1BPLA

Glycosyltransferase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
179
Chain Sequence
LNGTLMQYFEWYMPNDGQHWKRLQNDSAYLAEHGITAVWIPPAYKGTSQADVGYGAYDLYDLGEFHQKGTVRTKYGTKGELQSAIKSLHSRDINVYGDVVINHKGGADATEDVTAVEVDPADRNRVISGEHLIKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKLNRIYKFQGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
publication title Crystal structure of calcium-depleted Bacillus licheniformis alpha-amylase at 2.2 A resolution.
pubmed doi rcsb
molecule tags Glycosyltransferase
total genus 53
structure length 179
sequence length 179
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1bplA02
3.30.750.90 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1bplA01
1BLIA 1OB0A 1HVXA 3BCDA 1UD3A 2DIEA 3BCFA 1UD8A 4UZUA 2D3NA 1BPLA 1UD5A 1E3ZA 1E3XA 1WPCA 3BH4A 1E43A 1UD4A 2GJRA 1UD6A 1UD2A 2D3LA 1W9XA 1WP6A 1VJSA 2GJPA 3BC9A
chains in the Genus database with same CATH superfamily
2XOKA 1NJID 4B3GA 4Y7CA 1T6YA 5FL7A 4WZLA 2VBUA 1W87A 1V0FA 3QFTA 2VNJA 4B44A 3JQQA 5DS0A 1BPLA 5DN6A 2YWHA 2BPOA 3FPPA 2V7XA 1NDHA 2BMWA 2FVGA 1OB2A 1QGAA 2OK7A 2QTLA 1VQ6B 2RRLA 1M90D 1FC9A 3OZUA 2B7BA 2ZL5A 5EZBA 2GJKA 3W2HA 4AC9A 2XGJA 1N0VC 2YWEA 1TLLA 1FX0A 3AGPA 4ZCMA 4ACBA 4IW3B 5IYNA 2PMDA 1UMKA 2DYIA 4P22A 1VQLB 4DQKA 1YJWB 4YAFA 4Q7JB 5F4JA 1G7SA 1MRZA 2X85A 2AS0A 2DXLA 1E62A 4UZFA 4II3A 2ZBVA 5IYPA 3A35A 2JDIA 1XQBA 1KK1A 4YELA 3ASQA 5FO0A 4J0QA 1TTTA 3AVTA 2V7VA 1K28D 4PC1A 5J35A 1I7PA 2FX3A 4P6VF 3V97A 1BX1A 2VBVA 2ZITA 3Q38A 2PLFA 4TMZA 1G7TA 3GHFA 4X07A 3OW7A 1FCFA 1AUZA 1OB5A 1FNDA 4ZV4A 3H9NA 4X7DA 4YHBA 1T6ZA 2WZNA 3OKXA 1MABA 4HIZA 2QE7A 2X0KA 2X6XA 2DIEA 4YAUA 1F20A 1AIPA 4G6IA 3D26A 1R5NA 3I55B 1VQKB 3J81k 4ZGQB 4CQJA 3T56B 3CCQB 5EUUA 1FNBA 2OBSA 4OP7A 1W34A 2VJJA 1D8TA 2CWWA 4FK8A 3W5VA 4OOXA 3K50A 1N6EA 2D74A 4XLHA 1KK2A 3SKBA 3C0KA 1T6XA 2NV4A 4EH1A 4G5GA 4PGOA 5IYRA 3VNVA 1WP6A 4TMXA 2CW5A 1Q7YD 2Q6LA 4X0CA 4Y9RA 2V31A 2BGJA 4X05A 3W2EA 2HLDA 2ZTNA 1BMFA 3V8VA 4Z1MA 1BX0A 2BM1A 5HZAA 3AGQA 1ZM4A 1PJ6A 2D3NA 1WORA 3MMPA 4PC2A 4RDKA 4TKOB 3KL9A 5TY0A 3QE2A 3OEEA 2CC2A 3CCRB 3G6EB 1SKQA 1QVGB 1E3ZA 4XN0A 5L46A 3NE5B 4OPSA 1N05A 1KJZA 1WDTA 1ZM3A 1UD4A 3T51B 3CESA 1W0KA 2JN9A 4AVZA 3I56B 1N6DA 2I1LA 2X6YA 1SM4A 4LBVA 3WYAA 1IHMA 2C2WA 1KK3A 1ZM2A 4QUZA 4RD2A 2F1MA 4M0LA 1AMOA 3CD6B 4XS5A 2OBRA 4HYLA 4WWVA 3DORA 3W2IA 1UD8A 3ZXNA 4RCYA 1QFZA 1P4MA 3GIRA 4R71A 5B6IA 3AGDA 1WSVA 3CC2B 1EP2B 3VSEA 2RC5A 4P12A 3ISXA 3ONUA 3WY9A 1WU8A 3ONYA 3CCLB 3WNCA 3W2FA 4QFMA 3CMEB 4TMWA 4N3GA 3ASTA 3V7AA 2D9RA 4RPDA 5THXA 3P27A 3WNDA 2F4NA 2JJ1A 2X3UA 2V4DA 4Z4TA 3SLDA 2Q6KA 2DOGA 4X06A 1VLYA 4HE6A 4XOTA 2M5SA 2R6HA 2VNIA 1DG1G 1NBMA 1OHHA 2W6IA 3OIRA 4P1VA 3AVVA 1VC1A 2BVNA 3ZZ0A 3A3BA 4Z4VA 5A88A 3OOCA 3G71B 1YIJB 4OPOA 1S4MA 4GHNA 4RLZA 4XLFA 3ZC3A 4L1CA 2E1BA 3OZWA 3OZVA 2GJRA 2RC6A 1Y0YA 3ASPA 4E0FA 3AVUA 2VZLA 2OTLB 1VQNB 3IHAA 4DNRB 1N8RD 2GQFA 3SEJA 3OFNA 4KKTA 3W5HA 2ZO9B 2V7QA 4JMQA 2ZL7A 4X7FA 3DUPA 1RQPA 4WZKA 1VQ5B 5HZBA 1DARA 4X8IA 4PC3A 3CCUB 4QVAA 1EP1B 1RQRA 2WJYA 2ZZFA 2NPFA 4ZCLA 2Q6OA 4B3XA 3CTAA 1N07A 1SBOA 1NB0A 3MHPA 4TT3A 2X53S 3ES9A 1BUZA 5H5JA 1EFUA 3A8JA 1B23P 2X8KA 2JJ2A 3GVKA 4Y9UA 1T6RA 4DMGA 2CF4A 3ASSA 4ROXA 4XN3A 3A8KA 1QUEA 4TN1A 1COWA 4XKWA 3FKSA 4NBSA 3GVLA 5GV7A 2PE3A 1VJSA 1QX4A 3QFCA 1NRKA 3W5UA 3CCVB 1EWYA 1H8HA 2ZBUA 2J7KA 2V7TA 3BY2A 4P3YA 3OPOA 3BCFA 2GREA 4H9GA 1TIDB 3WNBA 3ZTBA 1PJ7A 4XR6A 2VY9A 5A89A 3D3UA 2B5OA 1UD5A 2WR8A 3GVJA 3BQJA 4RJLA 1W35A 4Z4RA 4AE2A 1GR1A 2QMUA 1YX2A 4ZGNB 2XNJA 1GAQA 2DERA 3B78A 3CW2A 4XLAA 1HZEA 4M2LA 1E1QA 2BM0A 3G4SB 1KZLA 3LKLA 1UD2A 2XZOA 2QA4B 4RCZA 4XONA 4RD0A 2ZXIA 2BSAA 1VHOA 4XNFA 5EUXA 1BLIA 1PJ5A 3QDQA 4L8KA 5LMZA 4P25A 3SLNA 1VQ8B 1UD3A 5H59A 3HAGA 4XORA 1D1NA 4K1XA 3GQBA 2F43A 2HMAA 2XZLA 2VBTA 1K9MD 3WBJA 3CCSB 3B82A 1QVFB 1B2RA 2XZPA 1A8PA 3CP8A 5FNZA 1XB2A 1E3XA 5AN9A 4P6YA 1PKVA 1E43A 4DGFA 1N6FA 2JIZA 1VHEA 3P26A 3VNUA 1HF2A 1EFCA 4XLCA 5JBQA 3QFRA 3CCEB 1YJ9B 3MGLA 2OBTA 4YXWA 2BV3A 4OOVA 3B8HA 1Q9SA 4YEJA 1GO2A 3ZUGA 5BSYA 2GPJA 3H94A 1N0UA 1GAWA 2OYNA 4LBWA 1ZUNB 3V76A 1QH0A 1V0EA 3GK7A 2GK7A 4DK0A 2ZXHA 4RD6A 4UZEA 1KMHA 4UZUA 1VQOB 4MYUA 3GMFA 3LVBA 1OGJA 4JC0A 3JQRA 4RM0A 4G7WA 5E6TA 1R5OA 1OGIA 2OTJB 4X7EA 4LC0A 3ZIAA 3FPKA 1YLOA 3PVDA 1BQEA 1QUFA 1JNYA 1VQMB 1UD6A 3W2GA 4XL9A 3CMAB 3ASRA 3CCJB 3G05A 2QTZA 3WBKA 1VLOA 1DDIA 2Q6IA 4YAOA 2QEXB 4M1KA 4N3NA 3OAAA 2AHOA 2ZL6A 5FO1A 1H4ZA 2VNHA 3LQ6A 4G1BA 2BN4A 3VO1A 5TRDA 3LQEA 2X6WA 2WZPP 1EFTA 2C78A 4GQNA 1VQ7B 1WOOA 2C5HA 1EFRA 3QSYA 1GVHA 2YWFA 3LNNA 4AF7A 2QGGA 4F7DA 3ZBUA 4RD3A 2CRVA 1QFYA 3DDYA 2CBXA 1I18A 4WZEA 4XKVA 5FIUA 1TUIA 4QVJA 2ZZQA 5KW9A 1Q81D 1GJRA 3IHBA 3MOGA 1JA0A 4XQFA 3CRZA 1VQPB 1H4XA 2VNKA 1H42A 2C5BA 1WSRA 4RDJA 1KD1D 1W9XA 5EUSA 2GJPA 4FXUA 4UAJA 1CQXA 4NNJA 4OOSA 4FWTA 5TR9A 3LDFA 5TV2A 1JJ2B 3SJZA 1E1RA 4TMTA 1XFOA 2V7WA 3OJWA 1QGYA 1IJEA 3CPXA 3KEWA 3PUNA 1EXMA 4XMYA 4U9UA 1WXXA 4B43A 2HDNB 1IJFA 1H85A 1I8DA 1T5EA 2V7UA 2XNDA 2YWGA 3PA2A 4OPVA 4XLEA 1FRQA 3BH4A 3ZZUA 3CCMB 1S72B 1K73D 2ZZEA 4AEJA 1K8AD 1U2RA 3I1FA 4C43A 3PA1A 5KSWB 2E1RA 3A1PA 1D2EA 1QGZA 4QHYA 4MYTA 1WTHD 3OJXA 4P9SA 3FJOA 1H4YA 2QN6A 1R5BA 3OE7A 2WYRA 4RPBA 1OB0A 4Z4SA 5GV8A 3Q6QA 3U2QA 3BCDA 4Z4WA 2ZZGA 1KC8D 3EH7A 4DNTB 4P3IA 1E64A 2DY1A 1KRHA 2GK6A 4TSFA 4XD7A 2R9VA 4XOPA 3VO2A 2WJVA 2OK8A 1ELOA 4WZTA 3QFSA 5HKKA 3LLOA 4M53A 4QTPA 3OP1A 3BNWA 1YHQB 3R6JA 4BPRA 2BF4A 3R6KA 1J7XA 3ZPNA 2WPDA 4L8JA 3D03A 4PC7A 5FA6A 1VQ9B 3T6OA 1E63A 1DDGA 1E79A 4PABA 5KNLA 3AGEA 1WOSA 4RD4A 1ZM9A 1N06A 3E20A 1YJNB 2DEUA 5J3OA 4XM3A 3F43A 3BC9A 2WSSA 2W6JA 4DK1A 3LO8A 1VF7A 4KKUA 4C0SA 3OEHA 2B7CA 4PAAA 2XNCA 3VR6A 3WQZA 4TMVA 2F1LA 2VYQA 4HE5A 5IK2A 3CC7B 3AVXA 2KLNA 1QG0A 3JU4A 3ZBTA 1Q86D 3T53B 2ZTGA 4B48A 3IH9A 3CMMA 3BY1A 3CXCB 4B47A 4ACAA 3OIZA 2C77A 4M4SA 4QV2A 4NCNA 3IF5A 1XE1A 2LZJA 2DCUA 3PENA 4WQMA 1WPCA 3Q3AA 5IYQA 2XEXA 5EMNA 4PC6A 2OASA 4KKSA 3CPWB 4RDLA 1EP3B 4YAWA 2ZOAA 3VMFA 2KVOA 5BSXA 2B78A 5CDFA 4G7XA 4RD1A 1KK0A 3JQPA 4FN5A 5HXBA 1FNCA 1G7CA 2P3MA 1HVXA 4G1VA 2PIAA 2EFGA 1W2BB 4X7CA 3DJAA 4DQLA 3AVYA 3RY8A 2EIXA 4Z4UA 2Z6BD 1G7RA 3A3GA 5DSZA 1FC7A 4DGHA 4P2NA 4ZCIA 1KQSB 1K32A 3OW2B 4P26A 3GSIA 3AVWA 3CP2A 4B3FX 3CC4B 5IYWA 5EUWA 1KTVA 3SJPA 1N08A 3U6BA 1H8EA 1VQ4B 4LBZA 1IB0A 1M1KD 2D3LA 2C4TA 2DETA 1JA1A 2HCJB 5F4MA 1NB9A 1J9ZA 1F60A 1Q82D 1FC6A 2C4UA 1SKYB 1TILB 4ASUA 4Z4YA 1YI2B 3E1YE 2VJIA 1JB9A 1THNB 2BGIA 5A8AA 4B4DA 4LBYA 1Y0RA 5EUZA 4II2A 3MCAA 3WXMA 2VBSA 5F4OA 1QFJA 1WOPA 1WXWA 1FDRA 1FRNA 1TVCA 1TH8B 3PUMA 3ZZTA 3Q39A 3U6KA 1FNMA 2KA5A 3NY7A 1HA3A 1V5VA 3CB4A 2CK3A 4YALA 4Z4ZA 2QDXA 2CNDA 3IH8A 1CNFA 2DXNA 1W0JA 1S0UA 3A8IA 1CNEA 1BJKA 3Q6RA 1YITB 4AF6A
chains in the Genus database with same CATH topology
1BLIA 1OB0A 2XOKA 2F1MA 4B3GA 4L8KA 3BCDA 2ZZGA 1UD3A 5FL7A 4DNTB 3DORA 3HAGA 1UD8A 2GK6A 1V0FA 4TSFA 4XD7A 4XORA 3GQBA 2F43A 2R9VA 4XOPA 2XZLA 1BPLA 2WJVA 5DN6A 5HKKA 3FPPA 2XZPA 3CP8A 1E3XA 1J7XA 1PKVA 1E43A 3ZPNA 2WPDA 1N6FA 2JIZA 4L8JA 3D03A 2RRLA 1FC9A 1E79A 4XLCA 5KNLA 2GJKA 4YXWA 2XGJA 4YEJA 4XM3A 1FX0A 3BC9A 2WSSA 3H94A 2W6JA 4DK1A 2JJ1A 2V4DA 1VF7A 4KKUA 1V0EA 3OEHA 1VLYA 4P22A 4XOTA 2M5SA 3VR6A 2GK7A 3WQZA 4DK0A 2ZXHA 5IK2A 4XNFA 1KMHA 1NBMA 1OHHA 2W6IA 3JU4A 4UZUA 3T53B 2X85A 2ZTGA 2DXLA 3CMMA 3GMFA 4JC0A 4II3A 3A3BA 3OOCA 4G7WA 3A35A 2JDIA 2LZJA 4YELA 1WPCA 4GHNA 4XLFA 3ZIAA 1K28D 4L1CA 4KKSA 2E1BA 2GJRA 4E0FA 1UD6A 4DNRB 4XL9A 3GHFA 2ZOAA 3OFNA 3G05A 2KVOA 3OW7A 4KKTA 1FCFA 2ZO9B 5CDFA 2V7QA 4G7XA 4JMQA 3OAAA 3DUPA 1MABA 1HVXA 4HIZA 2QE7A 2X6XA 2X6WA 2WZPP 2DIEA 2WJYA 2ZZFA 4GQNA 3DJAA 1EFRA 4G6IA 3LNNA 1FC7A 2Z6BD 3A3GA 4TT3A 3T56B 2X53S 2VJJA 1K32A 2X8KA 3DDYA 1I18A 4XKVA 2JJ2A 3GVKA 2ZZQA 3K50A 3CP2A 4XN3A 4B3FX 1N6EA 4XLHA 3MOGA 1COWA 1H8EA 4XQFA 4XKWA 3FKSA 2D3LA 3GVLA 1W9XA 1WP6A 1VJSA 2GJPA 4FXUA 2V31A 1NRKA 4NNJA 2HLDA 1H8HA 2ZTNA 1BMFA 1FC6A 4Z1MA 1SKYB 3OPOA 4ASUA 3BCFA 2VJIA 1E1RA 2D3NA 3KEWA 4XR6A 4XMYA 4TKOB 1UD5A 3OEEA 4II2A 3GVJA 1I8DA 1T5EA 1E3ZA 4XN0A 2XNDA 3NE5B 4XLEA 4AE2A 3BH4A 3T51B 1UD4A 2ZZEA 3CESA 4AEJA 2CK3A 4XLAA 1W0KA 4AVZA 1HZEA 1E1QA 2X6YA 1N6DA 1KZLA 1UD2A 2DXNA 2XZOA 1W0JA 4XONA 2ZXIA 1WTHD 3OE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLI A;  1OB0 A;  1HVX A;  3BCD A;  1UD3 A;  2DIE A;  3BCF A;  1UD8 A;  4UZU A;  2D3N A;  1BPL A;  1UD5 A;  1E3Z A;  1E3X A;  1WPC A;  3BH4 A;  1E43 A;  1UD4 A;  2GJR A;  1UD6 A;  1UD2 A;  2D3L A;  1W9X A;  1WP6 A;  1VJS A;  2GJP A;  3BC9 A; 
#chains in the Genus database with same CATH topology
 2XOK A;  1NJI D;  4B3G A;  4Y7C A;  1T6Y A;  5FL7 A;  4WZL A;  2VBU A;  1W87 A;  1V0F A;  3QFT A;  2VNJ A;  4B44 A;  3JQQ A;  5DS0 A;  1BPL A;  5DN6 A;  2YWH A;  2BPO A;  3FPP A;  2V7X A;  1NDH A;  2BMW A;  2FVG A;  1OB2 A;  1QGA A;  2OK7 A;  2QTL A;  1VQ6 B;  2RRL A;  1M90 D;  1FC9 A;  3OZU A;  2B7B A;  2ZL5 A;  5EZB A;  2GJK A;  3W2H A;  4AC9 A;  2XGJ A;  1N0V C;  2YWE A;  1TLL A;  1FX0 A;  3AGP A;  4ZCM A;  4ACB A;  4IW3 B;  5IYN A;  2PMD A;  1UMK A;  2DYI A;  4P22 A;  1VQL B;  4DQK A;  1YJW B;  4YAF A;  4Q7J B;  5F4J A;  1G7S A;  1MRZ A;  2X85 A;  2AS0 A;  2DXL A;  1E62 A;  4UZF A;  4II3 A;  2ZBV A;  5IYP A;  3A35 A;  2JDI A;  1XQB A;  1KK1 A;  4YEL A;  3ASQ A;  5FO0 A;  4J0Q A;  1TTT A;  3AVT A;  2V7V A;  1K28 D;  4PC1 A;  5J35 A;  1I7P A;  2FX3 A;  4P6V F;  3V97 A;  1BX1 A;  2VBV A;  2ZIT A;  3Q38 A;  2PLF A;  4TMZ A;  1G7T A;  3GHF A;  4X07 A;  3OW7 A;  1FCF A;  1AUZ A;  1OB5 A;  1FND A;  4ZV4 A;  3H9N A;  4X7D A;  4YHB A;  1T6Z A;  2WZN A;  3OKX A;  1MAB A;  4HIZ A;  2QE7 A;  2X0K A;  2X6X A;  2DIE A;  4YAU A;  1F20 A;  1AIP A;  4G6I A;  3D26 A;  1R5N A;  3I55 B;  1VQK B;  3J81 k;  4ZGQ B;  4CQJ A;  3T56 B;  3CCQ B;  5EUU A;  1FNB A;  2OBS A;  4OP7 A;  1W34 A;  2VJJ A;  1D8T A;  2CWW A;  4FK8 A;  3W5V A;  4OOX A;  3K50 A;  1N6E A;  2D74 A;  4XLH A;  1KK2 A;  3SKB A;  3C0K A;  1T6X A;  2NV4 A;  4EH1 A;  4G5G A;  4PGO A;  5IYR A;  3VNV A;  1WP6 A;  4TMX A;  2CW5 A;  1Q7Y D;  2Q6L A;  4X0C A;  4Y9R A;  2V31 A;  2BGJ A;  4X05 A;  3W2E A;  2HLD A;  2ZTN A;  1BMF A;  3V8V A;  4Z1M A;  1BX0 A;  2BM1 A;  5HZA A;  3AGQ A;  1ZM4 A;  1PJ6 A;  2D3N A;  1WOR A;  3MMP A;  4PC2 A;  4RDK A;  4TKO B;  3KL9 A;  5TY0 A;  3QE2 A;  3OEE A;  2CC2 A;  3CCR B;  3G6E B;  1SKQ A;  1QVG B;  1E3Z A;  4XN0 A;  5L46 A;  3NE5 B;  4OPS A;  1N05 A;  1KJZ A;  1WDT A;  1ZM3 A;  1UD4 A;  3T51 B;  3CES A;  1W0K A;  2JN9 A;  4AVZ A;  3I56 B;  1N6D A;  2I1L A;  2X6Y A;  1SM4 A;  4LBV A;  3WYA A;  1IHM A;  2C2W A;  1KK3 A;  1ZM2 A;  4QUZ A;  4RD2 A;  2F1M A;  4M0L A;  1AMO A;  3CD6 B;  4XS5 A;  2OBR A;  4HYL A;  4WWV A;  3DOR A;  3W2I A;  1UD8 A;  3ZXN A;  4RCY A;  1QFZ A;  1P4M A;  3GIR A;  4R71 A;  5B6I A;  3AGD A;  1WSV A;  3CC2 B;  1EP2 B;  3VSE A;  2RC5 A;  4P12 A;  3ISX A;  3ONU A;  3WY9 A;  1WU8 A;  3ONY A;  3CCL B;  3WNC A;  3W2F A;  4QFM A;  3CME B;  4TMW A;  4N3G A;  3AST A;  3V7A A;  2D9R A;  4RPD A;  5THX A;  3P27 A;  3WND A;  2F4N A;  2JJ1 A;  2X3U A;  2V4D A;  4Z4T A;  3SLD A;  2Q6K A;  2DOG A;  4X06 A;  1VLY A;  4HE6 A;  4XOT A;  2M5S A;  2R6H A;  2VNI A;  1DG1 G;  1NBM A;  1OHH A;  2W6I A;  3OIR A;  4P1V A;  3AVV A;  1VC1 A;  2BVN A;  3ZZ0 A;  3A3B A;  4Z4V A;  5A88 A;  3OOC A;  3G71 B;  1YIJ B;  4OPO A;  1S4M A;  4GHN A;  4RLZ A;  4XLF A;  3ZC3 A;  4L1C A;  2E1B A;  3OZW A;  3OZV A;  2GJR A;  2RC6 A;  1Y0Y A;  3ASP A;  4E0F A;  3AVU A;  2VZL A;  2OTL B;  1VQN B;  3IHA A;  4DNR B;  1N8R D;  2GQF A;  3SEJ A;  3OFN A;  4KKT A;  3W5H A;  2ZO9 B;  2V7Q A;  4JMQ A;  2ZL7 A;  4X7F A;  3DUP A;  1RQP A;  4WZK A;  1VQ5 B;  5HZB A;  1DAR A;  4X8I A;  4PC3 A;  3CCU B;  4QVA A;  1EP1 B;  1RQR A;  2WJY A;  2ZZF A;  2NPF A;  4ZCL A;  2Q6O A;  4B3X A;  3CTA A;  1N07 A;  1SBO A;  1NB0 A;  3MHP A;  4TT3 A;  2X53 S;  3ES9 A;  1BUZ A;  5H5J A;  1EFU A;  3A8J A;  1B23 P;  2X8K A;  2JJ2 A;  3GVK A;  4Y9U A;  1T6R A;  4DMG A;  2CF4 A;  3ASS A;  4ROX A;  4XN3 A;  3A8K A;  1QUE A;  4TN1 A;  1COW A;  4XKW A;  3FKS A;  4NBS A;  3GVL A;  5GV7 A;  2PE3 A;  1VJS A;  1QX4 A;  3QFC A;  1NRK A;  3W5U A;  3CCV B;  1EWY A;  1H8H A;  2ZBU A;  2J7K A;  2V7T A;  3BY2 A;  4P3Y A;  3OPO A;  3BCF A;  2GRE A;  4H9G A;  1TID B;  3WNB A;  3ZTB A;  1PJ7 A;  4XR6 A;  2VY9 A;  5A89 A;  3D3U A;  2B5O A;  1UD5 A;  2WR8 A;  3GVJ A;  3BQJ A;  4RJL A;  1W35 A;  4Z4R A;  4AE2 A;  1GR1 A;  2QMU A;  1YX2 A;  4ZGN B;  2XNJ A;  1GAQ A;  2DER A;  3B78 A;  3CW2 A;  4XLA A;  1HZE A;  4M2L A;  1E1Q A;  2BM0 A;  3G4S B;  1KZL A;  3LKL A;  1UD2 A;  2XZO A;  2QA4 B;  4RCZ A;  4XON A;  4RD0 A;  2ZXI A;  2BSA A;  1VHO A;  4XNF A;  5EUX A;  1BLI A;  1PJ5 A;  3QDQ A;  4L8K A;  5LMZ A;  4P25 A;  3SLN A;  1VQ8 B;  1UD3 A;  5H59 A;  3HAG A;  4XOR A;  1D1N A;  4K1X A;  3GQB A;  2F43 A;  2HMA A;  2XZL A;  2VBT A;  1K9M D;  3WBJ A;  3CCS B;  3B82 A;  1QVF B;  1B2R A;  2XZP A;  1A8P A;  3CP8 A;  5FNZ A;  1XB2 A;  1E3X A;  5AN9 A;  4P6Y A;  1PKV A;  1E43 A;  4DGF A;  1N6F A;  2JIZ A;  1VHE A;  3P26 A;  3VNU A;  1HF2 A;  1EFC A;  4XLC A;  5JBQ A;  3QFR A;  3CCE B;  1YJ9 B;  3MGL A;  2OBT A;  4YXW A;  2BV3 A;  4OOV A;  3B8H A;  1Q9S A;  4YEJ A;  1GO2 A;  3ZUG A;  5BSY A;  2GPJ A;  3H94 A;  1N0U A;  1GAW A;  2OYN A;  4LBW A;  1ZUN B;  3V76 A;  1QH0 A;  1V0E A;  3GK7 A;  2GK7 A;  4DK0 A;  2ZXH A;  4RD6 A;  4UZE A;  1KMH A;  4UZU A;  1VQO B;  4MYU A;  3GMF A;  3LVB A;  1OGJ A;  4JC0 A;  3JQR A;  4RM0 A;  4G7W A;  5E6T A;  1R5O A;  1OGI A;  2OTJ B;  4X7E A;  4LC0 A;  3ZIA A;  3FPK A;  1YLO A;  3PVD A;  1BQE A;  1QUF A;  1JNY A;  1VQM B;  1UD6 A;  3W2G A;  4XL9 A;  3CMA B;  3ASR A;  3CCJ B;  3G05 A;  2QTZ A;  3WBK A;  1VLO A;  1DDI A;  2Q6I A;  4YAO A;  2QEX B;  4M1K A;  4N3N A;  3OAA A;  2AHO A;  2ZL6 A;  5FO1 A;  1H4Z A;  2VNH A;  3LQ6 A;  4G1B A;  2BN4 A;  3VO1 A;  5TRD A;  3LQE A;  2X6W A;  2WZP P;  1EFT A;  2C78 A;  4GQN A;  1VQ7 B;  1WOO A;  2C5H A;  1EFR A;  3QSY A;  1GVH A;  2YWF A;  3LNN A;  4AF7 A;  2QGG A;  4F7D A;  3ZBU A;  4RD3 A;  2CRV A;  1QFY A;  3DDY A;  2CBX A;  1I18 A;  4WZE A;  4XKV A;  5FIU A;  1TUI A;  4QVJ A;  2ZZQ A;  5KW9 A;  1Q81 D;  1GJR A;  3IHB A;  3MOG A;  1JA0 A;  4XQF A;  3CRZ A;  1VQP B;  1H4X A;  2VNK A;  1H42 A;  2C5B A;  1WSR A;  4RDJ A;  1KD1 D;  1W9X A;  5EUS A;  2GJP A;  4FXU A;  4UAJ A;  1CQX A;  4NNJ A;  4OOS A;  4FWT A;  5TR9 A;  3LDF A;  5TV2 A;  1JJ2 B;  3SJZ A;  1E1R A;  4TMT A;  1XFO A;  2V7W A;  3OJW A;  1QGY A;  1IJE A;  3CPX A;  3KEW A;  3PUN A;  1EXM A;  4XMY A;  4U9U A;  1WXX A;  4B43 A;  2HDN B;  1IJF A;  1H85 A;  1I8D A;  1T5E A;  2V7U A;  2XND A;  2YWG A;  3PA2 A;  4OPV A;  4XLE A;  1FRQ A;  3BH4 A;  3ZZU A;  3CCM B;  1S72 B;  1K73 D;  2ZZE A;  4AEJ A;  1K8A D;  1U2R A;  3I1F A;  4C43 A;  3PA1 A;  5KSW B;  2E1R A;  3A1P A;  1D2E A;  1QGZ A;  4QHY A;  4MYT A;  1WTH D;  3OJX A;  4P9S A;  3FJO A;  1H4Y A;  2QN6 A;  1R5B A;  3OE7 A;  2WYR A;  4RPB A;  1OB0 A;  4Z4S A;  5GV8 A;  3Q6Q A;  3U2Q A;  3BCD A;  4Z4W A;  2ZZG A;  1KC8 D;  3EH7 A;  4DNT B;  4P3I A;  1E64 A;  2DY1 A;  1KRH A;  2GK6 A;  4TSF A;  4XD7 A;  2R9V A;  4XOP A;  3VO2 A;  2WJV A;  2OK8 A;  1ELO A;  4WZT A;  3QFS A;  5HKK A;  3LLO A;  4M53 A;  4QTP A;  3OP1 A;  3BNW A;  1YHQ B;  3R6J A;  4BPR A;  2BF4 A;  3R6K A;  1J7X A;  3ZPN A;  2WPD A;  4L8J A;  3D03 A;  4PC7 A;  5FA6 A;  1VQ9 B;  3T6O A;  1E63 A;  1DDG A;  1E79 A;  4PAB A;  5KNL A;  3AGE A;  1WOS A;  4RD4 A;  1ZM9 A;  1N06 A;  3E20 A;  1YJN B;  2DEU A;  5J3O A;  4XM3 A;  3F43 A;  3BC9 A;  2WSS A;  2W6J A;  4DK1 A;  3LO8 A;  1VF7 A;  4KKU A;  4C0S A;  3OEH A;  2B7C A;  4PAA A;  2XNC A;  3VR6 A;  3WQZ A;  4TMV A;  2F1L A;  2VYQ A;  4HE5 A;  5IK2 A;  3CC7 B;  3AVX A;  2KLN A;  1QG0 A;  3JU4 A;  3ZBT A;  1Q86 D;  3T53 B;  2ZTG A;  4B48 A;  3IH9 A;  3CMM A;  3BY1 A;  3CXC B;  4B47 A;  4ACA A;  3OIZ A;  2C77 A;  4M4S A;  4QV2 A;  4NCN A;  3IF5 A;  1XE1 A;  2LZJ A;  2DCU A;  3PEN A;  4WQM A;  1WPC A;  3Q3A A;  5IYQ A;  2XEX A;  5EMN A;  4PC6 A;  2OAS A;  4KKS A;  3CPW B;  4RDL A;  1EP3 B;  4YAW A;  2ZOA A;  3VMF A;  2KVO A;  5BSX A;  2B78 A;  5CDF A;  4G7X A;  4RD1 A;  1KK0 A;  3JQP A;  4FN5 A;  5HXB A;  1FNC A;  1G7C A;  2P3M A;  1HVX A;  4G1V A;  2PIA A;  2EFG A;  1W2B B;  4X7C A;  3DJA A;  4DQL A;  3AVY A;  3RY8 A;  2EIX A;  4Z4U A;  2Z6B D;  1G7R A;  3A3G A;  5DSZ A;  1FC7 A;  4DGH A;  4P2N A;  4ZCI A;  1KQS B;  1K32 A;  3OW2 B;  4P26 A;  3GSI A;  3AVW A;  3CP2 A;  4B3F X;  3CC4 B;  5IYW A;  5EUW A;  1KTV A;  3SJP A;  1N08 A;  3U6B A;  1H8E A;  1VQ4 B;  4LBZ A;  1IB0 A;  1M1K D;  2D3L A;  2C4T A;  2DET A;  1JA1 A;  2HCJ B;  5F4M A;  1NB9 A;  1J9Z A;  1F60 A;  1Q82 D;  1FC6 A;  2C4U A;  1SKY B;  1TIL B;  4ASU A;  4Z4Y A;  1YI2 B;  3E1Y E;  2VJI A;  1JB9 A;  1THN B;  2BGI A;  5A8A A;  4B4D A;  4LBY A;  1Y0R A;  5EUZ A;  4II2 A;  3MCA A;  3WXM A;  2VBS A;  5F4O A;  1QFJ A;  1WOP A;  1WXW A;  1FDR A;  1FRN A;  1TVC A;  1TH8 B;  3PUM A;  3ZZT A;  3Q39 A;  3U6K A;  1FNM A;  2KA5 A;  3NY7 A;  1HA3 A;  1V5V A;  3CB4 A;  2CK3 A;  4YAL A;  4Z4Z A;  2QDX A;  2CND A;  3IH8 A;  1CNF A;  2DXN A;  1W0J A;  1S0U A;  3A8I A;  1CNE A;  1BJK A;  3Q6R A;  1YIT B;  4AF6 A; 
#chains in the Genus database with same CATH homology
 1BLI A;  1OB0 A;  2XOK A;  2F1M A;  4B3G A;  4L8K A;  3BCD A;  2ZZG A;  1UD3 A;  5FL7 A;  4DNT B;  3DOR A;  3HAG A;  1UD8 A;  2GK6 A;  1V0F A;  4TSF A;  4XD7 A;  4XOR A;  3GQB A;  2F43 A;  2R9V A;  4XOP A;  2XZL A;  1BPL A;  2WJV A;  5DN6 A;  5HKK A;  3FPP A;  2XZP A;  3CP8 A;  1E3X A;  1J7X A;  1PKV A;  1E43 A;  3ZPN A;  2WPD A;  1N6F A;  2JIZ A;  4L8J A;  3D03 A;  2RRL A;  1FC9 A;  1E79 A;  4XLC A;  5KNL A;  2GJK A;  4YXW A;  2XGJ A;  4YEJ A;  4XM3 A;  1FX0 A;  3BC9 A;  2WSS A;  3H94 A;  2W6J A;  4DK1 A;  2JJ1 A;  2V4D A;  1VF7 A;  4KKU A;  1V0E A;  3OEH A;  1VLY A;  4P22 A;  4XOT A;  2M5S A;  3VR6 A;  2GK7 A;  3WQZ A;  4DK0 A;  2ZXH A;  5IK2 A;  4XNF A;  1KMH A;  1NBM A;  1OHH A;  2W6I A;  3JU4 A;  4UZU A;  3T53 B;  2X85 A;  2ZTG A;  2DXL A;  3CMM A;  3GMF A;  4JC0 A;  4II3 A;  3A3B A;  3OOC A;  4G7W A;  3A35 A;  2JDI A;  2LZJ A;  4YEL A;  1WPC A;  4GHN A;  4XLF A;  3ZIA A;  1K28 D;  4L1C A;  4KKS A;  2E1B A;  2GJR A;  4E0F A;  1UD6 A;  4DNR B;  4XL9 A;  3GHF A;  2ZOA A;  3OFN A;  3G05 A;  2KVO A;  3OW7 A;  4KKT A;  1FCF A;  2ZO9 B;  5CDF A;  2V7Q A;  4G7X A;  4JMQ A;  3OAA A;  3DUP A;  1MAB A;  1HVX A;  4HIZ A;  2QE7 A;  2X6X A;  2X6W A;  2WZP P;  2DIE A;  2WJY A;  2ZZF A;  4GQN A;  3DJA A;  1EFR A;  4G6I A;  3LNN A;  1FC7 A;  2Z6B D;  3A3G A;  4TT3 A;  3T56 B;  2X53 S;  2VJJ A;  1K32 A;  2X8K A;  3DDY A;  1I18 A;  4XKV A;  2JJ2 A;  3GVK A;  2ZZQ A;  3K50 A;  3CP2 A;  4XN3 A;  4B3F X;  1N6E A;  4XLH A;  3MOG A;  1COW A;  1H8E A;  4XQF A;  4XKW A;  3FKS A;  2D3L A;  3GVL A;  1W9X A;  1WP6 A;  1VJS A;  2GJP A;  4FXU A;  2V31 A;  1NRK A;  4NNJ A;  2HLD A;  1H8H A;  2ZTN A;  1BMF A;  1FC6 A;  4Z1M A;  1SKY B;  3OPO A;  4ASU A;  3BCF A;  2VJI A;  1E1R A;  2D3N A;  3KEW A;  4XR6 A;  4XMY A;  4TKO B;  1UD5 A;  3OEE A;  4II2 A;  3GVJ A;  1I8D A;  1T5E A;  1E3Z A;  4XN0 A;  2XND A;  3NE5 B;  4XLE A;  4AE2 A;  3BH4 A;  3T51 B;  1UD4 A;  2ZZE A;  3CES A;  4AEJ A;  2CK3 A;  4XLA A;  1W0K A;  4AVZ A;  1HZE A;  1E1Q A;  2X6Y A;  1N6D A;  1KZL A;  1UD2 A;  2DXN A;  2XZO A;  1W0J A;  4XON A;  2ZXI A;  1WTH D;  3OE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...