2RRLA

Solution structure of the c-terminal domain of the flik
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
169
structure length
169
Chain Sequence
b'HMASDDRATGPALTPLVVAAAATSAKVEVDSPPAPVTHGAAMPTLSSATAQPLPVASAPVLSAPLGSHEWQQTFSQQVMLFTRQGQQSAQLRLHPEELGQVHISLKLDDNQAQLQMVSPHSHVRAALEAALPMLRTQLAESGIQLGQSSISSESFAGQQQSSSQQQSSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar hook-length control protein
publication title The NMR structure of FliK, the trigger for the switch of substrate specificity in the flagellar type III secretion apparatus
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Protein transport
total genus 23
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2011-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02120 Flg_hook Flagellar hook-length control protein FliK
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.140 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 2rrlA01
2RRLA
chains in the Genus database with same CATH superfamily
1BPLA 2ZO9B 4L8KA 4JC0A 1BUZA 1N6DA 2KLNA 5EUUA 3EH7A 1THNB 2KA5A 1WXXA 2RRLA 1V0FA 4HIZA 3GHFA 1FC7A 2VY9A 5EUWA 1AUZA 1FC6A 3GVKA 1H4ZA 1FCFA 4HYLA 3OIRA 2CWWA 3QDQA 3DJAA 1HF2A 1H4XA 2DXNA 3AGDA 3LDFA 2ZOAA 3AGEA 3LLOA 5EUZA 3NY7A 3ZXNA 1TIDB 5EUSA 3F43A 3T6OA 3JU4A 3MGLA 5EUXA 3GMFA 3GVLA 3IF5A 2AS0A 3DUPA 4L1CA 3C0KA 3V8VA 3IHBA 3IH8A 4AE2A 1N6FA 1VC1A 3MOGA 1K32A 1H4YA 4DGHA 3D3UA 4QTPA 3ZTBA 1T6RA 4XS5A 3IHAA 2B78A 2OASA 3VSEA 3GVJA 1TH8B 1TILB 1WXWA 1V0EA 1N6EA 2DXLA 3IH9A 3K50A 1SBOA 4DMGA 3DORA 1J7XA 3V97A 4AEJA 1FC9A 3LKLA 4GHNA 4DGFA 3OIZA 5EZBA 3D03A 3GK7A
chains in the Genus database with same CATH topology
1BPLA 2ZO9B 4L8KA 4JC0A 1FCFA 1N6DA 3GMFA 3DJAA 3DUPA 4L1CA 1N6EA 4AE2A 2DXLA 1N6FA 2DXNA 3K50A 3MOGA 3DORA 1K32A 1J7XA 2RRLA 4AEJA 1FC9A 4GHNA 3GHFA 1FC7A 2ZOAA 3D03A 1FC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRL A; 
#chains in the Genus database with same CATH topology
 1BPL A;  2ZO9 B;  4L8K A;  4JC0 A;  1BUZ A;  1N6D A;  2KLN A;  5EUU A;  3EH7 A;  1THN B;  2KA5 A;  1WXX A;  2RRL A;  1V0F A;  4HIZ A;  3GHF A;  1FC7 A;  2VY9 A;  5EUW A;  1AUZ A;  1FC6 A;  3GVK A;  1H4Z A;  1FCF A;  4HYL A;  3OIR A;  2CWW A;  3QDQ A;  3DJA A;  1HF2 A;  1H4X A;  2DXN A;  3AGD A;  3LDF A;  2ZOA A;  3AGE A;  3LLO A;  5EUZ A;  3NY7 A;  3ZXN A;  1TID B;  5EUS A;  3F43 A;  3T6O A;  3JU4 A;  3MGL A;  5EUX A;  3GMF A;  3GVL A;  3IF5 A;  2AS0 A;  3DUP A;  4L1C A;  3C0K A;  3V8V A;  3IHB A;  3IH8 A;  4AE2 A;  1N6F A;  1VC1 A;  3MOG A;  1K32 A;  1H4Y A;  4DGH A;  3D3U A;  4QTP A;  3ZTB A;  1T6R A;  4XS5 A;  3IHA A;  2B78 A;  2OAS A;  3VSE A;  3GVJ A;  1TH8 B;  1TIL B;  1WXW A;  1V0E A;  1N6E A;  2DXL A;  3IH9 A;  3K50 A;  1SBO A;  4DMG A;  3DOR A;  1J7X A;  3V97 A;  4AEJ A;  1FC9 A;  3LKL A;  4GHN A;  4DGF A;  3OIZ A;  5EZB A;  3D03 A;  3GK7 A; 
#chains in the Genus database with same CATH homology
 1BPL A;  2ZO9 B;  4L8K A;  4JC0 A;  1FCF A;  1N6D A;  3GMF A;  3DJA A;  3DUP A;  4L1C A;  1N6E A;  4AE2 A;  2DXL A;  1N6F A;  2DXN A;  3K50 A;  3MOG A;  3DOR A;  1K32 A;  1J7X A;  2RRL A;  4AEJ A;  1FC9 A;  4GHN A;  3GHF A;  1FC7 A;  2ZOA A;  3D03 A;  1FC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...