 A;  4RDL A;  1UD4 A;  3ES9 A;  1COW A;  3CPW B;  5J3O A;  1ZUN B;  3ISX A;  3QSY A;  1E1R A;  4OPV A;  1VHO A;  1V5V A;  1WDT A;  3ASP A;  4OOS A;  1FC9 A;  4XN3 A;  5EMN A;  2WJV A;  3QFR A;  4M4S A;  5DN6 A;  1XB2 A;  3VSE A;  1T6Z A;  4RDK A;  3CD6 B;  2PLF A;  4NCN A;  3R6J A;  2HMA A;  1NDH A;  1OB2 A;  4TMT A;  3P27 A;  3AGE A;  1AUZ A;  2OBS A;  3OPO A;  4QV2 A;  1R5B A;  3MMP A;  4M53 A;  4OP7 A;  2VNH A;  2KVO A;  4XLC A;  4XLH A;  3IF5 A;  4PAA A;  2DIE A;  1Q7Y D;  4XOR A;  4II3 A;  3W5V A;  1H4Z A;  1YHQ B;  1OGJ A;  1Y0R A;  3E20 A;  1N0V C;  3OP1 A;  1Q86 D;  3IHA A;  3QDQ A;  1EP3 B;  3OKX A;  3ZZ0 A;  4JC0 A;  3G05 A;  4B4D A;  3C0K A;  5EUX A;  4YEJ A;  3Q6Q A;  5BSX A;  3I1F A;  3GVJ A;  1D8T A;  3AVY A;  3OJW A;  1VC1 A;  4AEJ A;  3OOC A;  1QFJ A;  4XON A;  1THN B;  4WZE A;  2OK7 A;  1QUE A;  4RDJ A;  3FJO A;  3H94 A;  3SLD A;  3CMM A;  2VY9 A;  1B2R A;  1TTT A;  1WU8 A;  2AS0 A;  2VYQ A;  2B78 A;  1QH0 A;  3W2G A;  3AGQ A;  3KL9 A;  4Y9U A;  3Q6R A;  2F4N A;  2V7Q A;  4J0Q A;  1JA1 A;  4N3G A;  3ZTB A;  3VO1 A;  2OBR A;  2VBS A;  5IK2 A;  4HE5 A;  3WNB A;  1BMF A;  1TID B;  3QFC A;  2CWW A;  3OFN A;  4M2L A;  2XZO A;  1FX0 A;  2QN6 A;  4RCZ A;  1GVH A;  5H5J A;  3T51 B;  1TUI A;  2DY1 A;  4DNR B;  1FNM A;  4YHB A;  1K9M D;  5GV7 A;  1OHH A;  2DET A;  3CCM B;  3IH9 A;  5L46 A;  5EZB A;  2V4D A;  3V7A A;  5DSZ A;  2OYN A;  3AGP A;  1OB0 A;  4RD1 A;  4RCY A;  3CC2 B;  1IHM A;  1KMH A;  2ZZQ A;  5FIU A;  4Z4Y A;  3PUM A;  1UD3 A;  2KA5 A;  3B78 A;  3BQJ A;  4G7X A;  1VHE A;  4TKO B;  5F4O A;  4KKT A;  1RQP A;  1WOP A;  4LBY A;  2OTL B;  2V7W A;  1Q81 D;  1N6D A;  3HAG A;  3OZU A;  4N3N A;  5AN9 A;  2BGI A;  2DCU A;  4RM0 A;  1FRN A;  1N08 A;  2C78 A;  2X85 A;  4G6I A;  1E79 A;  4P22 A;  4Z4R A;  4XMY A;  1QVG B;  1G7S A;  2ZL6 A;  3MOG A;  1T6R A;  2YWE A;  1H8H A;  4IW3 B;  1VQ5 B;  1E3Z A;  2XGJ A;  1WXX A;  2VBU A;  1A8P A;  2ZOA A;  1E63 A;  2DOG A;  1PJ7 A;  3CCJ B;  5THX A;  3GHF A;  4JMQ A;  3WYA A;  2WR8 A;  1KK2 A;  5A8A A;  3CCV B;  4TT3 A;  2BF4 A;  3ZPN A;  5F4J A;  1YJN B;  3ASR A;  4X06 A;  2DYI A;  3G71 B;  1B23 P;  3W5H A;  5KW9 A;  1I7P A;  4RD6 A;  1QVF B;  5H59 A;  3E1Y E;  2Z6B D;  4G1V A;  1IB0 A;  1S4M A;  2OTJ B;  5IYQ A;  2YWG A;  5HXB A;  3CME B;  1WSR A;  2VJJ A;  3CCL B;  1P4M A;  1WTH D;  1QGA A;  1KZL A;  2V7U A;  4XR6 A;  3OIZ A;  1N07 A;  4L8J A;  4ROX A;  2VNJ A;  3MCA A;  3OEH A;  3A1P A;  1TIL B;  1G7T A;  3GQB A;  3AVX A;  1WP6 A;  3ONY A;  2X6W A;  5TY0 A;  1Y0Y A;  3W5U A;  1FC6 A;  3F43 A;  2VBV A;  2F43 A;  3CP8 A;  3GSI A;  4WZT A;  5DS0 A;  3IHB A;  1JA0 A;  4L8K A;  2V31 A;  3OAA A;  4Z1M A;  1VJS A;  2BM1 A;  5BSY A;  4XOP A;  1KJZ A;  4RD4 A;  2DEU A;  1BUZ A;  3OW2 B;  3H9N A;  3WBK A;  4TMX A;  1M90 D;  3FKS A;  1S0U A;  3ZBT A;  1GAQ A;  3SEJ A;  4ZCL A;  4DGF A;  1W34 A;  2AHO A;  1PJ6 A;  4ASU A;  1XE1 A;  2VZL A;  2JJ2 A;  4B48 A;  1N8R D;  2V7X A;  3JU4 A;  2ZXI A;  2PE3 A;  1VLO A;  4TSF A;  1OGI A;  2W6J A;  3BC9 A;  4MYU A;  4FXU A;  2M5S A;  3A8K A;  4UZF A;  1V0F A;  2FX3 A;  2WZN A;  3B82 A;  1DDI A;  3MHP A;  4OPO A;  5A88 A;  3RY8 A;  3D03 A;  1VQ6 B;  4DNT B;  4NBS A;  4C43 A;  2CRV A;  3CES A;  4X7E A;  4XKW A;  3OIR A;  1GR1 A;  4XLF A;  1HA3 A;  3ASQ A;  3DOR A;  4G7W A;  2RC5 A;  3Q39 A;  2WSS A;  1E3X A;  4Z4U A;  3W2H A;  3V8V A;  2JIZ A;  3CC4 B;  3JQP A;  4PC1 A;  1TVC A;  1VLY A;  5CDF A;  3WND A;  3ZC3 A;  1FCF A;  1QUF A;  4HIZ A;  4AF7 A;  1YIJ B;  4DMG A;  2PMD A;  3GK7 A;  3T6O A;  2HLD A;  4X7F A;  1Q9S A;  1R5N A;  3BY1 A;  4TMV A;  4P26 A;  4B3G A;  1E62 A;  4C0S A;  1VQ7 B;  3GMF A;  5A89 A;  4AF6 A;  3VO2 A;  5E6T A;  1T6Y A;  3BCD A;  3ZZT A;  1KC8 D;  5FL7 A;  1T6X A;  3CPX A;  4YAF A;  2CC2 A;  1IJE A;  2XNJ A;  2OK8 A;  4ZV4 A;  1FNC A;  4X7C A;  3VNV A;  5EUS A;  1F20 A;  2OBT A;  1KTV A;  2ZXH A;  3AGD A;  1YLO A;  1N0U A;  1MRZ A;  2P3M A;  1NBM A;  4F7D A;  1UD5 A;  2DXN A;  3CCS B;  1E43 A;  1NRK A;  4KKS A;  5FO1 A;  4QTP A;  5FA6 A;  1D1N A;  5KNL A;  1K28 D;  2B5O A; 
#chains in the Genus database with same CATH homology
 2D3N A;  2XZL A;  1WPC A;  2GK6 A;  4YXW A;  2ZO9 B;  4L1C A;  4XN0 A;  4E0F A;  2WJY A;  1HVX A;  3NE5 B;  2Z6B D;  1EFR A;  1N6E A;  1UD4 A;  1COW A;  3T56 B;  3K50 A;  1E1R A;  2VJJ A;  2X6Y A;  1W9X A;  4L8K A;  1WTH D;  1KZL A;  1FC9 A;  4GHN A;  4XN3 A;  2WZP P;  2WJV A;  2ZTN A;  4XR6 A;  5DN6 A;  4L8J A;  3OEH A;  4NNJ A;  1FC7 A;  3GQB A;  3WQZ A;  1UD6 A;  2E1B A;  1WP6 A;  2X53 S;  3OE7 A;  2X6W A;  4XM3 A;  2GJK A;  3OPO A;  1FC6 A;  1BLI A;  1H8E A;  2F43 A;  3CP8 A;  2XND A;  2KVO A;  4XLC A;  4XLH A;  2DIE A;  2WPD A;  3DDY A;  3LNN A;  2V31 A;  3OAA A;  4II3 A;  1VJS A;  4XOR A;  4Z1M A;  4XOP A;  2LZJ A;  1I18 A;  4XL9 A;  4XOT A;  3A35 A;  4JC0 A;  3FKS A;  3G05 A;  4XQF A;  4YEJ A;  3FPP A;  1UD8 A;  3GVJ A;  1E1Q A;  4ASU A;  5HKK A;  2JJ2 A;  4AEJ A;  4DK0 A;  3JU4 A;  3OOC A;  4YEL A;  4XON A;  1V0E A;  2ZXI A;  3VR6 A;  4TSF A;  2F1M A;  3BC9 A;  3CP2 A;  4FXU A;  1VF7 A;  2DXL A;  3ZIA A;  3H94 A;  3OEE A;  1T5E A;  3CMM A;  2M5S A;  2X8K A;  1UD2 A;  1V0F A;  2GJR A;  2ZTG A;  4XD7 A;  2V7Q A;  3D03 A;  4XLA A;  2JDI A;  4DK1 A;  1SKY B;  4GQN A;  5IK2 A;  2XZP A;  1BMF A;  4DNT B;  1HZE A;  3OFN A;  2VJI A;  2XZO A;  1FX0 A;  1K32 A;  3T51 B;  3KEW A;  3CES A;  4DNR B;  4XKV A;  2ZZF A;  2R9V A;  4XKW A;  2GJP A;  4AE2 A;  1J7X A;  1N6F A;  4XLF A;  3DOR A;  1OHH A;  1W0K A;  4G7W A;  2WSS A;  1E3X A;  4XNF A;  2JIZ A;  2ZZE A;  2V4D A;  1VLY A;  5CDF A;  1OB0 A;  1FCF A;  2QE7 A;  4HIZ A;  1KMH A;  3A3G A;  2ZZQ A;  2HLD A;  1UD3 A;  3GVK A;  4G7X A;  3OW7 A;  4TKO B;  4KKT A;  4B3G A;  3GMF A;  1N6D A;  2JJ1 A;  3BCD A;  3BH4 A;  3HAG A;  4B3F X;  2RRL A;  5FL7 A;  1I8D A;  1MAB A;  3DUP A;  2X6X A;  2X85 A;  4G6I A;  1E79 A;  4P22 A;  4II2 A;  4XMY A;  2XOK A;  3ZPN A;  3MOG A;  2ZZG A;  4KKU A;  4AVZ A;  1H8H A;  2ZXH A;  1E3Z A;  2XGJ A;  3GVL A;  1NBM A;  2ZOA A;  1UD5 A;  2CK3 A;  2GK7 A;  2W6I A;  4UZU A;  2DXN A;  3DJA A;  3GHF A;  4JMQ A;  1E43 A;  1NRK A;  1PKV A;  2D3L A;  1W0J A;  4KKS A;  1BPL A;  4TT3 A;  5KNL A;  3T53 B;  3BCF A;  1K28 D;  2W6J A;  3A3B A;  4XLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...