1BPLA

Glycosyltransferase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
179
Chain Sequence
LNGTLMQYFEWYMPNDGQHWKRLQNDSAYLAEHGITAVWIPPAYKGTSQADVGYGAYDLYDLGEFHQKGTVRTKYGTKGELQSAIKSLHSRDINVYGDVVINHKGGADATEDVTAVEVDPADRNRVISGEHLIKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKLNRIYKFQGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
publication title Crystal structure of calcium-depleted Bacillus licheniformis alpha-amylase at 2.2 A resolution.
pubmed doi rcsb
molecule tags Glycosyltransferase
total genus 53
structure length 179
sequence length 179
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1bplA02
3.30.750.90 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1bplA01
1UD5A 1OB0A 1UD2A 2D3LA 1HVXA 1VJSA 2GJRA 1E3ZA 1W9XA 1BPLA 1E43A 1WP6A 3BCFA 2D3NA 1UD3A 4UZUA 1WPCA 1UD4A 2GJPA 3BH4A 2DIEA 3BCDA 1BLIA 1UD6A 1E3XA 3BC9A 1UD8A
chains in the Genus database with same CATH superfamily
1GO2A 1ZM9A 1OB0A 2C5HA 2QTZA 3OIZA 5IYQA 3CCEB 4AE2A 4Y7CA 4LBVA 4G7WA 2P3MA 2D9RA 3V76A 1BJKA 4OPVA 5A88A 2FX3A 1VLOA 2ZBVA 3Q39A 3WNBA 3QFCA 3T56B 3CCLB 1FRQA 1N05A 4TKOB 1VHEA 4XM3A 1YIJB 1WXWA 2Q6IA 2RRLA 5B6IA 3J81k 5FO0A 1KTVA 2C5BA 2WSSA 3NY7A 4CQJA 4L8KA 4ROXA 1Q82D 5FIUA 3SJPA 3RY8A 4DQLA 2GJPA 3G05A 1NB0A 2VNHA 4B47A 4F7DA 4G1VA 1EFCA 3ASPA 3LLOA 4B43A 4TMXA 3CPWB 2CK3A 3ZIAA 3SLDA 2ZOAA 2NV4A 1UD2A 4G7XA 3GVJA 1ZM2A 5HZAA 3OZWA 2Q6LA 1N8RD 1AUZA 1K8AD 2DEUA 3WBJA 1HF2A 2HCJB 3SJZA 1PKVA 1N06A 2ZXIA 3E1YE 3GVKA 4G1BA 3A3GA 4OOSA 4B3GA 1W9XA 2OASA 4M4SA 2B7CA 1V0EA 4FK8A 1QFJA 2VBUA 3GMFA 2AHOA 2V7QA 4ACAA 2VNJA 3ZC3A 3MGLA 3HAGA 4UZUA 3WQZA 3CCVB 1H42A 1KK3A 3GHFA 3VO1A 1YITB 1IJEA 1J9ZA 1UMKA 2VJIA 3CP2A 1EP3B 4X8IA 4GHNA 4IW3B 3AGEA 4P26A 2M5SA 3PVDA 4DNRB 1E79A 2WJYA 2D3LA 4AC9A 1VQNB 3VSEA 5IYNA 2C4UA 3SLNA 2ZL5A 2RC6A 1FNCA 1R5NA 3FPKA 2F43A 4ZCLA 3VR6A 5EUWA 4XKWA 5HKKA 3PUNA 3AVYA 4QV2A 4RDJA 4YXWA 4B3FX 2HMAA 2DYIA 2V7XA 1FNBA 2YWHA 1W0JA 2Z6BD 2ZTGA 1GAQA 4JC0A 1OHHA 2PE3A 3DDYA 1QVFB 2OK8A 3W2FA 5J3OA 3CCJB 4P9SA 2F4NA 3BCDA 4P22A 2JJ1A 3OZUA 5A8AA 1ZM3A 4OOXA 2JN9A 3OW7A 1HVXA 1VJSA 3PUMA 3W5UA 3OJXA 1WXXA 4XS5A 2PIAA 3CCQB 4TSFA 1KQSB 4P25A 1H4XA 3CC7B 4PABA 2ZL6A 1YLOA 3LKLA 1COWA 4HE5A 2GREA 3W2EA 3GVLA 4M53A 4N3GA 4X07A 4R71A 1GJRA 2WJVA 2OTJB 2E1RA 2F1MA 1ZUNB 3JQQA 4BPRA 1W34A 4TMVA 4FWTA 2BGJA 1K9MD 3AVUA 2ZO9B 1KK2A 4N3NA 4WZEA 3BH4A 5F4MA 1UD6A 2WZPP 1JA1A 1G7CA 3BY1A 2V31A 2J7KA 1WDTA 1WU8A 1T6ZA 3A8KA 3FKSA 2GK7A 2ZITA 3NE5B 4P6VF 4P3YA 5FO1A 3W2GA 3KEWA 4OPSA 4C0SA 3ZPNA 4U9UA 1EFRA 2XNDA 1BPLA 2NPFA 5CDFA 1DARA 4MYUA 2BGIA 1WP6A 1VQKB 2ZZGA 5THXA 4XQFA 4ZV4A 1JB9A 1FC6A 2OK7A 4HE6A 4PC2A 1CNEA 2XZPA 1JJ2B 3PENA 1D1NA 4XN0A 2Q6KA 4Z4UA 2KLNA 3CC2B 2C4TA 2I1LA 3Q6QA 2ZZEA 1YI2B 1HZEA 1THNB 1BLIA 3P26A 3U6KA 2JJ2A 1YJNB 4NBSA 1M1KD 3AVWA 3BNWA 5TY0A 3OZVA 1VQ5B 1EP2B 1MRZA 1TUIA 4RDKA 1WOPA 2X85A 4C43A 4L8JA 1K28D 3BQJA 4RD2A 4YELA 3H9NA 4XLHA 3VO2A 3CCUB 4XLAA 1QGYA 1Y0YA 3U6BA 4AF6A 4II2A 3T53B 4XD7A 1VHOA 1A8PA 1D2EA 1H8HA 1K32A 2V7VA 2VYQA 1EP1B 1BX1A 2C78A 2ZBUA 3QFRA 3FPPA 1OGIA 4PAAA 3EH7A 2CW5A 1J7XA 1QGZA 3OJWA 4RCZA 4RD6A 3ZBTA 1FNMA 5KNLA 4QTPA 4DGHA 1UD8A 3V97A 1N07A 1VQ7B 3CXCB 1JA0A 1E62A 2CNDA 4RD1A 5FA6A 1H4ZA 3A8JA 2JIZA 2D74A 1E1QA 2XEXA 2W6IA 4B4DA 1M90D 2X0KA 2WPDA 3U2QA 1YHQB 4KKTA 4WZKA 3AGPA 2X6YA 1WSVA 4RLZA 5F4OA 4J0QA 4YAFA 1E64A 3V8VA 1KRHA 1F20A 1AIPA 1GAWA 2EIXA 3ZXNA 5EMNA 4YAWA 2HDNB 1Y0RA 2C2WA 2V4DA 2ZXHA 4P2NA 2GPJA 5AN9A 3IH9A 3ONYA 2OBRA 4PC3A 4FXUA 4DK0A 1NB9A 1QUFA 1WTHD 1Q81D 1N6FA 1QFYA 1E3ZA 1XB2A 1WORA 3DJAA 5IYPA 2VZLA 2X8KA 3OP1A 4TMWA 4II3A 3I56B 2R9VA 3Q6RA 3ASTA 3CESA 1VQ8B 1AMOA 1VF7A 1S0UA 1TH8B 4YAUA 1OGJA 4Z4YA 2VBSA 5KW9A 3OFNA 2QE7A 3B78A 1VQ6B 3IH8A 2CBXA 3QSYA 3WXMA 1FCFA 1Q7YD 1G7SA 3ASQA 4RPBA 4XONA 4Y9UA 1YJ9B 3CD6B 3ONUA 1XE1A 4Z1MA 3BC9A 3JU4A 2V7TA 1NRKA 1KZLA 3A1PA 2OYNA 3CRZA 2RC5A 3CP8A 1RQRA 3VNUA 1T6XA 4P1VA 1YJWB 3ASRA 3QDQA 1V0FA 1FC7A 3IHAA 1R5OA 1DG1G 1SKYB 1TLLA 2X3UA 2D3NA 1ZM4A 4WZTA 1N08A 1TIDB 1H4YA 2LZJA 4FN5A 4G5GA 3CCRB 4M1KA 4UZEA 1V5VA 4TMTA 3D03A 1P4MA 1VC1A 2DXLA 4DGFA 1I7PA 4RDLA 4EH1A 1SM4A 1EFUA 3LDFA 3C0KA 1UD5A 2QDXA 4RD4A 4XR6A 3I55B 5EUUA 4AVZA 4E0FA 1IB0A 4WQMA 1DDIA 3P27A 2DERA 2VBVA 2KVOA 3B82A 3OOCA 4XOTA 5E6TA 1QG0A 5TR9A 2VBTA 4Z4TA 3IHBA 5F4JA 5H59A 3ZZUA 3WYAA 1IHMA 2CC2A 4OP7A 1G7RA 2OTLB 3W2HA 3CCMB 1T6RA 3OE7A 2VNIA 4XORA 4P12A 2ZTNA 1DDGA 5KSWB 2W6JA 1TILB 3F43A 3A8IA 5LMZA 3VNVA 3JQRA 1BMFA 3LNNA 3LVBA 4K1XA 4RPDA 4Z4ZA 3SKBA 3A35A 4QVAA 1JNYA 3WNDA 3QFSA 1W2BB 1VQMB 3FJOA 5H5JA 4KKUA 3CMAB 5BSYA 1B23P 3CMEB 4P3IA 4XKVA 5IYWA 5FNZA 3OPOA 4B44A 4WZLA 3VMFA 1WOOA 3WY9A 3PA2A 1VQLB 1R5BA 2B78A 5A89A 3GQBA 1NBMA 1F60A 1HA3A 4Q7JB 1OB5A 4QFMA 4ASUA 2V7WA 1QUEA 2BV3A 1TVCA 2QGGA 4G6IA 2QMUA 2DOGA 1EWYA 4KKSA 2ZZFA 2R6HA 1W0KA 1WOSA 4ZGQB 3W2IA 5EUZA 1I18A 5TV2A 3G4SB 4TMZA 3ZTBA 5HZBA 1W35A 2FVGA 3Q38A 4LC0A 4UAJA 4X06A 1VQ4B 1E1RA 4QVJA 3AVVA 3T51B 3MOGA 3CB4A 2E1BA 3OKXA 4LBWA 1N0VC 1RQPA 3R6JA 1QFZA 3QE2A 2BF4A 4YHBA 1BX0A 3D3UA 4X7FA 4MYTA 2OBSA 2C77A 1VLYA 3GK7A 4H9GA 1S4MA 4NNJA 3D26A 5IYRA 5DN6A 3ZZ0A 4Z4VA 1MABA 3JQPA 4OOVA 1KJZA 1QVGB 2X6XA 1N6EA 2AS0A 3OIRA 4QUZA 4DNTB 2BN4A 2Q6OA 1CNFA 5L46A 4JMQA 1WPCA 2DXNA 4TN1A 4YEJA 4X05A 3OEEA 3G71B 2QA4B 1FC9A 1H85A 1KC8D 1KK0A 4QHYA 4Z4RA 1EXMA 4Z4WA 3DORA 2KA5A 1U2RA 5TRDA 5EUSA 3K50A 2ZZQA 4RCYA 4ZCMA 4XOPA 3V7AA 5GV8A 4OPOA 3AVXA 1QH0A 1OB2A 2WYRA 1FX0A 2YWGA 3QFTA 1KD1D 2WZNA 3G6EB 5GV7A 1E43A 1YX2A 3AGQA 2BPOA 1S72B 3ES9A 4PGOA 1H8EA 4ACBA 1GVHA 3CMMA 1QX4A 1SBOA 1FDRA 1T6YA 4RM0A 2X53S 2B5OA 2PLFA 1K73D 1N0UA 1VQPB 1GR1A 3ZZTA 1Q9SA 1VQ9B 1IJFA 1E3XA 3AVTA 4Z4SA 1FNDA 1XQBA 3ASSA 3CPXA 1T5EA 5JBQA 3CW2A 4PC1A 5BSXA 4XLFA 2QEXB 4L1CA 3OW2B 3H94A 2QTLA 4RJLA 1NDHA 4X7EA 2PMDA 3BCFA 5HXBA 1CQXA 4LBZA 1WSRA 4YAOA 3T6OA 1W87A 3WNCA 2YWFA 2XGJA 3R6KA 1B2RA 4ZCIA 4DQKA 2DIEA 2VNKA 4Y9RA 2CF4A 1BUZA 2WR8A 2QN6A 3OEHA 3W5HA 2DCUA 1QGAA 1PJ5A 5J35A 2CRVA 2XOKA 2DETA 2VJJA 3CCSB 4M0LA 2XNCA 2HLDA 3OAAA 2YWEA 4P6YA 4XL9A 2GJRA 3B8HA 4YALA 3W5VA 5FL7A 2GK6A 2X6WA 4WWVA 5EUXA 4RD3A 4XN3A 1NJID 3MMPA 1XFOA 3LO8A 5IK2A 4TT3A 5DS0A 4B48A 2EFGA 4X7DA 1TTTA 1N6DA 2BVNA 3Q3AA 2B7BA 1KK1A 5EZBA 4M2LA 1FRNA 3LQ6A 2V7UA 3IF5A 3KL9A 4ZGNB 4XLCA 3MHPA 4LBYA 1UD4A 3CTAA 3WBKA 3DUPA 2BM1A 2XNJA 3ZUGA 4DMGA 3E20A 4RD0A 4AEJA 4AF7A 1VQOB 4PC7A 1SKQA 2DY1A 3AGDA 5DSZA 2VY9A 4X0CA 1E63A 3LQEA 1PJ7A 3MCAA 3SEJA 1KMHA 1ELOA 2BSAA 4GQNA 4XMYA 2CWWA 2BM0A 4B3XA 3ZBUA 3GSIA 4PC6A 1PJ6A 4UZFA 3GIRA 2XZLA 3BY2A 1D8TA 2GJKA 3I1FA 4HYLA 3CC4B 4X7CA 4XLEA 1UD3A 2BMWA 1EFTA 2JDIA 2XZOA 1BQEA 2GQFA 2ZL7A 1I8DA 2OBTA 3ISXA 1G7TA 3A3BA 4HIZA 4XNFA 4DK1A 4NCNA 1Q86D 3PA1A 2F1LA
chains in the Genus database with same CATH topology
3DORA 1NRKA 1OB0A 2V31A 3FKSA 1KZLA 2GK7A 3NE5B 3K50A 2ZZQA 4AE2A 3KEWA 4G7WA 4XOPA 3ZPNA 3CP8A 1FX0A 1EFRA 2XNDA 1BPLA 5CDFA 1V0FA 3T56B 1FC7A 4TKOB 1E43A 1SKYB 1WP6A 4XM3A 2RRLA 2D3NA 2ZZGA 4XQFA 2WSSA 1FC6A 2LZJA 4L8KA 1H8EA 3CMMA 2XZPA 3D03A 4XN0A 2GJPA 3G05A 2DXLA 2X53S 2ZZEA 1HZEA 1BLIA 2JJ2A 1E3XA 2CK3A 2WZPP 3ZIAA 1UD5A 2ZOAA 4XR6A 1UD2A 4G7XA 3GVJA 4AVZA 4E0FA 1T5EA 2X85A 4XOTA 2KVOA 3OOCA 1K28D 4L8JA 4YELA 1PKVA 3GVKA 2ZXIA 4XLHA 4B3GA 3A3GA 4XLFA 1W9XA 4L1CA 4XLAA 3H94A 1V0EA 3BCFA 4II2A 3GMFA 3T53B 4XD7A 2V7QA 3OE7A 1H8HA 4XORA 1K32A 2ZTNA 2W6JA 3HAGA 4UZUA 3WQZA 3FPPA 3GHFA 1BMFA 3LNNA 2XGJA 3A35A 2DIEA 2VJIA 3CP2A 4GHNA 1J7XA 3OEHA 5KNLA 2M5SA 4KKUA 1UD8A 4XKVA 4DNRB 1E79A 2XOKA 2VJJA 2WJYA 2D3LA 3OPOA 2HLDA 3OAAA 4XL9A 2GJRA 2JIZA 5FL7A 2GK6A 2X6WA 1E1QA 2F43A 4XN3A 2W6IA 5IK2A 3GQBA 1NBMA 2WPDA 3VR6A 4KKTA 4TT3A 4ASUA 2X6YA 4XKWA 5HKKA 4G6IA 1N6DA 4YXWA 4B3FX 4KKSA 2ZZFA 1W0KA 1W0JA 2Z6BD 2ZTGA 4JC0A 1OHHA 4XLCA 1UD4A 1I18A 3DUPA 3DDYA 2V4DA 2ZXHA 3BCDA 4AEJA 4P22A 2JJ1A 1E1RA 3T51B 3MOGA 2E1BA 3OW7A 1HVXA 1VJSA 4FXUA 4DK0A 1WTHD 4TSFA 1KMHA 4GQNA 4XMYA 1N6FA 1E3ZA 1VLYA 4NNJA 3DJAA 2X8KA 2XZLA 5DN6A 1COWA 3GVLA 1MABA 2GJKA 4II3A 1N6EA 2R9VA 2X6XA 3CESA 2WJVA 4XLEA 1UD3A 1VF7A 4DNTB 2F1MA 2JDIA 2XZOA 4JMQA 1WPCA 2QE7A 3OFNA 4YEJA 2DXNA 2ZO9B 1I8DA 3BH4A 3OEEA 1FC9A 1FCFA 3A3BA 4HIZA 4XONA 4XNFA 4DK1A 1UD6A 4Z1MA 3BC9A 3JU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UD5 A;  1OB0 A;  1UD2 A;  2D3L A;  1HVX A;  1VJS A;  2GJR A;  1E3Z A;  1W9X A;  1BPL A;  1E43 A;  1WP6 A;  3BCF A;  2D3N A;  1UD3 A;  4UZU A;  1WPC A;  1UD4 A;  2GJP A;  3BH4 A;  2DIE A;  3BCD A;  1BLI A;  1UD6 A;  1E3X A;  3BC9 A;  1UD8 A; 
#chains in the Genus database with same CATH topology
 1GO2 A;  1ZM9 A;  1OB0 A;  2C5H A;  2QTZ A;  3OIZ A;  5IYQ A;  3CCE B;  4AE2 A;  4Y7C A;  4LBV A;  4G7W A;  2P3M A;  2D9R A;  3V76 A;  1BJK A;  4OPV A;  5A88 A;  2FX3 A;  1VLO A;  2ZBV A;  3Q39 A;  3WNB A;  3QFC A;  3T56 B;  3CCL B;  1FRQ A;  1N05 A;  4TKO B;  1VHE A;  4XM3 A;  1YIJ B;  1WXW A;  2Q6I A;  2RRL A;  5B6I A;  3J81 k;  5FO0 A;  1KTV A;  2C5B A;  2WSS A;  3NY7 A;  4CQJ A;  4L8K A;  4ROX A;  1Q82 D;  5FIU A;  3SJP A;  3RY8 A;  4DQL A;  2GJP A;  3G05 A;  1NB0 A;  2VNH A;  4B47 A;  4F7D A;  4G1V A;  1EFC A;  3ASP A;  3LLO A;  4B43 A;  4TMX A;  3CPW B;  2CK3 A;  3ZIA A;  3SLD A;  2ZOA A;  2NV4 A;  1UD2 A;  4G7X A;  3GVJ A;  1ZM2 A;  5HZA A;  3OZW A;  2Q6L A;  1N8R D;  1AUZ A;  1K8A D;  2DEU A;  3WBJ A;  1HF2 A;  2HCJ B;  3SJZ A;  1PKV A;  1N06 A;  2ZXI A;  3E1Y E;  3GVK A;  4G1B A;  3A3G A;  4OOS A;  4B3G A;  1W9X A;  2OAS A;  4M4S A;  2B7C A;  1V0E A;  4FK8 A;  1QFJ A;  2VBU A;  3GMF A;  2AHO A;  2V7Q A;  4ACA A;  2VNJ A;  3ZC3 A;  3MGL A;  3HAG A;  4UZU A;  3WQZ A;  3CCV B;  1H42 A;  1KK3 A;  3GHF A;  3VO1 A;  1YIT B;  1IJE A;  1J9Z A;  1UMK A;  2VJI A;  3CP2 A;  1EP3 B;  4X8I A;  4GHN A;  4IW3 B;  3AGE A;  4P26 A;  2M5S A;  3PVD A;  4DNR B;  1E79 A;  2WJY A;  2D3L A;  4AC9 A;  1VQN B;  3VSE A;  5IYN A;  2C4U A;  3SLN A;  2ZL5 A;  2RC6 A;  1FNC A;  1R5N A;  3FPK A;  2F43 A;  4ZCL A;  3VR6 A;  5EUW A;  4XKW A;  5HKK A;  3PUN A;  3AVY A;  4QV2 A;  4RDJ A;  4YXW A;  4B3F X;  2HMA A;  2DYI A;  2V7X A;  1FNB A;  2YWH A;  1W0J A;  2Z6B D;  2ZTG A;  1GAQ A;  4JC0 A;  1OHH A;  2PE3 A;  3DDY A;  1QVF B;  2OK8 A;  3W2F A;  5J3O A;  3CCJ B;  4P9S A;  2F4N A;  3BCD A;  4P22 A;  2JJ1 A;  3OZU A;  5A8A A;  1ZM3 A;  4OOX A;  2JN9 A;  3OW7 A;  1HVX A;  1VJS A;  3PUM A;  3W5U A;  3OJX A;  1WXX A;  4XS5 A;  2PIA A;  3CCQ B;  4TSF A;  1KQS B;  4P25 A;  1H4X A;  3CC7 B;  4PAB A;  2ZL6 A;  1YLO A;  3LKL A;  1COW A;  4HE5 A;  2GRE A;  3W2E A;  3GVL A;  4M53 A;  4N3G A;  4X07 A;  4R71 A;  1GJR A;  2WJV A;  2OTJ B;  2E1R A;  2F1M A;  1ZUN B;  3JQQ A;  4BPR A;  1W34 A;  4TMV A;  4FWT A;  2BGJ A;  1K9M D;  3AVU A;  2ZO9 B;  1KK2 A;  4N3N A;  4WZE A;  3BH4 A;  5F4M A;  1UD6 A;  2WZP P;  1JA1 A;  1G7C A;  3BY1 A;  2V31 A;  2J7K A;  1WDT A;  1WU8 A;  1T6Z A;  3A8K A;  3FKS A;  2GK7 A;  2ZIT A;  3NE5 B;  4P6V F;  4P3Y A;  5FO1 A;  3W2G A;  3KEW A;  4OPS A;  4C0S A;  3ZPN A;  4U9U A;  1EFR A;  2XND A;  1BPL A;  2NPF A;  5CDF A;  1DAR A;  4MYU A;  2BGI A;  1WP6 A;  1VQK B;  2ZZG A;  5THX A;  4XQF A;  4ZV4 A;  1JB9 A;  1FC6 A;  2OK7 A;  4HE6 A;  4PC2 A;  1CNE A;  2XZP A;  1JJ2 B;  3PEN A;  1D1N A;  4XN0 A;  2Q6K A;  4Z4U A;  2KLN A;  3CC2 B;  2C4T A;  2I1L A;  3Q6Q A;  2ZZE A;  1YI2 B;  1HZE A;  1THN B;  1BLI A;  3P26 A;  3U6K A;  2JJ2 A;  1YJN B;  4NBS A;  1M1K D;  3AVW A;  3BNW A;  5TY0 A;  3OZV A;  1VQ5 B;  1EP2 B;  1MRZ A;  1TUI A;  4RDK A;  1WOP A;  2X85 A;  4C43 A;  4L8J A;  1K28 D;  3BQJ A;  4RD2 A;  4YEL A;  3H9N A;  4XLH A;  3VO2 A;  3CCU B;  4XLA A;  1QGY A;  1Y0Y A;  3U6B A;  4AF6 A;  4II2 A;  3T53 B;  4XD7 A;  1VHO A;  1A8P A;  1D2E A;  1H8H A;  1K32 A;  2V7V A;  2VYQ A;  1EP1 B;  1BX1 A;  2C78 A;  2ZBU A;  3QFR A;  3FPP A;  1OGI A;  4PAA A;  3EH7 A;  2CW5 A;  1J7X A;  1QGZ A;  3OJW A;  4RCZ A;  4RD6 A;  3ZBT A;  1FNM A;  5KNL A;  4QTP A;  4DGH A;  1UD8 A;  3V97 A;  1N07 A;  1VQ7 B;  3CXC B;  1JA0 A;  1E62 A;  2CND A;  4RD1 A;  5FA6 A;  1H4Z A;  3A8J A;  2JIZ A;  2D74 A;  1E1Q A;  2XEX A;  2W6I A;  4B4D A;  1M90 D;  2X0K A;  2WPD A;  3U2Q A;  1YHQ B;  4KKT A;  4WZK A;  3AGP A;  2X6Y A;  1WSV A;  4RLZ A;  5F4O A;  4J0Q A;  4YAF A;  1E64 A;  3V8V A;  1KRH A;  1F20 A;  1AIP A;  1GAW A;  2EIX A;  3ZXN A;  5EMN A;  4YAW A;  2HDN B;  1Y0R A;  2C2W A;  2V4D A;  2ZXH A;  4P2N A;  2GPJ A;  5AN9 A;  3IH9 A;  3ONY A;  2OBR A;  4PC3 A;  4FXU A;  4DK0 A;  1NB9 A;  1QUF A;  1WTH D;  1Q81 D;  1N6F A;  1QFY A;  1E3Z A;  1XB2 A;  1WOR A;  3DJA A;  5IYP A;  2VZL A;  2X8K A;  3OP1 A;  4TMW A;  4II3 A;  3I56 B;  2R9V A;  3Q6R A;  3AST A;  3CES A;  1VQ8 B;  1AMO A;  1VF7 A;  1S0U A;  1TH8 B;  4YAU A;  1OGJ A;  4Z4Y A;  2VBS A;  5KW9 A;  3OFN A;  2QE7 A;  3B78 A;  1VQ6 B;  3IH8 A;  2CBX A;  3QSY A;  3WXM A;  1FCF A;  1Q7Y D;  1G7S A;  3ASQ A;  4RPB A;  4XON A;  4Y9U A;  1YJ9 B;  3CD6 B;  3ONU A;  1XE1 A;  4Z1M A;  3BC9 A;  3JU4 A;  2V7T A;  1NRK A;  1KZL A;  3A1P A;  2OYN A;  3CRZ A;  2RC5 A;  3CP8 A;  1RQR A;  3VNU A;  1T6X A;  4P1V A;  1YJW B;  3ASR A;  3QDQ A;  1V0F A;  1FC7 A;  3IHA A;  1R5O A;  1DG1 G;  1SKY B;  1TLL A;  2X3U A;  2D3N A;  1ZM4 A;  4WZT A;  1N08 A;  1TID B;  1H4Y A;  2LZJ A;  4FN5 A;  4G5G A;  3CCR B;  4M1K A;  4UZE A;  1V5V A;  4TMT A;  3D03 A;  1P4M A;  1VC1 A;  2DXL A;  4DGF A;  1I7P A;  4RDL A;  4EH1 A;  1SM4 A;  1EFU A;  3LDF A;  3C0K A;  1UD5 A;  2QDX A;  4RD4 A;  4XR6 A;  3I55 B;  5EUU A;  4AVZ A;  4E0F A;  1IB0 A;  4WQM A;  1DDI A;  3P27 A;  2DER A;  2VBV A;  2KVO A;  3B82 A;  3OOC A;  4XOT A;  5E6T A;  1QG0 A;  5TR9 A;  2VBT A;  4Z4T A;  3IHB A;  5F4J A;  5H59 A;  3ZZU A;  3WYA A;  1IHM A;  2CC2 A;  4OP7 A;  1G7R A;  2OTL B;  3W2H A;  3CCM B;  1T6R A;  3OE7 A;  2VNI A;  4XOR A;  4P12 A;  2ZTN A;  1DDG A;  5KSW B;  2W6J A;  1TIL B;  3F43 A;  3A8I A;  5LMZ A;  3VNV A;  3JQR A;  1BMF A;  3LNN A;  3LVB A;  4K1X A;  4RPD A;  4Z4Z A;  3SKB A;  3A35 A;  4QVA A;  1JNY A;  3WND A;  3QFS A;  1W2B B;  1VQM B;  3FJO A;  5H5J A;  4KKU A;  3CMA B;  5BSY A;  1B23 P;  3CME B;  4P3I A;  4XKV A;  5IYW A;  5FNZ A;  3OPO A;  4B44 A;  4WZL A;  3VMF A;  1WOO A;  3WY9 A;  3PA2 A;  1VQL B;  1R5B A;  2B78 A;  5A89 A;  3GQB A;  1NBM A;  1F60 A;  1HA3 A;  4Q7J B;  1OB5 A;  4QFM A;  4ASU A;  2V7W A;  1QUE A;  2BV3 A;  1TVC A;  2QGG A;  4G6I A;  2QMU A;  2DOG A;  1EWY A;  4KKS A;  2ZZF A;  2R6H A;  1W0K A;  1WOS A;  4ZGQ B;  3W2I A;  5EUZ A;  1I18 A;  5TV2 A;  3G4S B;  4TMZ A;  3ZTB A;  5HZB A;  1W35 A;  2FVG A;  3Q38 A;  4LC0 A;  4UAJ A;  4X06 A;  1VQ4 B;  1E1R A;  4QVJ A;  3AVV A;  3T51 B;  3MOG A;  3CB4 A;  2E1B A;  3OKX A;  4LBW A;  1N0V C;  1RQP A;  3R6J A;  1QFZ A;  3QE2 A;  2BF4 A;  4YHB A;  1BX0 A;  3D3U A;  4X7F A;  4MYT A;  2OBS A;  2C77 A;  1VLY A;  3GK7 A;  4H9G A;  1S4M A;  4NNJ A;  3D26 A;  5IYR A;  5DN6 A;  3ZZ0 A;  4Z4V A;  1MAB A;  3JQP A;  4OOV A;  1KJZ A;  1QVG B;  2X6X A;  1N6E A;  2AS0 A;  3OIR A;  4QUZ A;  4DNT B;  2BN4 A;  2Q6O A;  1CNF A;  5L46 A;  4JMQ A;  1WPC A;  2DXN A;  4TN1 A;  4YEJ A;  4X05 A;  3OEE A;  3G71 B;  2QA4 B;  1FC9 A;  1H85 A;  1KC8 D;  1KK0 A;  4QHY A;  4Z4R A;  1EXM A;  4Z4W A;  3DOR A;  2KA5 A;  1U2R A;  5TRD A;  5EUS A;  3K50 A;  2ZZQ A;  4RCY A;  4ZCM A;  4XOP A;  3V7A A;  5GV8 A;  4OPO A;  3AVX A;  1QH0 A;  1OB2 A;  2WYR A;  1FX0 A;  2YWG A;  3QFT A;  1KD1 D;  2WZN A;  3G6E B;  5GV7 A;  1E43 A;  1YX2 A;  3AGQ A;  2BPO A;  1S72 B;  3ES9 A;  4PGO A;  1H8E A;  4ACB A;  1GVH A;  3CMM A;  1QX4 A;  1SBO A;  1FDR A;  1T6Y A;  4RM0 A;  2X53 S;  2B5O A;  2PLF A;  1K73 D;  1N0U A;  1VQP B;  1GR1 A;  3ZZT A;  1Q9S A;  1VQ9 B;  1IJF A;  1E3X A;  3AVT A;  4Z4S A;  1FND A;  1XQB A;  3ASS A;  3CPX A;  1T5E A;  5JBQ A;  3CW2 A;  4PC1 A;  5BSX A;  4XLF A;  2QEX B;  4L1C A;  3OW2 B;  3H94 A;  2QTL A;  4RJL A;  1NDH A;  4X7E A;  2PMD A;  3BCF A;  5HXB A;  1CQX A;  4LBZ A;  1WSR A;  4YAO A;  3T6O A;  1W87 A;  3WNC A;  2YWF A;  2XGJ A;  3R6K A;  1B2R A;  4ZCI A;  4DQK A;  2DIE A;  2VNK A;  4Y9R A;  2CF4 A;  1BUZ A;  2WR8 A;  2QN6 A;  3OEH A;  3W5H A;  2DCU A;  1QGA A;  1PJ5 A;  5J35 A;  2CRV A;  2XOK A;  2DET A;  2VJJ A;  3CCS B;  4M0L A;  2XNC A;  2HLD A;  3OAA A;  2YWE A;  4P6Y A;  4XL9 A;  2GJR A;  3B8H A;  4YAL A;  3W5V A;  5FL7 A;  2GK6 A;  2X6W A;  4WWV A;  5EUX A;  4RD3 A;  4XN3 A;  1NJI D;  3MMP A;  1XFO A;  3LO8 A;  5IK2 A;  4TT3 A;  5DS0 A;  4B48 A;  2EFG A;  4X7D A;  1TTT A;  1N6D A;  2BVN A;  3Q3A A;  2B7B A;  1KK1 A;  5EZB A;  4M2L A;  1FRN A;  3LQ6 A;  2V7U A;  3IF5 A;  3KL9 A;  4ZGN B;  4XLC A;  3MHP A;  4LBY A;  1UD4 A;  3CTA A;  3WBK A;  3DUP A;  2BM1 A;  2XNJ A;  3ZUG A;  4DMG A;  3E20 A;  4RD0 A;  4AEJ A;  4AF7 A;  1VQO B;  4PC7 A;  1SKQ A;  2DY1 A;  3AGD A;  5DSZ A;  2VY9 A;  4X0C A;  1E63 A;  3LQE A;  1PJ7 A;  3MCA A;  3SEJ A;  1KMH A;  1ELO A;  2BSA A;  4GQN A;  4XMY A;  2CWW A;  2BM0 A;  4B3X A;  3ZBU A;  3GSI A;  4PC6 A;  1PJ6 A;  4UZF A;  3GIR A;  2XZL A;  3BY2 A;  1D8T A;  2GJK A;  3I1F A;  4HYL A;  3CC4 B;  4X7C A;  4XLE A;  1UD3 A;  2BMW A;  1EFT A;  2JDI A;  2XZO A;  1BQE A;  2GQF A;  2ZL7 A;  1I8D A;  2OBT A;  3ISX A;  1G7T A;  3A3B A;  4HIZ A;  4XNF A;  4DK1 A;  4NCN A;  1Q86 D;  3PA1 A;  2F1L A; 
#chains in the Genus database with same CATH homology
 3DOR A;  1NRK A;  1OB0 A;  2V31 A;  3FKS A;  1KZL A;  2GK7 A;  3NE5 B;  3K50 A;  2ZZQ A;  4AE2 A;  3KEW A;  4G7W A;  4XOP A;  3ZPN A;  3CP8 A;  1FX0 A;  1EFR A;  2XND A;  1BPL A;  5CDF A;  1V0F A;  3T56 B;  1FC7 A;  4TKO B;  1E43 A;  1SKY B;  1WP6 A;  4XM3 A;  2RRL A;  2D3N A;  2ZZG A;  4XQF A;  2WSS A;  1FC6 A;  2LZJ A;  4L8K A;  1H8E A;  3CMM A;  2XZP A;  3D03 A;  4XN0 A;  2GJP A;  3G05 A;  2DXL A;  2X53 S;  2ZZE A;  1HZE A;  1BLI A;  2JJ2 A;  1E3X A;  2CK3 A;  2WZP P;  3ZIA A;  1UD5 A;  2ZOA A;  4XR6 A;  1UD2 A;  4G7X A;  3GVJ A;  4AVZ A;  4E0F A;  1T5E A;  2X85 A;  4XOT A;  2KVO A;  3OOC A;  1K28 D;  4L8J A;  4YEL A;  1PKV A;  3GVK A;  2ZXI A;  4XLH A;  4B3G A;  3A3G A;  4XLF A;  1W9X A;  4L1C A;  4XLA A;  3H94 A;  1V0E A;  3BCF A;  4II2 A;  3GMF A;  3T53 B;  4XD7 A;  2V7Q A;  3OE7 A;  1H8H A;  4XOR A;  1K32 A;  2ZTN A;  2W6J A;  3HAG A;  4UZU A;  3WQZ A;  3FPP A;  3GHF A;  1BMF A;  3LNN A;  2XGJ A;  3A35 A;  2DIE A;  2VJI A;  3CP2 A;  4GHN A;  1J7X A;  3OEH A;  5KNL A;  2M5S A;  4KKU A;  1UD8 A;  4XKV A;  4DNR B;  1E79 A;  2XOK A;  2VJJ A;  2WJY A;  2D3L A;  3OPO A;  2HLD A;  3OAA A;  4XL9 A;  2GJR A;  2JIZ A;  5FL7 A;  2GK6 A;  2X6W A;  1E1Q A;  2F43 A;  4XN3 A;  2W6I A;  5IK2 A;  3GQB A;  1NBM A;  2WPD A;  3VR6 A;  4KKT A;  4TT3 A;  4ASU A;  2X6Y A;  4XKW A;  5HKK A;  4G6I A;  1N6D A;  4YXW A;  4B3F X;  4KKS A;  2ZZF A;  1W0K A;  1W0J A;  2Z6B D;  2ZTG A;  4JC0 A;  1OHH A;  4XLC A;  1UD4 A;  1I18 A;  3DUP A;  3DDY A;  2V4D A;  2ZXH A;  3BCD A;  4AEJ A;  4P22 A;  2JJ1 A;  1E1R A;  3T51 B;  3MOG A;  2E1B A;  3OW7 A;  1HVX A;  1VJS A;  4FXU A;  4DK0 A;  1WTH D;  4TSF A;  1KMH A;  4GQN A;  4XMY A;  1N6F A;  1E3Z A;  1VLY A;  4NNJ A;  3DJA A;  2X8K A;  2XZL A;  5DN6 A;  1COW A;  3GVL A;  1MAB A;  2GJK A;  4II3 A;  1N6E A;  2R9V A;  2X6X A;  3CES A;  2WJV A;  4XLE A;  1UD3 A;  1VF7 A;  4DNT B;  2F1M A;  2JDI A;  2XZO A;  4JMQ A;  1WPC A;  2QE7 A;  3OFN A;  4YEJ A;  2DXN A;  2ZO9 B;  1I8D A;  3BH4 A;  3OEE A;  1FC9 A;  1FCF A;  3A3B A;  4HIZ A;  4XON A;  4XNF A;  4DK1 A;  1UD6 A;  4Z1M A;  3BC9 A;  3JU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...