2RRLA

Solution structure of the c-terminal domain of the flik
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
169
structure length
169
Chain Sequence
HMASDDRATGPALTPLVVAAAATSAKVEVDSPPAPVTHGAAMPTLSSATAQPLPVASAPVLSAPLGSHEWQQTFSQQVMLFTRQGQQSAQLRLHPEELGQVHISLKLDDNQAQLQMVSPHSHVRAALEAALPMLRTQLAESGIQLGQSSISSESFAGQQQSSSQQQSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Flagellar hook-length control protein
publication title The NMR structure of FliK, the trigger for the switch of substrate specificity in the flagellar type III secretion apparatus
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 23
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2011-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02120 Flg_hook Flagellar hook-length control protein FliK
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.140 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 2rrlA01
2RRLA
chains in the Genus database with same CATH superfamily
4L1CA 3DORA 1N6FA 1FC9A 3OIRA 1FC6A 3AGEA 5EUWA 3OIZA 5EUSA 3GVJA 1TILB 3AGDA 3NY7A 3QDQA 1AUZA 1WXWA 3T6OA 5EUUA 2DXLA 4GHNA 5EZBA 1V0FA 1TH8B 1K32A 3ZTBA 3D3UA 3GVLA 3GK7A 2ZO9B 3MGLA 2RRLA 1J7XA 3F43A 3ZXNA 2VY9A 3V97A 3DUPA 1N6EA 4QTPA 4HIZA 4L8KA 1HF2A 3LLOA 4DGFA 1BUZA 4DMGA 1VC1A 3IF5A 4XS5A 2B78A 3GMFA 3IH8A 1H4YA 3DJAA 1V0EA 2AS0A 4HYLA 1TIDB 1SBOA 3GVKA 5EUXA 2CWWA 4AE2A 3GHFA 3LDFA 1BPLA 1THNB 3IH9A 3LKLA 2ZOAA 3VSEA 2KLNA 4AEJA 1N6DA 1T6RA 2KA5A 2OASA 2DXNA 3EH7A 4JC0A 1H4XA 3K50A 3IHBA 1WXXA 1FCFA 3IHAA 5EUZA 3V8VA 3C0KA 1H4ZA 1FC7A 3JU4A 3D03A 3MOGA 4DGHA
chains in the Genus database with same CATH topology
2ZOAA 4L1CA 3DORA 1N6FA 4AEJA 1FC9A 2RRLA 3GMFA 1N6DA 1J7XA 1FC6A 2DXNA 3DJAA 4JC0A 3K50A 1FCFA 3DUPA 1N6EA 1FC7A 4L8KA 2DXLA 4GHNA 4AE2A 3GHFA 3D03A 1K32A 1BPLA 3MOGA 2ZO9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRL A; 
#chains in the Genus database with same CATH topology
 4L1C A;  3DOR A;  1N6F A;  1FC9 A;  3OIR A;  1FC6 A;  3AGE A;  5EUW A;  3OIZ A;  5EUS A;  3GVJ A;  1TIL B;  3AGD A;  3NY7 A;  3QDQ A;  1AUZ A;  1WXW A;  3T6O A;  5EUU A;  2DXL A;  4GHN A;  5EZB A;  1V0F A;  1TH8 B;  1K32 A;  3ZTB A;  3D3U A;  3GVL A;  3GK7 A;  2ZO9 B;  3MGL A;  2RRL A;  1J7X A;  3F43 A;  3ZXN A;  2VY9 A;  3V97 A;  3DUP A;  1N6E A;  4QTP A;  4HIZ A;  4L8K A;  1HF2 A;  3LLO A;  4DGF A;  1BUZ A;  4DMG A;  1VC1 A;  3IF5 A;  4XS5 A;  2B78 A;  3GMF A;  3IH8 A;  1H4Y A;  3DJA A;  1V0E A;  2AS0 A;  4HYL A;  1TID B;  1SBO A;  3GVK A;  5EUX A;  2CWW A;  4AE2 A;  3GHF A;  3LDF A;  1BPL A;  1THN B;  3IH9 A;  3LKL A;  2ZOA A;  3VSE A;  2KLN A;  4AEJ A;  1N6D A;  1T6R A;  2KA5 A;  2OAS A;  2DXN A;  3EH7 A;  4JC0 A;  1H4X A;  3K50 A;  3IHB A;  1WXX A;  1FCF A;  3IHA A;  5EUZ A;  3V8V A;  3C0K A;  1H4Z A;  1FC7 A;  3JU4 A;  3D03 A;  3MOG A;  4DGH A; 
#chains in the Genus database with same CATH homology
 2ZOA A;  4L1C A;  3DOR A;  1N6F A;  4AEJ A;  1FC9 A;  2RRL A;  3GMF A;  1N6D A;  1J7X A;  1FC6 A;  2DXN A;  3DJA A;  4JC0 A;  3K50 A;  1FCF A;  3DUP A;  1N6E A;  1FC7 A;  4L8K A;  2DXL A;  4GHN A;  4AE2 A;  3GHF A;  3D03 A;  1K32 A;  1BPL A;  3MOG A;  2ZO9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...