1BPLA

Glycosyltransferase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
179
Chain Sequence
LNGTLMQYFEWYMPNDGQHWKRLQNDSAYLAEHGITAVWIPPAYKGTSQADVGYGAYDLYDLGEFHQKGTVRTKYGTKGELQSAIKSLHSRDINVYGDVVINHKGGADATEDVTAVEVDPADRNRVISGEHLIKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKLNRIYKFQGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of calcium-depleted Bacillus licheniformis alpha-amylase at 2.2 A resolution.
pubmed doi rcsb
molecule tags Glycosyltransferase
molecule keywords ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
total genus 53
structure length 179
sequence length 179
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1bplA02
3.30.750.90 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1bplA01
1HVXA 3BH4A 2D3LA 2DIEA 3BCFA 1W9XA 2GJPA 1UD5A 2GJRA 3BCDA 1VJSA 4UZUA 1UD8A 1UD3A 1E3XA 3BC9A 1OB0A 1WPCA 1WP6A 1UD2A 1E3ZA 1UD6A 1BLIA 1BPLA 2D3NA 1UD4A 1E43A
chains in the Genus database with same CATH superfamily
4B48A 1HVXA 1GVHA 4WZLA 2WJVA 4ZCLA 1T6RA 1BUZA 3VSEA 4P25A 2BM0A 2RC6A 4C0SA 4ZCMA 2XNCA 3W5HA 4P9SA 4J0QA 2CC2A 1QUEA 2V31A 1JJ2B 2KA5A 3VO2A 1TVCA 2X6YA 2C77A 2J7KA 2F1LA 4NBSA 1VQPB 3OEHA 3U2QA 4OPVA 5EMNA 4II3A 4F7DA 4YALA 1RQPA 3OFNA 4XLFA 3C0KA 3D26A 4BPRA 1V5VA 2ZBVA 4PABA 5FNZA 1FNMA 2AHOA 1YHQB 3VNUA 5HZBA 2OBRA 1N8RD 4GHNA 4X7CA 3WXMA 4R71A 1QGZA 2C78A 2WR8A 3AGEA 4P6YA 4P3IA 3CW2A 4UZFA 2BM1A 4YAUA 1WXXA 1PJ7A 3BC9A 2DY1A 4JMQA 4Z4RA 1K28D 1H42A 1THNB 1H85A 3JQQA 2E1RA 5FO1A 3G4SB 5THXA 3ASTA 3CPWB 4X0CA 4QHYA 3IH9A 2WZNA 4PC2A 1D2EA 5EUZA 2E1BA 5TRDA 4B44A 2VY9A 3IHBA 1OHHA 3AVXA 2D74A 2JIZA 4UZEA 4XMYA 1TIDB 1KTVA 4XN3A 4RDJA 3A8KA 3GSIA 2W6IA 3JU4A 1QGYA 3OOCA 3W2FA 4ZV4A 5J3OA 4E0FA 5IYWA 4RCZA 1H8HA 4FWTA 3PUNA 3FJOA 2ZZQA 4XQFA 5BSXA 1QX4A 2WYRA 4G7XA 4HE6A 1NJID 1E64A 1VQ5B 1N6EA 2OASA 3PA2A 4QFMA 2JDIA 4DMGA 3B82A 4LBWA 4X8IA 2EIXA 2C5HA 2GJKA 2OBSA 4B3GA 1BPLA 1EFUA 4Z4YA 3CPXA 3W2GA 1VF7A 5F4JA 3WNCA 1S72B 3AVVA 2YWEA 4XS5A 1BX1A 4YAOA 2XGJA 3B78A 3SKBA 4Z4VA 2QDXA 3LVBA 4AC9A 3DORA 1RQRA 1K9MD 1WSRA 1KD1D 5IYQA 2VNIA 5L46A 3I56B 2CBXA 3ZZUA 1KK0A 1XQBA 1UD3A 2F4NA 3GIRA 4XLCA 3OEEA 3G71B 1SKQA 1W0JA 1WP6A 4B3XA 3ASRA 4DNRB 4KKUA 4GQNA 4LC0A 2PMDA 4M2LA 1BLIA 2KVOA 4XONA 2OTJB 3I55B 4XD7A 2DXNA 1SKYB 4C43A 1GR1A 3DJAA 3ZXNA 3ZC3A 2QN6A 4JC0A 2V7VA 3ZZTA 1E62A 2VJIA 3B8HA 3GVJA 1UMKA 4X7FA 1FC7A 4XM3A 1TILB 1KC8D 2DERA 2BF4A 4OOXA 1UD5A 3AVYA 4ACAA 1DDIA 1PJ5A 1YX2A 2ZL6A 4OPSA 3ONUA 5TV2A 1R5NA 1W0KA 2GREA 4P6VF 4WZEA 1UD8A 3MCAA 1YI2B 2GK6A 1OB5A 3R6JA 2ZXIA 4YEJA 3WNBA 1N6FA 4G5GA 2VBUA 1FX0A 3SEJA 4RPBA 3CC7B 2JJ2A 1ZM3A 3W2EA 1Y0YA 1EXMA 4KKTA 4RPDA 5FL7A 2BPOA 4X07A 4B43A 3T53B 1NB0A 3P27A 1E43A 1M90D 1N08A 4QVAA 1NBMA 1EFRA 1KK2A 1VHEA 4WQMA 1VQ4B 2ZZGA 2F1MA 3LO8A 2XZLA 1QH0A 3BCFA 2WSSA 4RD3A 4B3FX 2XEXA 2ZO9B 1IHMA 2VBTA 3FPKA 2DOGA 2V7QA 3CXCB 4G1BA 1FCFA 5HZAA 3GMFA 1KK3A 4AF6A 4RLZA 1KMHA 2CW5A 1KRHA 1OB0A 3AVWA 1XFOA 2BGJA 2B7BA 3CP8A 4LBYA 4UAJA 3VO1A 3W5VA 4ACBA 4B4DA 4AF7A 1YJNB 5IYPA 3D3UA 1TLLA 5EUWA 2OTLB 2CNDA 4XNFA 3Q3AA 1H4ZA 1Q9SA 3I1FA 3EH7A 5A8AA 2ZZFA 3SJZA 4DK0A 3F43A 1E63A 3MMPA 1H8EA 1MRZA 3OZUA 2V7WA 3CCSB 3T6OA 2VNJA 3BCDA 1S0UA 4XLHA 5EUSA 3CCMB 3LDFA 3QE2A 3A3BA 3QFCA 1GJRA 1HA3A 5KW9A 3WNDA 2BMWA 1S4MA 2VJJA 2WJYA 4B47A 3CMAB 4X05A 1M1KD 2D9RA 2YWGA 4P2NA 1EFTA 1VHOA 1V0FA 2QTZA 3RY8A 1KQSB 3A35A 1VQNB 3GHFA 3KEWA 1FDRA 1N06A 4AEJA 1QGAA 1PKVA 3A8IA 2HLDA 3QDQA 3WBKA 4TSFA 2X6XA 3OJWA 1WOSA 2DIEA 2BV3A 4P1VA 2XOKA 1ELOA 2CRVA 1I8DA 1QG0A 2ZBUA 3FPPA 2OBTA 3BY1A 2BSAA 3OZVA 4UZUA 4HE5A 1YIJB 4XOTA 3CCVB 4FXUA 3QSYA 2C4UA 5AN9A 3VR6A 2Z6BD 1D1NA 4RDLA 1E1RA 4DQKA 1UD6A 3CCJB 1QFYA 2QGGA 1FC9A 2X8KA 2B7CA 4II2A 1IB0A 3CC4B 1I18A 2NV4A 1R5OA 4YELA 2P3MA 4LBZA 3MOGA 2HCJB 1N07A 1J9ZA 2ZZEA 1CNFA 4KKSA 5A89A 3W5UA 1U2RA 3V76A 1FRNA 2GPJA 4M53A 2VBSA 1VQMB 1D8TA 2QA4B 3LQEA 3PVDA 3ZBTA 1H4XA 1P4MA 4CQJA 3ZUGA 1Q86D 2X0KA 2XNJA 1E3XA 5E6TA 2RRLA 2QEXB 2R9VA 2BVNA 4ASUA 4DNTB 1E3ZA 3FKSA 4QUZA 3AVUA 3LKLA 2OYNA 4P26A 5DN6A 2R6HA 1VLYA 3BQJA 5IK2A 1VLOA 4XOPA 1UD4A 1W2BB 3SLNA 2F43A 2VNHA 5KSWB 1BQEA 3KL9A 4RCYA 2BN4A 1WTHD 4XL9A 2LZJA 4NNJA 3CCUB 4YAWA 4IW3B 2C4TA 1SM4A 2B5OA 3PUMA 1TTTA 1K32A 2AS0A 5EUUA 4Z4SA 3CCEB 4P22A 3WBJA 3GK7A 1IJFA 1NDHA 4Z4ZA 5JBQA 4AVZA 3JQRA 4ZGNB 3U6KA 2GQFA 5J35A 3MGLA 4NCNA 5GV7A 4Z4TA 1OGJA 3A3GA 2HDNB 5IYNA 4Z4UA 2X3UA 2EFGA 3E20A 4MYTA 1T5EA 4DQLA 2GK7A 3NY7A 1WDTA 4PAAA 1VQKB 3ASQA 1E1QA 3G6EB 1FNDA 3CCQB 3U6BA 3OZWA 4ZGQB 5BSYA 3Q38A 2YWHA 1W9XA 4Y9RA 1WXWA 4YXWA 3IF5A 2X53S 2WZPP 1XB2A 2RC5A 3DUPA 1NRKA 5HXBA 1YLOA 3T51B 4PGOA 2Q6IA 2PE3A 2VZLA 2ZITA 3OJXA 4DGHA 1ZUNB 4L1CA 1B23P 4AE2A 1FNCA 1TUIA 4EH1A 3Q6QA 4X7DA 5A88A 3V8VA 3CB4A 4M1KA 1DDGA 4RM0A 4RDKA 3LLOA 1JB9A 4XORA 4OOSA 2Q6LA 1T6ZA 1KJZA 4ZCIA 1Y0RA 2CF4A 3J81k 3CMEB 3MHPA 1F20A 4TKOB 3WYAA 1QFJA 2V7UA 4G1VA 3A8JA 2FVGA 5F4OA 1ZM4A 4PC1A 3VMFA 2GJPA 1BX0A 3IH8A 1WOPA 4M0LA 5CDFA 1H4YA 1G7TA 1JNYA 2C2WA 1J7XA 1T6YA 1KK1A 2WPDA 4RJLA 2ZTNA 1VC1A 1WSVA 1XE1A 4N3GA 4OOVA 1Q81D 4HYLA 2OK7A 1Q82D 1N6DA 4N3NA 1AMOA 1MABA 3CD6B 1UD2A 4P3YA 2VYQA 1JA0A 2XZPA 2V7XA 3LNNA 4WZKA 1HF2A 3OIRA 1I7PA 2HMAA 2JJ1A 4YAFA 1T6XA 1K73D 1IJEA 4TMXA 2QTLA 1TH8B 3PENA 3D03A 1VQ8B 4P12A 3BY2A 1N0VC 2BGIA 3ZZ0A 4TMVA 1K8AD 3ASPA 1BJKA 4X7EA 2QMUA 3ONYA 4DGFA 1OB2A 1F60A 1AUZA 1CQXA 4YHBA 4U9UA 1SBOA 3R6KA 5LMZA 2KLNA 2ZTGA 4QV2A 3CC2B 1FNBA 1EP3B 3ZPNA 3ZBUA 1QVFB 2ZL5A 3ZTBA 2ZL7A 3OP1A 4L8KA 3CTAA 5FO0A 1QVGB 4G6IA 3Q6RA 1VQ6B 2DETA 1QUFA 2DYIA 5EUXA 1JA1A 5GV8A 4XLEA 2D3NA 1COWA 4XKVA 3JQPA 3BH4A 4Q7JB 1FRQA 3CMMA 3SJPA 3T56B 4RD0A 3CCLB 1EP1B 1N0UA 2XZOA 4WWVA 1VQLB 3WY9A 2GJRA 5KNLA 4PC3A 1VJSA 3SLDA 4PC7A 5FIUA 3GVKA 2X6WA 4Z1MA 2VNKA 4RD1A 1NB9A 3W2HA 2M5SA 3OPOA 1DARA 4M4SA 4RD2A 3AGQA 1W87A 5TR9A 4TMZA 1CNEA 4K1XA 3CESA 5DS0A 3ISXA 1W35A 2C5BA 5DSZA 1YITB 5HKKA 4MYUA 4HIZA 3QFRA 1BMFA 3GQBA 4FK8A 2W6JA 4QVJA 5IYRA 4PC6A 1VQ7B 5EZBA 4Y7CA 1N05A 2CWWA 1Q7YD 2FX3A 1B2RA 1E79A 3E1YE 4XN0A 2JN9A 2I1LA 1ZM9A 3PA1A 4TT3A 3V97A 3V7AA 2Q6OA 1G7CA 3CRZA 4X06A 3OIZA 3GVLA 2V7TA 3DDYA 4ROXA 5TY0A 3W2IA 4OP7A 1AIPA 1EP2B 2X85A 3OE7A 3OAAA 3ZIAA 2YWFA 1EFCA 1WORA 3P26A 1YJ9B 3AGPA 4QTPA 1ZM2A 4L8JA 2B78A 3OW7A 2VBVA 1GAQA 3HAGA 2ZOAA 3CCRB 1G7SA 4G7WA 3G05A 4DK1A 1HZEA 3WQZA 2NPFA 1WU8A 1A8PA 3Q39A 3ES9A 3VNVA 1YJWB 2CK3A 1R5BA 3LQ6A 4OPOA 2PLFA 2Q6KA 4XLAA 4XR6A 1G7RA 5H59A 1QFZA 2D3LA 3BNWA 1WOOA 4H9GA 4TN1A 4WZTA 3H94A 1GO2A 2DEUA 2XNDA 1FC6A 5FA6A 2DCUA 3OW2B 3QFSA 1VQ9B 2DXLA 1OGIA 3CP2A 4TMWA 3QFTA 1VQOB 3ASSA 2PIAA 4FN5A 3IHAA 2V4DA 1EWYA 1WPCA 3H9NA 1GAWA 5B6IA 3K50A 3NE5B 4Z4WA 1W34A 4Y9UA 3A1PA 3AVTA 1PJ6A 2ZXHA 4RD6A 4XKWA 1KZLA 3OKXA 4LBVA 2OK8A 1DG1G 4TMTA 4RD4A 5F4MA 2QE7A 3AGDA 5H5JA 1V0EA
chains in the Genus database with same CATH topology
1HVXA 2VJIA 2ZZEA 1FC7A 3GVJA 4KKSA 2WJVA 4XM3A 1UD5A 2V31A 1W0KA 2ZTGA 1UD8A 3ZPNA 2GK6A 1E3XA 2ZXIA 4YEJA 1N6FA 2RRLA 2X6YA 2R9VA 4L8KA 1FX0A 4ASUA 3OEHA 4G6IA 4DNTB 1E3ZA 2JJ2A 3FKSA 4II3A 3OFNA 4XLFA 5DN6A 1VLYA 4KKTA 5IK2A 4XLEA 4XOPA 2D3NA 1UD4A 5FL7A 1COWA 3T53B 4XKVA 1E43A 2F43A 3BH4A 3CMMA 1NBMA 1EFRA 4XL9A 1WTHD 3T56B 2XZLA 2ZZGA 2F1MA 2LZJA 3BCFA 2WSSA 4NNJA 4B3FX 2XZOA 4GHNA 2GJRA 5KNLA 2ZO9B 1VJSA 1K32A 3GVKA 2X6WA 4Z1MA 2V7QA 3GMFA 4P22A 2M5SA 1FCFA 3OPOA 4JC0A 3BC9A 1KMHA 1OB0A 4AVZA 4JMQA 1K28D 3CESA 3CP8A 5HKKA 3A3GA 4HIZA 1BMFA 3GQBA 2W6JA 4XNFA 1T5EA 2E1BA 2GK7A 2ZZFA 1E79A 1OHHA 4XN0A 4DK0A 1H8EA 1E1QA 2JIZA 4XMYA 4TT3A 4XN3A 1W9XA 4YXWA 2X53S 3BCDA 3DDYA 3GVLA 2WZPP 3DUPA 1NRKA 3T51B 2X85A 3OE7A 3ZIAA 3OAAA 2W6IA 3JU4A 3OOCA 4XLHA 3A3BA 4E0FA 1H8HA 4L8JA 4L1CA 3OW7A 4AE2A 2ZZQA 3HAGA 4XQFA 2ZOAA 2VJJA 2WJYA 4G7XA 4G7WA 3G05A 4DK1A 1HZEA 1N6EA 3GHFA 1V0FA 2JDIA 3WQZA 3A35A 4XORA 3KEWA 2CK3A 2GJKA 4B3GA 1BPLA 4AEJA 1PKVA 2HLDA 1VF7A 4XLAA 4XR6A 4TSFA 2X6XA 4TKOB 2XGJA 2D3LA 2DIEA 3DORA 3H94A 2XOKA 2XNDA 1FC6A 1I8DA 2GJPA 3FPPA 5CDFA 2DXLA 1J7XA 4UZUA 2WPDA 3CP2A 4XOTA 2ZTNA 4FXUA 1UD3A 4XLCA 3OEEA 2V4DA 1W0JA 3VR6A 1WPCA 1WP6A 1N6DA 1MABA 3K50A 1UD2A 2Z6BD 3NE5B 4DNRB 4KKUA 1E1RA 1UD6A 4GQNA 2ZXHA 4XKWA 2XZPA 1KZLA 1BLIA 2KVOA 3LNNA 4XONA 1FC9A 2JJ1A 2X8KA 4II2A 4XD7A 2DXNA 1SKYB 1I18A 3DJAA 2QE7A 3D03A 4YELA 3MOGA 1V0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HVX A;  3BH4 A;  2D3L A;  2DIE A;  3BCF A;  1W9X A;  2GJP A;  1UD5 A;  2GJR A;  3BCD A;  1VJS A;  4UZU A;  1UD8 A;  1UD3 A;  1E3X A;  3BC9 A;  1OB0 A;  1WPC A;  1WP6 A;  1UD2 A;  1E3Z A;  1UD6 A;  1BLI A;  1BPL A;  2D3N A;  1UD4 A;  1E43 A; 
#chains in the Genus database with same CATH topology
 4B48 A;  1HVX A;  1GVH A;  4WZL A;  2WJV A;  4ZCL A;  1T6R A;  1BUZ A;  3VSE A;  4P25 A;  2BM0 A;  2RC6 A;  4C0S A;  4ZCM A;  2XNC A;  3W5H A;  4P9S A;  4J0Q A;  2CC2 A;  1QUE A;  2V31 A;  1JJ2 B;  2KA5 A;  3VO2 A;  1TVC A;  2X6Y A;  2C77 A;  2J7K A;  2F1L A;  4NBS A;  1VQP B;  3OEH A;  3U2Q A;  4OPV A;  5EMN A;  4II3 A;  4F7D A;  4YAL A;  1RQP A;  3OFN A;  4XLF A;  3C0K A;  3D26 A;  4BPR A;  1V5V A;  2ZBV A;  4PAB A;  5FNZ A;  1FNM A;  2AHO A;  1YHQ B;  3VNU A;  5HZB A;  2OBR A;  1N8R D;  4GHN A;  4X7C A;  3WXM A;  4R71 A;  1QGZ A;  2C78 A;  2WR8 A;  3AGE A;  4P6Y A;  4P3I A;  3CW2 A;  4UZF A;  2BM1 A;  4YAU A;  1WXX A;  1PJ7 A;  3BC9 A;  2DY1 A;  4JMQ A;  4Z4R A;  1K28 D;  1H42 A;  1THN B;  1H85 A;  3JQQ A;  2E1R A;  5FO1 A;  3G4S B;  5THX A;  3AST A;  3CPW B;  4X0C A;  4QHY A;  3IH9 A;  2WZN A;  4PC2 A;  1D2E A;  5EUZ A;  2E1B A;  5TRD A;  4B44 A;  2VY9 A;  3IHB A;  1OHH A;  3AVX A;  2D74 A;  2JIZ A;  4UZE A;  4XMY A;  1TID B;  1KTV A;  4XN3 A;  4RDJ A;  3A8K A;  3GSI A;  2W6I A;  3JU4 A;  1QGY A;  3OOC A;  3W2F A;  4ZV4 A;  5J3O A;  4E0F A;  5IYW A;  4RCZ A;  1H8H A;  4FWT A;  3PUN A;  3FJO A;  2ZZQ A;  4XQF A;  5BSX A;  1QX4 A;  2WYR A;  4G7X A;  4HE6 A;  1NJI D;  1E64 A;  1VQ5 B;  1N6E A;  2OAS A;  3PA2 A;  4QFM A;  2JDI A;  4DMG A;  3B82 A;  4LBW A;  4X8I A;  2EIX A;  2C5H A;  2GJK A;  2OBS A;  4B3G A;  1BPL A;  1EFU A;  4Z4Y A;  3CPX A;  3W2G A;  1VF7 A;  5F4J A;  3WNC A;  1S72 B;  3AVV A;  2YWE A;  4XS5 A;  1BX1 A;  4YAO A;  2XGJ A;  3B78 A;  3SKB A;  4Z4V A;  2QDX A;  3LVB A;  4AC9 A;  3DOR A;  1RQR A;  1K9M D;  1WSR A;  1KD1 D;  5IYQ A;  2VNI A;  5L46 A;  3I56 B;  2CBX A;  3ZZU A;  1KK0 A;  1XQB A;  1UD3 A;  2F4N A;  3GIR A;  4XLC A;  3OEE A;  3G71 B;  1SKQ A;  1W0J A;  1WP6 A;  4B3X A;  3ASR A;  4DNR B;  4KKU A;  4GQN A;  4LC0 A;  2PMD A;  4M2L A;  1BLI A;  2KVO A;  4XON A;  2OTJ B;  3I55 B;  4XD7 A;  2DXN A;  1SKY B;  4C43 A;  1GR1 A;  3DJA A;  3ZXN A;  3ZC3 A;  2QN6 A;  4JC0 A;  2V7V A;  3ZZT A;  1E62 A;  2VJI A;  3B8H A;  3GVJ A;  1UMK A;  4X7F A;  1FC7 A;  4XM3 A;  1TIL B;  1KC8 D;  2DER A;  2BF4 A;  4OOX A;  1UD5 A;  3AVY A;  4ACA A;  1DDI A;  1PJ5 A;  1YX2 A;  2ZL6 A;  4OPS A;  3ONU A;  5TV2 A;  1R5N A;  1W0K A;  2GRE A;  4P6V F;  4WZE A;  1UD8 A;  3MCA A;  1YI2 B;  2GK6 A;  1OB5 A;  3R6J A;  2ZXI A;  4YEJ A;  3WNB A;  1N6F A;  4G5G A;  2VBU A;  1FX0 A;  3SEJ A;  4RPB A;  3CC7 B;  2JJ2 A;  1ZM3 A;  3W2E A;  1Y0Y A;  1EXM A;  4KKT A;  4RPD A;  5FL7 A;  2BPO A;  4X07 A;  4B43 A;  3T53 B;  1NB0 A;  3P27 A;  1E43 A;  1M90 D;  1N08 A;  4QVA A;  1NBM A;  1EFR A;  1KK2 A;  1VHE A;  4WQM A;  1VQ4 B;  2ZZG A;  2F1M A;  3LO8 A;  2XZL A;  1QH0 A;  3BCF A;  2WSS A;  4RD3 A;  4B3F X;  2XEX A;  2ZO9 B;  1IHM A;  2VBT A;  3FPK A;  2DOG A;  2V7Q A;  3CXC B;  4G1B A;  1FCF A;  5HZA A;  3GMF A;  1KK3 A;  4AF6 A;  4RLZ A;  1KMH A;  2CW5 A;  1KRH A;  1OB0 A;  3AVW A;  1XFO A;  2BGJ A;  2B7B A;  3CP8 A;  4LBY A;  4UAJ A;  3VO1 A;  3W5V A;  4ACB A;  4B4D A;  4AF7 A;  1YJN B;  5IYP A;  3D3U A;  1TLL A;  5EUW A;  2OTL B;  2CND A;  4XNF A;  3Q3A A;  1H4Z A;  1Q9S A;  3I1F A;  3EH7 A;  5A8A A;  2ZZF A;  3SJZ A;  4DK0 A;  3F43 A;  1E63 A;  3MMP A;  1H8E A;  1MRZ A;  3OZU A;  2V7W A;  3CCS B;  3T6O A;  2VNJ A;  3BCD A;  1S0U A;  4XLH A;  5EUS A;  3CCM B;  3LDF A;  3QE2 A;  3A3B A;  3QFC A;  1GJR A;  1HA3 A;  5KW9 A;  3WND A;  2BMW A;  1S4M A;  2VJJ A;  2WJY A;  4B47 A;  3CMA B;  4X05 A;  1M1K D;  2D9R A;  2YWG A;  4P2N A;  1EFT A;  1VHO A;  1V0F A;  2QTZ A;  3RY8 A;  1KQS B;  3A35 A;  1VQN B;  3GHF A;  3KEW A;  1FDR A;  1N06 A;  4AEJ A;  1QGA A;  1PKV A;  3A8I A;  2HLD A;  3QDQ A;  3WBK A;  4TSF A;  2X6X A;  3OJW A;  1WOS A;  2DIE A;  2BV3 A;  4P1V A;  2XOK A;  1ELO A;  2CRV A;  1I8D A;  1QG0 A;  2ZBU A;  3FPP A;  2OBT A;  3BY1 A;  2BSA A;  3OZV A;  4UZU A;  4HE5 A;  1YIJ B;  4XOT A;  3CCV B;  4FXU A;  3QSY A;  2C4U A;  5AN9 A;  3VR6 A;  2Z6B D;  1D1N A;  4RDL A;  1E1R A;  4DQK A;  1UD6 A;  3CCJ B;  1QFY A;  2QGG A;  1FC9 A;  2X8K A;  2B7C A;  4II2 A;  1IB0 A;  3CC4 B;  1I18 A;  2NV4 A;  1R5O A;  4YEL A;  2P3M A;  4LBZ A;  3MOG A;  2HCJ B;  1N07 A;  1J9Z A;  2ZZE A;  1CNF A;  4KKS A;  5A89 A;  3W5U A;  1U2R A;  3V76 A;  1FRN A;  2GPJ A;  4M53 A;  2VBS A;  1VQM B;  1D8T A;  2QA4 B;  3LQE A;  3PVD A;  3ZBT A;  1H4X A;  1P4M A;  4CQJ A;  3ZUG A;  1Q86 D;  2X0K A;  2XNJ A;  1E3X A;  5E6T A;  2RRL A;  2QEX B;  2R9V A;  2BVN A;  4ASU A;  4DNT B;  1E3Z A;  3FKS A;  4QUZ A;  3AVU A;  3LKL A;  2OYN A;  4P26 A;  5DN6 A;  2R6H A;  1VLY A;  3BQJ A;  5IK2 A;  1VLO A;  4XOP A;  1UD4 A;  1W2B B;  3SLN A;  2F43 A;  2VNH A;  5KSW B;  1BQE A;  3KL9 A;  4RCY A;  2BN4 A;  1WTH D;  4XL9 A;  2LZJ A;  4NNJ A;  3CCU B;  4YAW A;  4IW3 B;  2C4T A;  1SM4 A;  2B5O A;  3PUM A;  1TTT A;  1K32 A;  2AS0 A;  5EUU A;  4Z4S A;  3CCE B;  4P22 A;  3WBJ A;  3GK7 A;  1IJF A;  1NDH A;  4Z4Z A;  5JBQ A;  4AVZ A;  3JQR A;  4ZGN B;  3U6K A;  2GQF A;  5J35 A;  3MGL A;  4NCN A;  5GV7 A;  4Z4T A;  1OGJ A;  3A3G A;  2HDN B;  5IYN A;  4Z4U A;  2X3U A;  2EFG A;  3E20 A;  4MYT A;  1T5E A;  4DQL A;  2GK7 A;  3NY7 A;  1WDT A;  4PAA A;  1VQK B;  3ASQ A;  1E1Q A;  3G6E B;  1FND A;  3CCQ B;  3U6B A;  3OZW A;  4ZGQ B;  5BSY A;  3Q38 A;  2YWH A;  1W9X A;  4Y9R A;  1WXW A;  4YXW A;  3IF5 A;  2X53 S;  2WZP P;  1XB2 A;  2RC5 A;  3DUP A;  1NRK A;  5HXB A;  1YLO A;  3T51 B;  4PGO A;  2Q6I A;  2PE3 A;  2VZL A;  2ZIT A;  3OJX A;  4DGH A;  1ZUN B;  4L1C A;  1B23 P;  4AE2 A;  1FNC A;  1TUI A;  4EH1 A;  3Q6Q A;  4X7D A;  5A88 A;  3V8V A;  3CB4 A;  4M1K A;  1DDG A;  4RM0 A;  4RDK A;  3LLO A;  1JB9 A;  4XOR A;  4OOS A;  2Q6L A;  1T6Z A;  1KJZ A;  4ZCI A;  1Y0R A;  2CF4 A;  3J81 k;  3CME B;  3MHP A;  1F20 A;  4TKO B;  3WYA A;  1QFJ A;  2V7U A;  4G1V A;  3A8J A;  2FVG A;  5F4O A;  1ZM4 A;  4PC1 A;  3VMF A;  2GJP A;  1BX0 A;  3IH8 A;  1WOP A;  4M0L A;  5CDF A;  1H4Y A;  1G7T A;  1JNY A;  2C2W A;  1J7X A;  1T6Y A;  1KK1 A;  2WPD A;  4RJL A;  2ZTN A;  1VC1 A;  1WSV A;  1XE1 A;  4N3G A;  4OOV A;  1Q81 D;  4HYL A;  2OK7 A;  1Q82 D;  1N6D A;  4N3N A;  1AMO A;  1MAB A;  3CD6 B;  1UD2 A;  4P3Y A;  2VYQ A;  1JA0 A;  2XZP A;  2V7X A;  3LNN A;  4WZK A;  1HF2 A;  3OIR A;  1I7P A;  2HMA A;  2JJ1 A;  4YAF A;  1T6X A;  1K73 D;  1IJE A;  4TMX A;  2QTL A;  1TH8 B;  3PEN A;  3D03 A;  1VQ8 B;  4P12 A;  3BY2 A;  1N0V C;  2BGI A;  3ZZ0 A;  4TMV A;  1K8A D;  3ASP A;  1BJK A;  4X7E A;  2QMU A;  3ONY A;  4DGF A;  1OB2 A;  1F60 A;  1AUZ A;  1CQX A;  4YHB A;  4U9U A;  1SBO A;  3R6K A;  5LMZ A;  2KLN A;  2ZTG A;  4QV2 A;  3CC2 B;  1FNB A;  1EP3 B;  3ZPN A;  3ZBU A;  1QVF B;  2ZL5 A;  3ZTB A;  2ZL7 A;  3OP1 A;  4L8K A;  3CTA A;  5FO0 A;  1QVG B;  4G6I A;  3Q6R A;  1VQ6 B;  2DET A;  1QUF A;  2DYI A;  5EUX A;  1JA1 A;  5GV8 A;  4XLE A;  2D3N A;  1COW A;  4XKV A;  3JQP A;  3BH4 A;  4Q7J B;  1FRQ A;  3CMM A;  3SJP A;  3T56 B;  4RD0 A;  3CCL B;  1EP1 B;  1N0U A;  2XZO A;  4WWV A;  1VQL B;  3WY9 A;  2GJR A;  5KNL A;  4PC3 A;  1VJS A;  3SLD A;  4PC7 A;  5FIU A;  3GVK A;  2X6W A;  4Z1M A;  2VNK A;  4RD1 A;  1NB9 A;  3W2H A;  2M5S A;  3OPO A;  1DAR A;  4M4S A;  4RD2 A;  3AGQ A;  1W87 A;  5TR9 A;  4TMZ A;  1CNE A;  4K1X A;  3CES A;  5DS0 A;  3ISX A;  1W35 A;  2C5B A;  5DSZ A;  1YIT B;  5HKK A;  4MYU A;  4HIZ A;  3QFR A;  1BMF A;  3GQB A;  4FK8 A;  2W6J A;  4QVJ A;  5IYR A;  4PC6 A;  1VQ7 B;  5EZB A;  4Y7C A;  1N05 A;  2CWW A;  1Q7Y D;  2FX3 A;  1B2R A;  1E79 A;  3E1Y E;  4XN0 A;  2JN9 A;  2I1L A;  1ZM9 A;  3PA1 A;  4TT3 A;  3V97 A;  3V7A A;  2Q6O A;  1G7C A;  3CRZ A;  4X06 A;  3OIZ A;  3GVL A;  2V7T A;  3DDY A;  4ROX A;  5TY0 A;  3W2I A;  4OP7 A;  1AIP A;  1EP2 B;  2X85 A;  3OE7 A;  3OAA A;  3ZIA A;  2YWF A;  1EFC A;  1WOR A;  3P26 A;  1YJ9 B;  3AGP A;  4QTP A;  1ZM2 A;  4L8J A;  2B78 A;  3OW7 A;  2VBV A;  1GAQ A;  3HAG A;  2ZOA A;  3CCR B;  1G7S A;  4G7W A;  3G05 A;  4DK1 A;  1HZE A;  3WQZ A;  2NPF A;  1WU8 A;  1A8P A;  3Q39 A;  3ES9 A;  3VNV A;  1YJW B;  2CK3 A;  1R5B A;  3LQ6 A;  4OPO A;  2PLF A;  2Q6K A;  4XLA A;  4XR6 A;  1G7R A;  5H59 A;  1QFZ A;  2D3L A;  3BNW A;  1WOO A;  4H9G A;  4TN1 A;  4WZT A;  3H94 A;  1GO2 A;  2DEU A;  2XND A;  1FC6 A;  5FA6 A;  2DCU A;  3OW2 B;  3QFS A;  1VQ9 B;  2DXL A;  1OGI A;  3CP2 A;  4TMW A;  3QFT A;  1VQO B;  3ASS A;  2PIA A;  4FN5 A;  3IHA A;  2V4D A;  1EWY A;  1WPC A;  3H9N A;  1GAW A;  5B6I A;  3K50 A;  3NE5 B;  4Z4W A;  1W34 A;  4Y9U A;  3A1P A;  3AVT A;  1PJ6 A;  2ZXH A;  4RD6 A;  4XKW A;  1KZL A;  3OKX A;  4LBV A;  2OK8 A;  1DG1 G;  4TMT A;  4RD4 A;  5F4M A;  2QE7 A;  3AGD A;  5H5J A;  1V0E A; 
#chains in the Genus database with same CATH homology
 1HVX A;  2VJI A;  2ZZE A;  1FC7 A;  3GVJ A;  4KKS A;  2WJV A;  4XM3 A;  1UD5 A;  2V31 A;  1W0K A;  2ZTG A;  1UD8 A;  3ZPN A;  2GK6 A;  1E3X A;  2ZXI A;  4YEJ A;  1N6F A;  2RRL A;  2X6Y A;  2R9V A;  4L8K A;  1FX0 A;  4ASU A;  3OEH A;  4G6I A;  4DNT B;  1E3Z A;  2JJ2 A;  3FKS A;  4II3 A;  3OFN A;  4XLF A;  5DN6 A;  1VLY A;  4KKT A;  5IK2 A;  4XLE A;  4XOP A;  2D3N A;  1UD4 A;  5FL7 A;  1COW A;  3T53 B;  4XKV A;  1E43 A;  2F43 A;  3BH4 A;  3CMM A;  1NBM A;  1EFR A;  4XL9 A;  1WTH D;  3T56 B;  2XZL A;  2ZZG A;  2F1M A;  2LZJ A;  3BCF A;  2WSS A;  4NNJ A;  4B3F X;  2XZO A;  4GHN A;  2GJR A;  5KNL A;  2ZO9 B;  1VJS A;  1K32 A;  3GVK A;  2X6W A;  4Z1M A;  2V7Q A;  3GMF A;  4P22 A;  2M5S A;  1FCF A;  3OPO A;  4JC0 A;  3BC9 A;  1KMH A;  1OB0 A;  4AVZ A;  4JMQ A;  1K28 D;  3CES A;  3CP8 A;  5HKK A;  3A3G A;  4HIZ A;  1BMF A;  3GQB A;  2W6J A;  4XNF A;  1T5E A;  2E1B A;  2GK7 A;  2ZZF A;  1E79 A;  1OHH A;  4XN0 A;  4DK0 A;  1H8E A;  1E1Q A;  2JIZ A;  4XMY A;  4TT3 A;  4XN3 A;  1W9X A;  4YXW A;  2X53 S;  3BCD A;  3DDY A;  3GVL A;  2WZP P;  3DUP A;  1NRK A;  3T51 B;  2X85 A;  3OE7 A;  3ZIA A;  3OAA A;  2W6I A;  3JU4 A;  3OOC A;  4XLH A;  3A3B A;  4E0F A;  1H8H A;  4L8J A;  4L1C A;  3OW7 A;  4AE2 A;  2ZZQ A;  3HAG A;  4XQF A;  2ZOA A;  2VJJ A;  2WJY A;  4G7X A;  4G7W A;  3G05 A;  4DK1 A;  1HZE A;  1N6E A;  3GHF A;  1V0F A;  2JDI A;  3WQZ A;  3A35 A;  4XOR A;  3KEW A;  2CK3 A;  2GJK A;  4B3G A;  1BPL A;  4AEJ A;  1PKV A;  2HLD A;  1VF7 A;  4XLA A;  4XR6 A;  4TSF A;  2X6X A;  4TKO B;  2XGJ A;  2D3L A;  2DIE A;  3DOR A;  3H94 A;  2XOK A;  2XND A;  1FC6 A;  1I8D A;  2GJP A;  3FPP A;  5CDF A;  2DXL A;  1J7X A;  4UZU A;  2WPD A;  3CP2 A;  4XOT A;  2ZTN A;  4FXU A;  1UD3 A;  4XLC A;  3OEE A;  2V4D A;  1W0J A;  3VR6 A;  1WPC A;  1WP6 A;  1N6D A;  1MAB A;  3K50 A;  1UD2 A;  2Z6B D;  3NE5 B;  4DNR B;  4KKU A;  1E1R A;  1UD6 A;  4GQN A;  2ZXH A;  4XKW A;  2XZP A;  1KZL A;  1BLI A;  2KVO A;  3LNN A;  4XON A;  1FC9 A;  2JJ1 A;  2X8K A;  4II2 A;  4XD7 A;  2DXN A;  1SKY B;  1I18 A;  3DJA A;  2QE7 A;  3D03 A;  4YEL A;  3MOG A;  1V0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...