1BPLA

Glycosyltransferase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
179
Chain Sequence
b'LNGTLMQYFEWYMPNDGQHWKRLQNDSAYLAEHGITAVWIPPAYKGTSQADVGYGAYDLYDLGEFHQKGTVRTKYGTKGELQSAIKSLHSRDINVYGDVVINHKGGADATEDVTAVEVDPADRNRVISGEHLIKAWTHFHFPGRGSTYSDFKWHWYHFDGTDWDESRKLNRIYKFQGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
molecule tags Glycosyltransferase
publication title Crystal structure of calcium-depleted Bacillus licheniformis alpha-amylase at 2.2 A resolution.
pubmed doi rcsb
total genus 53
structure length 179
sequence length 179
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 1995-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 1bplA02
3.30.750.90 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 1bplA01
1UD8A 1UD2A 1OB0A 1E3XA 2D3LA 1WPCA 3BH4A 2D3NA 3BC9A 1VJSA 2GJRA 1UD6A 1BPLA 1BLIA 1E43A 2GJPA 4UZUA 1UD5A 1UD3A 3BCDA 1UD4A 1W9XA 3BCFA 2DIEA 1E3ZA 1HVXA 1WP6A
chains in the Genus database with same CATH superfamily
2XNJA 4M2LA 1XQBA 1MRZA 3GIRA 1TILB 1W0JA 4UZEA 1WTHD 3ISXA 4XN3A 2JJ1A 1H85A 2ZZFA 5H59A 1PJ6A 4WZTA 3IH9A 3H9NA 1R5OA 4X7CA 1A8PA 3BC9A 1B23P 1E79A 4P2NA 3WYAA 4LBYA 2DYIA 4OP7A 1VQ4B 4JC0A 2WJVA 2OK7A 1BMFA 1QFZA 1PJ5A 4ACAA 2BGJA 4LBZA 4Q7JB 5DN6A 2PMDA 3U2QA 3CCLB 4P12A 5A8AA 1QGAA 1S0UA 4LC0A 5L46A 1U2RA 1BJKA 4ZV4A 1TUIA 1OB2A 2DXLA 4QTPA 1WSVA 1QFJA 2OYNA 4YEJA 4ZCLA 5CDFA 1UD2A 1VQKB 1FC6A 4OOVA 4DMGA 5KSWB 3KEWA 1VHOA 2V7WA 3CCVB 1W0KA 1G7SA 2ZZQA 2BF4A 3OEEA 4RCZA 2QTZA 4TMWA 3ZC3A 1Q86D 2V7VA 5IYRA 2Q6IA 3U6BA 3D03A 4FK8A 4ROXA 2ZOAA 4II2A 3H94A 1P4MA 3PA1A 4AF7A 2F4NA 1M90D 2E1RA 3CPXA 1S4MA 4RDKA 2V7XA 3ONYA 4X07A 2ZO9B 5KNLA 3AVWA 4DK1A 3AGQA 2X6XA 1GAWA 4RM0A 3CC2B 4XONA 1H8EA 1HVXA 2KA5A 3W2EA 3LLOA 1KK2A 4WZLA 1AMOA 3WNBA 4B4DA 2CF4A 3BY1A 2D3LA 4E0FA 1VQOB 1FRNA 1XFOA 1K28D 1VLYA 1NDHA 2WZNA 3OJXA 4HE5A 1E63A 1ZM3A 2JDIA 1VQ8B 1I7PA 3CP8A 4XLCA 4YHBA 4P9SA 3GQBA 3GHFA 3WXMA 2R9VA 1TIDB 3LNNA 1NBMA 1XB2A 3PVDA 2VNHA 2P3MA 5IYNA 4XLFA 3CCSB 2OBRA 4XKVA 4X06A 4BPRA 3V76A 3CC4B 4P22A 3AVTA 2V31A 4RCYA 2PE3A 2HCJB 1HZEA 3PA2A 2VJJA 1E62A 3ES9A 2OBTA 4TKOB 2NV4A 2VBTA 1VQ6B 4LBVA 5TV2A 4ZCMA 1WU8A 4G5GA 2HLDA 4Z4UA 1JNYA 2C4UA 1Q7YD 1KC8D 4RD1A 4B43A 4GQNA 1M1KD 2C5BA 2DOGA 2D3NA 2D9RA 2PLFA 4RD4A 4P6YA 4Y9UA 1H8HA 1S72B 5IYQA 3FKSA 5EUSA 4ZGNB 1VHEA 5J3OA 2QMUA 3GVLA 5EUXA 3ONUA 1W2BB 2DIEA 2ZL6A 1N6DA 3W2GA 3DUPA 3QFSA 3F43A 4J0QA 1N6FA 3MMPA 2OBSA 3JU4A 1Y0RA 3QFRA 4QUZA 1H4ZA 4N3NA 4QV2A 2X6YA 3LQEA 5HXBA 4XLHA 1CNFA 2X6WA 4Z4TA 5EZBA 3JQRA 5F4MA 5J35A 2ZZGA 3B78A 3OZWA 4HIZA 4G1BA 1E1QA 4AVZA 5HKKA 3CCMB 3CTAA 4Y9RA 2GK7A 5IYPA 1YI2B 3CXCB 4M1KA 4G6IA 3B8HA 3ASTA 2OASA 3FPKA 4RD3A 1BPLA 2V7TA 5JBQA 1N8RD 1T6ZA 4DNRB 1CNEA 4X05A 1AUZA 1CQXA 1IJFA 2GREA 4PC6A 3ASSA 1N0UA 2HDNB 1BQEA 1SKQA 4U9UA 3JQPA 2YWFA 4CQJA 2DERA 3OFNA 3QE2A 2VNIA 1VQ9B 4X8IA 5FL7A 4DK0A 1VQ7B 3ASRA 3V7AA 4RD6A 3OOCA 1TVCA 1JB9A 3W5VA 3OP1A 5F4JA 1E3XA 4TMVA 4Z4ZA 3EH7A 3BH4A 3OIZA 1QVGB 2W6JA 3ASPA 2B5OA 4H9GA 4Y7CA 3VSEA 2ZL7A 3AGDA 4P26A 1E43A 1SBOA 3OIRA 2GPJA 2AS0A 2LZJA 1V5VA 3NY7A 1N0VC 1EP3B 3I55B 3VR6A 2BN4A 3OAAA 3CESA 3CC7B 4XLAA 1XE1A 4PABA 1I8DA 3ZTBA 4ACBA 3OEHA 1VQ5B 3A8KA 4OOXA 5THXA 4IW3B 1BUZA 3OW7A 4YAOA 1FNCA 3OE7A 4OOSA 3SJZA 4L1CA 1ZM2A 4WZEA 2GQFA 3DDYA 4M0LA 2Q6LA 4YXWA 1I18A 4TN1A 1KQSB 2WYRA 1HF2A 1IJEA 3BNWA 4FXUA 3ZXNA 1IHMA 4RPDA 4UZFA 1KD1D 1Q9SA 2ZL5A 2DXNA 2X85A 4UZUA 4PC2A 3AGEA 4XD7A 3V8VA 1QVFB 4F7DA 4M4SA 1UD4A 1W9XA 2NPFA 3K50A 3ZBUA 1RQRA 3AVYA 2VY9A 3C0KA 2YWEA 3G4SB 3VO1A 2OK8A 3MCAA 3W2IA 2KLNA 3AVVA 1FRQA 2I1LA 1G7TA 3KL9A 4C0SA 1G7RA 5A89A 2CC2A 3CPWB 5EMNA 2VJIA 4MYTA 1FC7A 2RRLA 2W6IA 4HYLA 3DORA 3ZZ0A 1TTTA 2YWHA 5FIUA 4NBSA 3MOGA 4Z4SA 4XMYA 1EP1B 2CW5A 2DY1A 4R71A 1DG1G 3W5UA 4OPSA 2BM1A 2ZBUA 2BGIA 1VQNB 3OZVA 3A3GA 1UD5A 2EIXA 1UD3A 2GK6A 3CRZA 1VQPB 3J81k 1IB0A 4RD0A 3ZUGA 2XZPA 3IF5A 5FA6A 1ZUNB 1OB0A 3P27A 1FC9A 2WZPP 2AHOA 3ZZTA 4ASUA 3T6OA 4YELA 5HZAA 3JQQA 2CK3A 3A35A 3OW2B 2QDXA 1H42A 2X8KA 2BV3A 3CMMA 1NRKA 2VNJA 4ZGQB 5BSXA 4RDJA 1PKVA 2CNDA 1T6YA 1N07A 2XNDA 3U6KA 2VBVA 2FVGA 5B6IA 2RC6A 1FNDA 1FNBA 3OJWA 3SLDA 1JA0A 1FDRA 4G1VA 1W34A 2F43A 3MHPA 3VNVA 2ZXHA 4EH1A 2JN9A 3Q38A 1N6EA 4M53A 2BMWA 3VO2A 1T6RA 1WPCA 3A3BA 3SJPA 1KK3A 2HMAA 1TLLA 1ELOA 1VF7A 1Q81D 5FO1A 1QGYA 4HE6A 1MABA 4L8JA 3GVJA 1UD6A 1BLIA 2XNCA 5A88A 3IH8A 1GJRA 1KK1A 2GJPA 3T56B 1VLOA 1R5NA 2WPDA 4YALA 1YITB 1T5EA 2DEUA 3D3UA 5IK2A 4QVJA 3A1PA 1QH0A 1QUEA 3QFCA 4PC7A 4MYUA 4PC3A 4TSFA 4B3FX 2BPOA 2Q6OA 1K73D 4ZCIA 1YIJB 4XM3A 2OTJB 3CW2A 1YLOA 2QTLA 2DETA 3BQJA 1T6XA 1BX1A 4RLZA 5LMZA 2C2WA 2EFGA 2YWGA 1KRHA 3CCUB 3CP2A 2QN6A 4X7EA 3QDQA 4B47A 1FNMA 3E20A 4PGOA 4X7DA 3I56B 2B7BA 2QEXB 2QE7A 4RD2A 1UMKA 2X53S 2FX3A 2XEXA 3WBKA 4P3YA 1DDIA 1EFRA 2JIZA 3PENA 4XOTA 4AF6A 3BCDA 2B78A 3R6JA 2D74A 5IYWA 1QGZA 2F1MA 3R6KA 4XKWA 5E6TA 1FCFA 3LO8A 4Z4WA 3IHAA 3LQ6A 4P6VF 4XN0A 2XGJA 1PJ7A 3OPOA 1WP6A 3QFTA 4NNJA 2JJ2A 1WXXA 1WXWA 1V0FA 3A8JA 1F60A 3CCEB 1QX4A 4XLEA 1EWYA 5H5JA 2F1LA 4WZKA 2PIAA 2XZLA 1F20A 1WSRA 3W2FA 1WOOA 4QHYA 1TH8B 2VBSA 1W35A 2Q6KA 4X7FA 1VJSA 4XORA 5TRDA 1RQPA 3AGPA 1QG0A 1D8TA 2R6HA 5FNZA 1EXMA 3VNUA 4XOPA 3G05A 2Z6BD 2V7QA 3Q39A 1H4XA 1JA1A 5AN9A 3SEJA 5EUZA 3FJOA 4XR6A 1N08A 1H4YA 1YJWB 1OGIA 2VYQA 1OHHA 1EFCA 4P3IA 1E64A 3Q6RA 4II3A 3GSIA 4B44A 2XOKA 1VQMB 3WQZA 3GVKA 4PC1A 2CWWA 1GR1A 2CBXA 4K1XA 3ASQA 5TY0A 1GVHA 3LKLA 3CCRB 1ZM4A 4WWVA 4Z4RA 1N05A 3Q6QA 3BY2A 4WQMA 2V4DA 4XL9A 3G6EB 3T53B 1BX0A 4B3GA 1K32A 4OPVA 2ZITA 1D1NA 4Z4VA 4AEJA 4Z4YA 1K9MD 3QSYA 1VQLB 4RJLA 1E3ZA 1Q82D 2C78A 2M5SA 2ZXIA 1E1RA 2E1BA 1UD8A 1WOPA 2VNKA 3IHBA 5EUWA 3W2HA 4KKSA 1SM4A 3CMEB 1VC1A 4P1VA 3V97A 4DGHA 4AE2A 2GJKA 3GK7A 3LVBA 1HA3A 2C4TA 2C5HA 3SKBA 1KZLA 1G7CA 4TMZA 1ZM9A 2WR8A 2ZZEA 5DSZA 5KW9A 2ZBVA 2VZLA 3D26A 5EUUA 4N3GA 2KVOA 1Y0YA 1EFTA 3A8IA 4P25A 1KK0A 2WSSA 1GO2A 5GV8A 1K8AD 4B48A 1AIPA 3WY9A 5HZBA 2CRVA 3GMFA 1QUFA 4OPOA 4X0CA 4AC9A 1OB5A 3PUMA 1J9ZA 2X3UA 3OKXA 4KKUA 1NB0A 3Q3AA 3NE5B 3OZUA 3I1FA 4C43A 1NJID 4FWTA 1J7XA 1W87A 4XNFA 1KMHA 3B82A 4FN5A 4PAAA 2BSAA 1OGJA 3FPPA 2VBUA 1COWA 4YAFA 1N06A 1WORA 1YX2A 1SKYB 3CB4A 2V7UA 5GV7A 4L8KA 2OTLB 4DGFA 3G71B 3WNCA 1WOSA 2X0KA 1JJ2B 2J7KA 1YJ9B 3HAGA 2RC5A 3VMFA 2WJYA 3MGLA 4QFMA 1EFUA 1GAQA 1FX0A 1V0EA 3BCFA 1B2RA 3ZPNA 2BM0A 4XQFA 4TMXA 2BVNA 1KJZA 4LBWA 4RDLA 2B7CA 4DNTB 3LDFA 2ZTNA 4DQLA 4TMTA 3AVUA 1NB9A 2C77A 4KKTA 5FO0A 4GHNA 4NCNA 3E1YE 3AVXA 3RY8A 4TT3A 1DDGA 4QVAA 1YJNB 3ZIAA 4DQKA 4YAUA 3CD6B 3WBJA 3P26A 1D2EA 3PUNA 3ZZUA 2GJRA 5TR9A 2QA4B 5DS0A 5BSYA 2ZTGA 4YAWA 1DARA 4G7WA 4B3XA 3CCQB 4G7XA 3WNDA 4RPBA 2DCUA 1THNB 1YHQB 3CMAB 1QFYA 3CCJB 4JMQA 2QGGA 4Z1MA 4XS5A 1KTVA 3ZBTA 4UAJA 2XZOA 3W5HA 5F4OA 3T51B 3DJAA 1EP2B 1R5BA 1WDTA 3SLNA
chains in the Genus database with same CATH topology
1OHHA 3WQZA 4II3A 2XOKA 1W0JA 2X6YA 1WTHD 1OB0A 3GVKA 4XLHA 1FC9A 2X6WA 4XN3A 2JJ1A 2WZPP 2ZZFA 4ASUA 4YELA 2ZZGA 5HKKA 2CK3A 3A35A 4HIZA 1E1QA 4AVZA 2X8KA 3BC9A 2GK7A 1E79A 3CMMA 1NRKA 4G6IA 2V4DA 1BPLA 4XL9A 4B3GA 2WJVA 3T53B 4DNRB 1BMFA 1K32A 4JC0A 1PKVA 2XNDA 5DN6A 4AEJA 3OFNA 1E3ZA 2F43A 2M5SA 5FL7A 2ZXIA 1E1RA 4DK0A 2DXLA 2E1BA 2ZXHA 1UD8A 4YEJA 5CDFA 1UD2A 1FC6A 3OOCA 4KKSA 3KEWA 1E3XA 1N6EA 1W0KA 1WPCA 3A3BA 2ZZQA 4AE2A 3OEEA 2GJKA 3BH4A 1VF7A 1KZLA 3D03A 2W6JA 2ZZEA 2ZOAA 1MABA 4L8JA 3GVJA 4II2A 1UD6A 3H94A 1BLIA 1E43A 2GJPA 2KVOA 3T56B 2LZJA 2WSSA 2WPDA 1T5EA 3DJAA 5IK2A 3GMFA 3VR6A 3OAAA 3CESA 4TSFA 4XLAA 5KNLA 4B3FX 4DK1A 2ZO9B 2X6XA 1I8DA 4XM3A 4KKUA 4XONA 3OEHA 1H8EA 1HVXA 3NE5B 4L1CA 3OW7A 3OE7A 1J7XA 4XNFA 1KMHA 2D3LA 3DDYA 4E0FA 4YXWA 1I18A 3FPPA 3CP2A 1K28D 1VLYA 1COWA 4FXUA 2JDIA 3CP8A 4XLCA 1SKYB 4L8KA 3GQBA 3GHFA 2R9VA 2QE7A 2DXNA 2X53S 1NBMA 2X85A 3LNNA 4UZUA 1EFRA 2JIZA 3HAGA 4XD7A 4XLFA 4XOTA 2WJYA 4XKVA 3BCDA 1UD4A 1W9XA 4P22A 3BCFA 3K50A 1FX0A 1V0EA 2F1MA 2V31A 4XKWA 1HZEA 1FCFA 2VJJA 3ZPNA 4XN0A 4XQFA 2XGJA 3OPOA 4TKOB 4DNTB 1WP6A 4NNJA 2JJ2A 2ZTNA 1V0FA 2HLDA 4KKTA 1FC7A 4GHNA 2VJIA 4XLEA 2RRLA 2W6IA 4TT3A 2XZLA 3ZIAA 3DORA 4GQNA 2D3NA 4XORA 1VJSA 2GJRA 3MOGA 4XMYA 2ZTGA 1H8HA 4G7WA 3FKSA 4G7XA 4XOPA 3G05A 3A3GA 1UD5A 1UD3A 2GK6A 3GVLA 2Z6BD 2V7QA 4JMQA 2DIEA 3DUPA 1N6DA 4Z1MA 1N6FA 3JU4A 4XR6A 2XZOA 3T51B 2XZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UD8 A;  1UD2 A;  1OB0 A;  1E3X A;  2D3L A;  1WPC A;  3BH4 A;  2D3N A;  3BC9 A;  1VJS A;  2GJR A;  1UD6 A;  1BPL A;  1BLI A;  1E43 A;  2GJP A;  4UZU A;  1UD5 A;  1UD3 A;  3BCD A;  1UD4 A;  1W9X A;  3BCF A;  2DIE A;  1E3Z A;  1HVX A;  1WP6 A; 
#chains in the Genus database with same CATH topology
 2XNJ A;  4M2L A;  1XQB A;  1MRZ A;  3GIR A;  1TIL B;  1W0J A;  4UZE A;  1WTH D;  3ISX A;  4XN3 A;  2JJ1 A;  1H85 A;  2ZZF A;  5H59 A;  1PJ6 A;  4WZT A;  3IH9 A;  3H9N A;  1R5O A;  4X7C A;  1A8P A;  3BC9 A;  1B23 P;  1E79 A;  4P2N A;  3WYA A;  4LBY A;  2DYI A;  4OP7 A;  1VQ4 B;  4JC0 A;  2WJV A;  2OK7 A;  1BMF A;  1QFZ A;  1PJ5 A;  4ACA A;  2BGJ A;  4LBZ A;  4Q7J B;  5DN6 A;  2PMD A;  3U2Q A;  3CCL B;  4P12 A;  5A8A A;  1QGA A;  1S0U A;  4LC0 A;  5L46 A;  1U2R A;  1BJK A;  4ZV4 A;  1TUI A;  1OB2 A;  2DXL A;  4QTP A;  1WSV A;  1QFJ A;  2OYN A;  4YEJ A;  4ZCL A;  5CDF A;  1UD2 A;  1VQK B;  1FC6 A;  4OOV A;  4DMG A;  5KSW B;  3KEW A;  1VHO A;  2V7W A;  3CCV B;  1W0K A;  1G7S A;  2ZZQ A;  2BF4 A;  3OEE A;  4RCZ A;  2QTZ A;  4TMW A;  3ZC3 A;  1Q86 D;  2V7V A;  5IYR A;  2Q6I A;  3U6B A;  3D03 A;  4FK8 A;  4ROX A;  2ZOA A;  4II2 A;  3H94 A;  1P4M A;  3PA1 A;  4AF7 A;  2F4N A;  1M90 D;  2E1R A;  3CPX A;  1S4M A;  4RDK A;  2V7X A;  3ONY A;  4X07 A;  2ZO9 B;  5KNL A;  3AVW A;  4DK1 A;  3AGQ A;  2X6X A;  1GAW A;  4RM0 A;  3CC2 B;  4XON A;  1H8E A;  1HVX A;  2KA5 A;  3W2E A;  3LLO A;  1KK2 A;  4WZL A;  1AMO A;  3WNB A;  4B4D A;  2CF4 A;  3BY1 A;  2D3L A;  4E0F A;  1VQO B;  1FRN A;  1XFO A;  1K28 D;  1VLY A;  1NDH A;  2WZN A;  3OJX A;  4HE5 A;  1E63 A;  1ZM3 A;  2JDI A;  1VQ8 B;  1I7P A;  3CP8 A;  4XLC A;  4YHB A;  4P9S A;  3GQB A;  3GHF A;  3WXM A;  2R9V A;  1TID B;  3LNN A;  1NBM A;  1XB2 A;  3PVD A;  2VNH A;  2P3M A;  5IYN A;  4XLF A;  3CCS B;  2OBR A;  4XKV A;  4X06 A;  4BPR A;  3V76 A;  3CC4 B;  4P22 A;  3AVT A;  2V31 A;  4RCY A;  2PE3 A;  2HCJ B;  1HZE A;  3PA2 A;  2VJJ A;  1E62 A;  3ES9 A;  2OBT A;  4TKO B;  2NV4 A;  2VBT A;  1VQ6 B;  4LBV A;  5TV2 A;  4ZCM A;  1WU8 A;  4G5G A;  2HLD A;  4Z4U A;  1JNY A;  2C4U A;  1Q7Y D;  1KC8 D;  4RD1 A;  4B43 A;  4GQN A;  1M1K D;  2C5B A;  2DOG A;  2D3N A;  2D9R A;  2PLF A;  4RD4 A;  4P6Y A;  4Y9U A;  1H8H A;  1S72 B;  5IYQ A;  3FKS A;  5EUS A;  4ZGN B;  1VHE A;  5J3O A;  2QMU A;  3GVL A;  5EUX A;  3ONU A;  1W2B B;  2DIE A;  2ZL6 A;  1N6D A;  3W2G A;  3DUP A;  3QFS A;  3F43 A;  4J0Q A;  1N6F A;  3MMP A;  2OBS A;  3JU4 A;  1Y0R A;  3QFR A;  4QUZ A;  1H4Z A;  4N3N A;  4QV2 A;  2X6Y A;  3LQE A;  5HXB A;  4XLH A;  1CNF A;  2X6W A;  4Z4T A;  5EZB A;  3JQR A;  5F4M A;  5J35 A;  2ZZG A;  3B78 A;  3OZW A;  4HIZ A;  4G1B A;  1E1Q A;  4AVZ A;  5HKK A;  3CCM B;  3CTA A;  4Y9R A;  2GK7 A;  5IYP A;  1YI2 B;  3CXC B;  4M1K A;  4G6I A;  3B8H A;  3AST A;  2OAS A;  3FPK A;  4RD3 A;  1BPL A;  2V7T A;  5JBQ A;  1N8R D;  1T6Z A;  4DNR B;  1CNE A;  4X05 A;  1AUZ A;  1CQX A;  1IJF A;  2GRE A;  4PC6 A;  3ASS A;  1N0U A;  2HDN B;  1BQE A;  1SKQ A;  4U9U A;  3JQP A;  2YWF A;  4CQJ A;  2DER A;  3OFN A;  3QE2 A;  2VNI A;  1VQ9 B;  4X8I A;  5FL7 A;  4DK0 A;  1VQ7 B;  3ASR A;  3V7A A;  4RD6 A;  3OOC A;  1TVC A;  1JB9 A;  3W5V A;  3OP1 A;  5F4J A;  1E3X A;  4TMV A;  4Z4Z A;  3EH7 A;  3BH4 A;  3OIZ A;  1QVG B;  2W6J A;  3ASP A;  2B5O A;  4H9G A;  4Y7C A;  3VSE A;  2ZL7 A;  3AGD A;  4P26 A;  1E43 A;  1SBO A;  3OIR A;  2GPJ A;  2AS0 A;  2LZJ A;  1V5V A;  3NY7 A;  1N0V C;  1EP3 B;  3I55 B;  3VR6 A;  2BN4 A;  3OAA A;  3CES A;  3CC7 B;  4XLA A;  1XE1 A;  4PAB A;  1I8D A;  3ZTB A;  4ACB A;  3OEH A;  1VQ5 B;  3A8K A;  4OOX A;  5THX A;  4IW3 B;  1BUZ A;  3OW7 A;  4YAO A;  1FNC A;  3OE7 A;  4OOS A;  3SJZ A;  4L1C A;  1ZM2 A;  4WZE A;  2GQF A;  3DDY A;  4M0L A;  2Q6L A;  4YXW A;  1I18 A;  4TN1 A;  1KQS B;  2WYR A;  1HF2 A;  1IJE A;  3BNW A;  4FXU A;  3ZXN A;  1IHM A;  4RPD A;  4UZF A;  1KD1 D;  1Q9S A;  2ZL5 A;  2DXN A;  2X85 A;  4UZU A;  4PC2 A;  3AGE A;  4XD7 A;  3V8V A;  1QVF B;  4F7D A;  4M4S A;  1UD4 A;  1W9X A;  2NPF A;  3K50 A;  3ZBU A;  1RQR A;  3AVY A;  2VY9 A;  3C0K A;  2YWE A;  3G4S B;  3VO1 A;  2OK8 A;  3MCA A;  3W2I A;  2KLN A;  3AVV A;  1FRQ A;  2I1L A;  1G7T A;  3KL9 A;  4C0S A;  1G7R A;  5A89 A;  2CC2 A;  3CPW B;  5EMN A;  2VJI A;  4MYT A;  1FC7 A;  2RRL A;  2W6I A;  4HYL A;  3DOR A;  3ZZ0 A;  1TTT A;  2YWH A;  5FIU A;  4NBS A;  3MOG A;  4Z4S A;  4XMY A;  1EP1 B;  2CW5 A;  2DY1 A;  4R71 A;  1DG1 G;  3W5U A;  4OPS A;  2BM1 A;  2ZBU A;  2BGI A;  1VQN B;  3OZV A;  3A3G A;  1UD5 A;  2EIX A;  1UD3 A;  2GK6 A;  3CRZ A;  1VQP B;  3J81 k;  1IB0 A;  4RD0 A;  3ZUG A;  2XZP A;  3IF5 A;  5FA6 A;  1ZUN B;  1OB0 A;  3P27 A;  1FC9 A;  2WZP P;  2AHO A;  3ZZT A;  4ASU A;  3T6O A;  4YEL A;  5HZA A;  3JQQ A;  2CK3 A;  3A35 A;  3OW2 B;  2QDX A;  1H42 A;  2X8K A;  2BV3 A;  3CMM A;  1NRK A;  2VNJ A;  4ZGQ B;  5BSX A;  4RDJ A;  1PKV A;  2CND A;  1T6Y A;  1N07 A;  2XND A;  3U6K A;  2VBV A;  2FVG A;  5B6I A;  2RC6 A;  1FND A;  1FNB A;  3OJW A;  3SLD A;  1JA0 A;  1FDR A;  4G1V A;  1W34 A;  2F43 A;  3MHP A;  3VNV A;  2ZXH A;  4EH1 A;  2JN9 A;  3Q38 A;  1N6E A;  4M53 A;  2BMW A;  3VO2 A;  1T6R A;  1WPC A;  3A3B A;  3SJP A;  1KK3 A;  2HMA A;  1TLL A;  1ELO A;  1VF7 A;  1Q81 D;  5FO1 A;  1QGY A;  4HE6 A;  1MAB A;  4L8J A;  3GVJ A;  1UD6 A;  1BLI A;  2XNC A;  5A88 A;  3IH8 A;  1GJR A;  1KK1 A;  2GJP A;  3T56 B;  1VLO A;  1R5N A;  2WPD A;  4YAL A;  1YIT B;  1T5E A;  2DEU A;  3D3U A;  5IK2 A;  4QVJ A;  3A1P A;  1QH0 A;  1QUE A;  3QFC A;  4PC7 A;  4MYU A;  4PC3 A;  4TSF A;  4B3F X;  2BPO A;  2Q6O A;  1K73 D;  4ZCI A;  1YIJ B;  4XM3 A;  2OTJ B;  3CW2 A;  1YLO A;  2QTL A;  2DET A;  3BQJ A;  1T6X A;  1BX1 A;  4RLZ A;  5LMZ A;  2C2W A;  2EFG A;  2YWG A;  1KRH A;  3CCU B;  3CP2 A;  2QN6 A;  4X7E A;  3QDQ A;  4B47 A;  1FNM A;  3E20 A;  4PGO A;  4X7D A;  3I56 B;  2B7B A;  2QEX B;  2QE7 A;  4RD2 A;  1UMK A;  2X53 S;  2FX3 A;  2XEX A;  3WBK A;  4P3Y A;  1DDI A;  1EFR A;  2JIZ A;  3PEN A;  4XOT A;  4AF6 A;  3BCD A;  2B78 A;  3R6J A;  2D74 A;  5IYW A;  1QGZ A;  2F1M A;  3R6K A;  4XKW A;  5E6T A;  1FCF A;  3LO8 A;  4Z4W A;  3IHA A;  3LQ6 A;  4P6V F;  4XN0 A;  2XGJ A;  1PJ7 A;  3OPO A;  1WP6 A;  3QFT A;  4NNJ A;  2JJ2 A;  1WXX A;  1WXW A;  1V0F A;  3A8J A;  1F60 A;  3CCE B;  1QX4 A;  4XLE A;  1EWY A;  5H5J A;  2F1L A;  4WZK A;  2PIA A;  2XZL A;  1F20 A;  1WSR A;  3W2F A;  1WOO A;  4QHY A;  1TH8 B;  2VBS A;  1W35 A;  2Q6K A;  4X7F A;  1VJS A;  4XOR A;  5TRD A;  1RQP A;  3AGP A;  1QG0 A;  1D8T A;  2R6H A;  5FNZ A;  1EXM A;  3VNU A;  4XOP A;  3G05 A;  2Z6B D;  2V7Q A;  3Q39 A;  1H4X A;  1JA1 A;  5AN9 A;  3SEJ A;  5EUZ A;  3FJO A;  4XR6 A;  1N08 A;  1H4Y A;  1YJW B;  1OGI A;  2VYQ A;  1OHH A;  1EFC A;  4P3I A;  1E64 A;  3Q6R A;  4II3 A;  3GSI A;  4B44 A;  2XOK A;  1VQM B;  3WQZ A;  3GVK A;  4PC1 A;  2CWW A;  1GR1 A;  2CBX A;  4K1X A;  3ASQ A;  5TY0 A;  1GVH A;  3LKL A;  3CCR B;  1ZM4 A;  4WWV A;  4Z4R A;  1N05 A;  3Q6Q A;  3BY2 A;  4WQM A;  2V4D A;  4XL9 A;  3G6E B;  3T53 B;  1BX0 A;  4B3G A;  1K32 A;  4OPV A;  2ZIT A;  1D1N A;  4Z4V A;  4AEJ A;  4Z4Y A;  1K9M D;  3QSY A;  1VQL B;  4RJL A;  1E3Z A;  1Q82 D;  2C78 A;  2M5S A;  2ZXI A;  1E1R A;  2E1B A;  1UD8 A;  1WOP A;  2VNK A;  3IHB A;  5EUW A;  3W2H A;  4KKS A;  1SM4 A;  3CME B;  1VC1 A;  4P1V A;  3V97 A;  4DGH A;  4AE2 A;  2GJK A;  3GK7 A;  3LVB A;  1HA3 A;  2C4T A;  2C5H A;  3SKB A;  1KZL A;  1G7C A;  4TMZ A;  1ZM9 A;  2WR8 A;  2ZZE A;  5DSZ A;  5KW9 A;  2ZBV A;  2VZL A;  3D26 A;  5EUU A;  4N3G A;  2KVO A;  1Y0Y A;  1EFT A;  3A8I A;  4P25 A;  1KK0 A;  2WSS A;  1GO2 A;  5GV8 A;  1K8A D;  4B48 A;  1AIP A;  3WY9 A;  5HZB A;  2CRV A;  3GMF A;  1QUF A;  4OPO A;  4X0C A;  4AC9 A;  1OB5 A;  3PUM A;  1J9Z A;  2X3U A;  3OKX A;  4KKU A;  1NB0 A;  3Q3A A;  3NE5 B;  3OZU A;  3I1F A;  4C43 A;  1NJI D;  4FWT A;  1J7X A;  1W87 A;  4XNF A;  1KMH A;  3B82 A;  4FN5 A;  4PAA A;  2BSA A;  1OGJ A;  3FPP A;  2VBU A;  1COW A;  4YAF A;  1N06 A;  1WOR A;  1YX2 A;  1SKY B;  3CB4 A;  2V7U A;  5GV7 A;  4L8K A;  2OTL B;  4DGF A;  3G71 B;  3WNC A;  1WOS A;  2X0K A;  1JJ2 B;  2J7K A;  1YJ9 B;  3HAG A;  2RC5 A;  3VMF A;  2WJY A;  3MGL A;  4QFM A;  1EFU A;  1GAQ A;  1FX0 A;  1V0E A;  3BCF A;  1B2R A;  3ZPN A;  2BM0 A;  4XQF A;  4TMX A;  2BVN A;  1KJZ A;  4LBW A;  4RDL A;  2B7C A;  4DNT B;  3LDF A;  2ZTN A;  4DQL A;  4TMT A;  3AVU A;  1NB9 A;  2C77 A;  4KKT A;  5FO0 A;  4GHN A;  4NCN A;  3E1Y E;  3AVX A;  3RY8 A;  4TT3 A;  1DDG A;  4QVA A;  1YJN B;  3ZIA A;  4DQK A;  4YAU A;  3CD6 B;  3WBJ A;  3P26 A;  1D2E A;  3PUN A;  3ZZU A;  2GJR A;  5TR9 A;  2QA4 B;  5DS0 A;  5BSY A;  2ZTG A;  4YAW A;  1DAR A;  4G7W A;  4B3X A;  3CCQ B;  4G7X A;  3WND A;  4RPB A;  2DCU A;  1THN B;  1YHQ B;  3CMA B;  1QFY A;  3CCJ B;  4JMQ A;  2QGG A;  4Z1M A;  4XS5 A;  1KTV A;  3ZBT A;  4UAJ A;  2XZO A;  3W5H A;  5F4O A;  3T51 B;  3DJA A;  1EP2 B;  1R5B A;  1WDT A;  3SLN A; 
#chains in the Genus database with same CATH homology
 1OHH A;  3WQZ A;  4II3 A;  2XOK A;  1W0J A;  2X6Y A;  1WTH D;  1OB0 A;  3GVK A;  4XLH A;  1FC9 A;  2X6W A;  4XN3 A;  2JJ1 A;  2WZP P;  2ZZF A;  4ASU A;  4YEL A;  2ZZG A;  5HKK A;  2CK3 A;  3A35 A;  4HIZ A;  1E1Q A;  4AVZ A;  2X8K A;  3BC9 A;  2GK7 A;  1E79 A;  3CMM A;  1NRK A;  4G6I A;  2V4D A;  1BPL A;  4XL9 A;  4B3G A;  2WJV A;  3T53 B;  4DNR B;  1BMF A;  1K32 A;  4JC0 A;  1PKV A;  2XND A;  5DN6 A;  4AEJ A;  3OFN A;  1E3Z A;  2F43 A;  2M5S A;  5FL7 A;  2ZXI A;  1E1R A;  4DK0 A;  2DXL A;  2E1B A;  2ZXH A;  1UD8 A;  4YEJ A;  5CDF A;  1UD2 A;  1FC6 A;  3OOC A;  4KKS A;  3KEW A;  1E3X A;  1N6E A;  1W0K A;  1WPC A;  3A3B A;  2ZZQ A;  4AE2 A;  3OEE A;  2GJK A;  3BH4 A;  1VF7 A;  1KZL A;  3D03 A;  2W6J A;  2ZZE A;  2ZOA A;  1MAB A;  4L8J A;  3GVJ A;  4II2 A;  1UD6 A;  3H94 A;  1BLI A;  1E43 A;  2GJP A;  2KVO A;  3T56 B;  2LZJ A;  2WSS A;  2WPD A;  1T5E A;  3DJA A;  5IK2 A;  3GMF A;  3VR6 A;  3OAA A;  3CES A;  4TSF A;  4XLA A;  5KNL A;  4B3F X;  4DK1 A;  2ZO9 B;  2X6X A;  1I8D A;  4XM3 A;  4KKU A;  4XON A;  3OEH A;  1H8E A;  1HVX A;  3NE5 B;  4L1C A;  3OW7 A;  3OE7 A;  1J7X A;  4XNF A;  1KMH A;  2D3L A;  3DDY A;  4E0F A;  4YXW A;  1I18 A;  3FPP A;  3CP2 A;  1K28 D;  1VLY A;  1COW A;  4FXU A;  2JDI A;  3CP8 A;  4XLC A;  1SKY B;  4L8K A;  3GQB A;  3GHF A;  2R9V A;  2QE7 A;  2DXN A;  2X53 S;  1NBM A;  2X85 A;  3LNN A;  4UZU A;  1EFR A;  2JIZ A;  3HAG A;  4XD7 A;  4XLF A;  4XOT A;  2WJY A;  4XKV A;  3BCD A;  1UD4 A;  1W9X A;  4P22 A;  3BCF A;  3K50 A;  1FX0 A;  1V0E A;  2F1M A;  2V31 A;  4XKW A;  1HZE A;  1FCF A;  2VJJ A;  3ZPN A;  4XN0 A;  4XQF A;  2XGJ A;  3OPO A;  4TKO B;  4DNT B;  1WP6 A;  4NNJ A;  2JJ2 A;  2ZTN A;  1V0F A;  2HLD A;  4KKT A;  1FC7 A;  4GHN A;  2VJI A;  4XLE A;  2RRL A;  2W6I A;  4TT3 A;  2XZL A;  3ZIA A;  3DOR A;  4GQN A;  2D3N A;  4XOR A;  1VJS A;  2GJR A;  3MOG A;  4XMY A;  2ZTG A;  1H8H A;  4G7W A;  3FKS A;  4G7X A;  4XOP A;  3G05 A;  3A3G A;  1UD5 A;  1UD3 A;  2GK6 A;  3GVL A;  2Z6B D;  2V7Q A;  4JMQ A;  2DIE A;  3DUP A;  1N6D A;  4Z1M A;  1N6F A;  3JU4 A;  4XR6 A;  2XZO A;  3T51 B;  2XZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...