2RRLA

Solution structure of the c-terminal domain of the flik
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
169
structure length
169
Chain Sequence
HMASDDRATGPALTPLVVAAAATSAKVEVDSPPAPVTHGAAMPTLSSATAQPLPVASAPVLSAPLGSHEWQQTFSQQVMLFTRQGQQSAQLRLHPEELGQVHISLKLDDNQAQLQMVSPHSHVRAALEAALPMLRTQLAESGIQLGQSSISSESFAGQQQSSSQQQSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar hook-length control protein
publication title The NMR structure of FliK, the trigger for the switch of substrate specificity in the flagellar type III secretion apparatus
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Protein transport
total genus 23
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2011-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02120 Flg_hook Flagellar hook-length control protein FliK
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.140 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 2rrlA01
2RRLA
chains in the Genus database with same CATH superfamily
3GK7A 5EZBA 1N6DA 1H4XA 3GVJA 1FCFA 3MGLA 2B78A 4L1CA 3F43A 2KA5A 1V0FA 3IH8A 3LKLA 4L8KA 2DXNA 1BPLA 1N6FA 3V8VA 3K50A 3DORA 3JU4A 5EUZA 3C0KA 1FC6A 3V97A 4HIZA 4GHNA 4DGHA 1SBOA 4HYLA 5EUWA 3ZXNA 3DJAA 3EH7A 1FC7A 5EUSA 1TH8B 4XS5A 1V0EA 2VY9A 3IF5A 3LLOA 2CWWA 3IHBA 4AE2A 3MOGA 3OIRA 3DUPA 3VSEA 3IH9A 3D3UA 1T6RA 3IHAA 3GVLA 3GHFA 1K32A 1BUZA 1H4YA 1AUZA 2KLNA 1THNB 5EUXA 3ZTBA 1HF2A 3QDQA 3D03A 3GMFA 3NY7A 1WXWA 4DGFA 5EUUA 3AGEA 1VC1A 2DXLA 1H4ZA 1N6EA 1TILB 1FC9A 4DMGA 2RRLA 4QTPA 3LDFA 3AGDA 3T6OA 2ZOAA 1TIDB 3GVKA 2ZO9B 4JC0A 1J7XA 1WXXA 3OIZA 2OASA 2AS0A 4AEJA
chains in the Genus database with same CATH topology
1FC6A 4GHNA 1N6DA 3DUPA 2DXLA 3DJAA 1FCFA 1N6EA 1FC7A 1FC9A 4L1CA 2RRLA 2ZOAA 3GHFA 1K32A 2ZO9B 4JC0A 1J7XA 4L8KA 4AE2A 2DXNA 1BPLA 1N6FA 3D03A 3GMFA 3MOGA 4AEJA 3K50A 3DORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRL A; 
#chains in the Genus database with same CATH topology
 3GK7 A;  5EZB A;  1N6D A;  1H4X A;  3GVJ A;  1FCF A;  3MGL A;  2B78 A;  4L1C A;  3F43 A;  2KA5 A;  1V0F A;  3IH8 A;  3LKL A;  4L8K A;  2DXN A;  1BPL A;  1N6F A;  3V8V A;  3K50 A;  3DOR A;  3JU4 A;  5EUZ A;  3C0K A;  1FC6 A;  3V97 A;  4HIZ A;  4GHN A;  4DGH A;  1SBO A;  4HYL A;  5EUW A;  3ZXN A;  3DJA A;  3EH7 A;  1FC7 A;  5EUS A;  1TH8 B;  4XS5 A;  1V0E A;  2VY9 A;  3IF5 A;  3LLO A;  2CWW A;  3IHB A;  4AE2 A;  3MOG A;  3OIR A;  3DUP A;  3VSE A;  3IH9 A;  3D3U A;  1T6R A;  3IHA A;  3GVL A;  3GHF A;  1K32 A;  1BUZ A;  1H4Y A;  1AUZ A;  2KLN A;  1THN B;  5EUX A;  3ZTB A;  1HF2 A;  3QDQ A;  3D03 A;  3GMF A;  3NY7 A;  1WXW A;  4DGF A;  5EUU A;  3AGE A;  1VC1 A;  2DXL A;  1H4Z A;  1N6E A;  1TIL B;  1FC9 A;  4DMG A;  2RRL A;  4QTP A;  3LDF A;  3AGD A;  3T6O A;  2ZOA A;  1TID B;  3GVK A;  2ZO9 B;  4JC0 A;  1J7X A;  1WXX A;  3OIZ A;  2OAS A;  2AS0 A;  4AEJ A; 
#chains in the Genus database with same CATH homology
 1FC6 A;  4GHN A;  1N6D A;  3DUP A;  2DXL A;  3DJA A;  1FCF A;  1N6E A;  1FC7 A;  1FC9 A;  4L1C A;  2RRL A;  2ZOA A;  3GHF A;  1K32 A;  2ZO9 B;  4JC0 A;  1J7X A;  4L8K A;  4AE2 A;  2DXN A;  1BPL A;  1N6F A;  3D03 A;  3GMF A;  3MOG A;  4AEJ A;  3K50 A;  3DOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...