4AEJA

Crystal structure of human fibrillar procollagen type iii c- propeptide trimer
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
213
Chain Sequence
SPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQQITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLLAGEN ALPHA-1(III) CHAIN
publication title Structural Basis of Fibrillar Collagen Trimerization and Related Genetic Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 49
structure length 213
sequence length 217
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01410 COLFI Fibrillar collagen C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1000 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aejA02
3.30.750.130 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4aejA01
4AEJA 4AK3A 4AE2A
chains in the Genus database with same CATH superfamily
2JG9B 3VBHC 4LIUA 3MYXA 1PNGA 2GH8A 4I3GA 4CP2A 1HJGA 2WYFA 4LK6A 3TOJA 4QM9A 1JTZX 3WNLA 1SFPA 3NJXA 4A7KA 1K32A 3AK0A 1J3QA 5FQ0A 3O14A 1PMHX 3INAA 3VBSA 3ZTBA 3CKHA 5IVVA 3I8TA 3NNGA 4IUGA 5B4XA 3H1WA 3N36A 1ZZ8A 3C7FA 3UGHA 4CU9A 4EN0A 2Q5TA 5FDBA 3OGSA 2AZ5A 3U0ZA 2ZJCA 3S0MA 3IZOA 1ND3C 2PLV2 2WS93 3T2TA 2BGPA 1RIRA 1HV0A 3AMPA 3K2OA 4JKKA 2ET1A 3UGFA 1H4GA 3CU7A 1UX7A 3JB4C 2XL9A 2EF6A 2B39A 4MXVA 4QU1A 5BUVA 1DIWA 3ACIA 1HRI3 1OT5A 2J42A 2HKXA 4LBQA 2OUJA 4L8QA 5FYSA 1R1A3 5GLWA 3I2GA 2A6XA 3AP6A 1I3HA 4JZRA 4LKSA 2ARBA 4I0WB 5DAXA 3AM2A 3VZMA 2LS6A 3K46A 2O8OA 1SBOA 1X9TA 1PGL2 2CGPA 1F4AA 2RR13 1URXA 4NIHA 1SLCA 4UAPA 5FZOA 1IPKA 1BPLA 4FPCA 4QX3A 4RGKA 4E4ZA 1KS4A 5CADA 2WO7A 2PHWA 4NUBA 1TVGA 4M3CA 2JE9A 1RHI1 4UFMA 4W6WA 2X5IB 4MGZE 5A6YA 5JXIA 1EP0A 1AR63 1EV13 1RUC2 5CAZA 1H8TC 1CIWA 1AL21 1Q8OA 2ETEA 2PHLA 3DPRB 5T52A 3WP3A 4H7MA 4ISQA 5JIUA 2VUJA 2TBVA 2JX9A 2HWC1 5DAVA 5JXJA 3AYCA 5JWPA 2PAKA 3RPQA 2R071 1CIYA 2DCTA 3CIHA 3M2MA 1RUF2 5C8CC 4XILA 5CKQA 2VMFA 1NT0A 1W6OB 2PHFA 5FUPA 5FZDA 4BCUA 2JD9A 4GWMA 2BGOA 3VD5A 3BU0A 2WNUA 4E8DA 1CAVB 3FLTA 4D7YA 3AKRA 1J58A 5F3CA 4WM7A 1G9CA 4YZ4A 3KGLA 3HPNA 2A5ZA 4FI9A 3RI9A 3BODA 4BH9A 4AW7A 1REFA 1W6QA 3U14A 3ABZA 1E5SA 3MIEA 5AC91 2VZUA 2ZHLA 1QWRA 2VE1A 1KFUL 3T2OA 3V0BB 3NAPB 1ULCA 1N1YA 1VPHA 4WVMB 3MOGA 2Q1FA 4J6GA 2FCTA 4UF0B 1HKDA 2Y6HA 2CTVA 4B4PA 2B78A 3CQOA 3J26N 4N43B 2EA7A 2IFRA 1J83A 2ZGMA 1L7LA 4NHLA 2XQRA 2VNRA 4IV3A 4YM0A 4YW4A 4LULA 4LTAA 3E6DA 4XFBA 2VXRA 2UYAA 1QNYA 3OBAA 2ZZJA 4MADA 4MHRA 5D8AB 1H2MA 5IK4A 3GALA 3CMGA 5FBZA 3BTAA 1DCSA 3FMGA 1CZSA 2WSVA 3KQRA 5EJ3A 2VW1A 2WYSA 2YFZA 3GZTB 2ZCWA 4NOTA 4MGQA 5DN2A 5ABJA 1SZBA 1LEMA 5EUWA 3HQUA 3D03A 1SFYA 4RS5C 2UY8A 1VAVA 2D6KA 1DGLA 1H2NA 2JDMA 3OGGA 5C9AC 1FPN2 3PTRB 2UY9A 1OI6A 3GM8A 4LA3A 5J96B 5DUWA 3PVBB 4YG6A 3WD5A 2Z4FA 1DYPA 5CG9A 2IXLA 2RM22 4Z92B 2WL1A 3ENRA 2DVFA 4CE8A 2FMDA 2ZHMA 3A22A 2Y8KA 1LEDA 1UKRA 4AHWA 2OA2A 4FXKB 3MICA 1UPSA 3P6BA 2HBTA 1DQ4A 3TN93 3PL0A 1UD1A 1AX1A 3VKOA 2MEV3 4AFCA 5HCBA 4QMAA 3RVHA 1JZ5A 1OOPC 4YGDA 1OBNA 4E2GA 5JSOA 1O8SA 4J1WA 2OW4A 4Y22A 4MGIE 2JDPA 4CEWB 3NNJA 3DUIA 3NNLA 1QJFA 2WQ8A 1R092 2SLIA 3KHBA 2QQOA 4R52A 4U36A 3L2HA 2YC0A 3ACFA 4Q4X1 4XOGA 1Q8PA 1MEC3 1C1FA 1NY72 2VAUA 3LD8A 3VBHA 4WVZA 3QDQA 1HDKA 4MUVA 4EN9B 2HWF2 4QPYA 1MR5A 1WW5A 3OUHA 1S2KA 3D82A 3POSA 1QJU1 2H6BA 1RUG1 1ULGA 2HWD2 5IUQA 3KM5A 4D6RA 3CNAA 3OYWA 4FAHA 4M3CF 5CFCB 1STMA 2QQPA 3DEMA 2GH2A 2ZOEB 1CVNA 3JB8A 1F15A 3M3IA 4BIFA 5BNPB 4CA9A 3OEBA 5HCAA 1AX0A 4BQ2A 4FTEA 1ND3A 1JYIA 1RXGA 3WUDA 1RUOA 3ZXGA 4HN1A 4IE6A 1U5IA 3IHBA 4HYLA 1MVEA 1SLTA 2GNDA 3WP6A 1ZZCA 1R081 4ET7A 1IQAA 5C3OA 4LUKA 3BALA 1HQNA 3IIAA 4KGQA 1QQP3 2EXJA 3KCXA 1YQ6A 3ST7A 3SC7X 1TMF1 2JWPA 2OQ7A 1V6IA 1MS4A 3JCIA 4FFFA 3O1RA 3H8RA 2JDYA 5FY0A 4EYUA 5FMOS 3MEPA 3I2HA 4CDXC 1UOGA 2TNFA 4P9YA 3MW2A 5LK7B 1OA2A 1REEA 2IXHA 3RQ0A 5C5TA 5KC6A 2D3SA 5ERLA 1LRHA 1UYYA 5IHRA 1AR83 2ZMKA 4HONA 5F32A 1RMU3 1HXS1 3VHPA 5DMYA 1UL9A 2VZTA 1A34A 1GWKA 1H8TA 3POYA 2Y0IA 4C8DA 2QNKA 1PVC2 4N53B 3ZN5A 5F7UA 4KG8A 3TRSB 3HWJA 3SMHA 2WZR2 3KD4A 1EV12 2GC3A 1X9PA 2RJ2A 2EIGA 5C8CA 2VM9A 2WFPA 1SCSA 3OJBA 3OGJA 1HRV1 2X29A 2IC1A 1I5ZA 1YXWA 3LIHA 4OI0A 1H0BA 2VZQA 3LOBA 5FO7B 2JB4A 1RGSA 2R30A 5LK5A 5LEKA 3AYEA 3JBG3 3RZMA 3H42B 1UZVA 1WW4A 4XZUG 3OD0A 2ZKNA 5JR2A 4OHXA 2ID4A 1CGPA 5EJZB 3SCHA 5CNAA 4XQWA 1TH8B 2BJSA 1W8ZA 3GBGA 4B4RA 3RYRA 1PIV2 5IVFA 4E2SA 2VBPA 5FP7A 1LKNA 1JYTA 3PUIA 4P08A 4DZGA 2VNVA 1OF4A 1JN2P 1GANA 2AENA 5L19A 1COV2 3JXSA 1XU2A 1FT9A 2KLNA 2BERA 4V2WA 4WVMA 1VAKA 4CTEA 1ENSA 3W59A 1YFWA 3LDKA 2GU9A 2X8KA 1NLQA 1J3RA 1ODMA 3KV4A 2EVXA 5C5UA 1AHSA 1LESA 5BV6A 1UIJA 2XWBB 2DBIA 5LB6A 3WDTA 2VMDA 1WW6A 3HBKA 2G9ZA 4XIKA 4QB1A 5FZIA 4RS5A 5G05L 4IE4A 4LORA 1RUC1 3RZGA 1CESA 2W52A 1VE0A 5C9AA 2RDQA 4EN8B 5K9YA 1GICA 4YGBA 4YW6A 4XXPA 5DAWA 2CWSA 2V73A 2YPJA 3J8F3 3RDIA 3WNMA 1ENXA 2A73B 3LEKA 4NHXA 1B35B 5GZEA 3UKVA 2W08A 1W8TA 1AUZA 1BBT3 1EAH2 2SBAA 3U1XA 2ADDA 3J7LA 4RQPC 3DN7A 5J48A 5KXCA 5GALA 3AVSA 3B7MA 4JRAA 1TNRA 2P4EA 1OOPA 1GWMA 5LRSA 2UWCA 1D2SA 1XE7A 1H4YA 1RVF3 2PAMA 1IG3A 3KV9A 4P9WA 4QX8A 3N3HA 1AYN2 3VL8A 4P5HA 2EICA 2WINB 3DV8A 2RS32 3VBRC 2XONA 3BVCA 4B1MA 1OLMA 1RXFA 1K5JA 5A6QA 4QPGC 3S30A 3BN6A 1ZYBA 2GMEA 1GWLA 2GP5A 1LB2A 2WUHA 2YZ4A 5FZ7A 3RJRA 3ZFEA 5LEJA 3A4UA 2J1VA 3DKQA 4RHV1 4IDZA 4IETA 3KCCA 3IH8A 1K45A 4AI1A 1T2XA 5A7OA 3KSCA 3OTFA 4NIAA 3JQXA 3UESA 2RVAA 2X53S 1TME2 5EUUA 4FPJA 4JKLA 4LNVA 5A3OA 3M4FA 2YU2A 5A32B 2WKKA 4OVEA 4QDQA 4K21A 1F5JA 5E1RA 2YFUA 1JHNA 3S6PA 2O14A 3MFAA 4CUBA 3MFCA 3OBTA 3RZJA 4XS5A 4AAXA 5HPOA 2PHXA 2RM21 1O5UA 1O6UA 3B3QE 3E1F1 4CDXA 4CSWA 4FTBA 1THNB 1X7NA 4YVSB 1UO9A 1KXGA 4Y24A 5FK7A 1G9FA 3C0KA 1WCSA 1C1LA 2IXKA 2JDNA 2FBEA 4G4FA 2VC9A 2QQUA 4GA9A 4GB31 5KBFA 1UZ0A 3EO6A 4A7YA 3TEWA 2VTFA 2FDFA 1OLQA 2BOIA 3D8CA 1YQ2A 2BU9A 2NQYA 5LRRA 4YM3A 3N9MA 1VRH2 3WHUA 1Q3EA 5F3EA 5BNOB 2W1WA 3WF3A 1UF2C 3E5QA 4MXWB 2Q30A 1TIDB 3F95A 4QKDA 2G9FA 3WW2A 5JMOA 1X82A 1ND2B 2ET7A 2IVJA 1UZZA 3GBFA 3AVRA 2GN3A 1WLTA 1HQLA 2WNVB 3POFA 3S7EA 1C5IA 5J98B 1VBB1 2JKBA 3NW4A 3KT1A 5FXVA 3ZKUA 4CDWB 3D3UA 3N7MA 2EIBA 4JTOA 5KXBA 2Z42A 1H2KA 4CCNA 3PIJA 5JUVA 2RS52 1VBD2 1BVVA 1UW8A 3AYAA 3GZEA 2NPIA 1KFXL 1K12A 5EIYB 3ILRA 2JDUA 1VR3A 3WDWA 3WZ1A 1PO23 1XSQA 3GCXA 5FZ4A 3PDQA 3A0NA 4ZY9A 5FLIA 4CCLA 1HB4A 4MHUA 2Y6KA 1UX6A 2VBBA 5AVAA 1S55A 3M8LA 4XJUA 4YPJA 3M3QA 1NA1C 1PX3A 4X6QB 4X6RB 2BZDA 3NNFA 3MW3A 4XDOA 3DYPA 2UYBA 5FYHA 5K8SA 2A70A 1OQDA 1J59A 4N7UA 4LOTA 4YZ2A 3ZXJA 3C8XA 1S4CA 2IZWA 1A78A 4RGGA 4XJ8A 4Q4V1 5BNQA 3VB9A 1GR3A 5HXVA 1FMD2 5FZEA 3NV4A 2B5HA 2WZR1 1O3RA 1HB2A 3ZFFB 4EN7B 3KHCA 1W9YA 2CNAA 4OLLA 2E7AA 4HK8A 3NO8A 1D7PM 2BFUS 3DF0A 1VBC3 2JD4A 3MIGA 1MQTC 3ZSKA 4HPKA 4CU6A 2WA3A 4RQPA 1QMJA 4DXSA 2IWGB 4LK7A 2XPJA 5JI7A 4ATFA 4YG3A 4NIDA 4XFHA 4L1CA 5T5LA 4FCAA 1D4VB 2ERFA 4D7TA 1Y9GA 1A6CA 4LXLA 3B9CA 4AAPA 1W39A 5EJ1B 1XPWA 3P1IA 1EPWA 4YGCA 2VVFA 4AQSA 1V9U2 3GK7A 4BQ3A 1SBDA 1JU4A 1JOJA 1Z7S2 2Z69A 2D6MA 3U4SA 3D3AA 2E6VA 2WFF2 4XUNA 5APAA 1Y9QA 1QJU3 3GHMA 2N7GA 4MGSA 1PIV1 3CJIB 1RUG3 1BVP1 2CL2A 2R061 2UWBA 3VBRA 4QDSA 1SBEA 1YEWA 3BU7A 3CF6E 3PUSA 2O1QA 4Z8BA 2ZGQA 4D3WA 2BPA2 4Y5SA 3VBUB 4QPGA 3CJIC 3JUUA 4TLFA 4F3JA 3D4KA 1NG0A 4BLIA 1CONA 2WLQA 2DBNA 2Y33A 4JHZA 4PIYA 1O4ZA 3VHRA 3ZXAC 1R083 2ZX0A 4FOWA 1XJAA 4RGAA 2R042 4XUQA 5D21A 4CCJA 3CBNA 4LT5A 2Y34A 4FBFA 1G7YA 4ES8A 3VBFC 1QJEA 1LOCA 3QACA 1VMHA 2YHJA 4AVCA 4AVVA 4Z2AA 2AC1A 4OI2A 1JZ2A 3HN1A 1NZIA 5IAXA 4Q4W1 2EXIA 4CXYA 4HK9A 4TZDA 3VDBA 4LHKA 2VOVA 4IGQA 2DTWA 1XBFA 2V4VA 3AZXA 3H1YA 4IW3A 4XE9A 2K2SA 3WNNA 5KHGA 2XOMA 4GH4C 5JIAA 4XZPA 2Q4SA 1HXS3 2VZVA 1PO12 4M4RA 5BPXA 4AK3A 1OMIA 4HVRA 4FAGA 4F8AA 5FKBA 1AYM2 2YYOA 1YJKA 4X8PA 3ZYHA 4WM8C 3ITQA 4HKWA 3SNMA 1LECA 3SHRA 1G6NA 4PLMA 1PM4A 2W3JA 3LF7A 4GMP1 3HAGA 2AS0A 1IKPA 1QOTA 3OY8B 2GP3A 1HRV3 2VY0A 3IDAA 4Y5Z0 3BKZA 1BUZA 3V0AB 2BNOA 5EP9A 1G86A 2RS31 1RUNA 1GQHA 1C8NA 1VBE3 4A44A 3FFZA 1LOEA 2VU9A 3FZ3A 3MPPG 4INDA 2P3JA 2BW8A 2YGMA 2RMU2 4W6YA 5CFDA 3KB5A 4DMIA 5FZ0A 1LU1A 3KV5A 5BY5A 3POBA 4LO6B 3TNQA 1DGRA 2EALA 2OYZA 4UFJA 2RRLA 2JKXA 1SG3A 4KBBA 2Q8EA 2CV6A 2LUWA 2A6YA 5FY5A 2ZMNA 1RUE2 1L7QA 3TEZA 2HWB1 1AX2A 3B69A 4NR1A 1BQPA 4K1YA 4LBNA 1W0PA 1X8EA 4LHSA 1EY2A 2VQTA 4A7ZA 3VDDC 3T4HB 4BXFA 1FC9A 1N1VA 1ZBA1 3AKPA 3K48A 3N9LA 2RE9A 2RS12 1O4YA 3U10A 5E88A 2XJQA 2VUCA 4Q0SA 4DNYA 3GF6A 4JKMA 2C9AA 1ZA7A 1IKQA 1BEV2 3AMQA 3GNEA 1PK6B 3PURA 1W8WA 1XRUA 2X05A 3F2ZA 1PO22 2Y64A 5FZBA 3H3UA 3NV2A 3VDCA 3W5MA 1NA1A 2JE7A 2B4KA 1VLNA 1DGWA 3LB9A 4O61A 4HVQA 1DZRA 3KS7A 4XF4A 2DU0A 2P3KA 5C8WA 1ZZ6A 5FZ1A 4FVVA 5CBLA 5L36A 1RB8G 2EAKA 3PNAA 4N8MA 4I30A 5FFOC 4COZA 2E26A 5GKAC 1XU1A 4AEKA 2PYTA 5FYTA 4FPHA 1O7FA 5F37A 2G1MA 3V97A 5FPUA 4YFWA 1UZWA 1AJOA 2D44A 2BGCA 4I3PA 1AR73 2PMWB 3RGBA 5GLTA 2YC4A 4Y4RA 3FN9A 1OPOA 1MQTA 2LRPA 5LATA 2H0BA 2BV4A 3I59B 1YHFA 1WGPA 5BNNC 2DUQA 1W6NB 4XIOA 1VBC2 4AI9A 1NCRC 1ENRA 3SCGA 1P8JA 3V8VA 1N3PA 2VH9A 3KZ4C 1IHMA 4NE9A 2RS51 1U12A 1H1MA 3IPVB 4AF9A 1EPZA 1NUKA 2H6CA 3M1HA 4IESA 2B46X 1CAXA 4QPIC 5F6LB 2QFEA 2TEPA 3S57A 1G9AA 3PUHA 1XSRA 2FCUA 3ZSMA 1JH5A 5JZGA 2V5DA 3UV9A 1DGRN 4RHV3 2DU1A 2J1SA 2PFWA 2BQPA 3J7HA 3S7IA 3DXUA 5L7OB 1Q8VA 1WMXA 3NKGA 1Z0HA 3KCYA 1CAWB 4DXTA 2VZRA 1JZ8A 4FP2A 2VL4A 3BTXA 4IEPA 4LMFA 4RFRB 1N1SA 3MLKA 2ZKLA 2IVIB 2NM1A 3VBFA 1W3XA 3GJBA 4XPVA 3O5SA 4FOQA 1YNAA 3BUCA 2EAAA 3MO4A 4Y1ZA 4AWDA 4PDWC 3NQHA 5JVVA 3I3MA 3R6SA 2HEYF 1QXRA 3PVOA 1PGSA 2WT0A 4UW6A 5F3IA 3MDPA 4YARA 4S2HA 4LBLA 2QDNA 2BUKA 5DZEA 2WSUA 4FO9A 1FMD1 2QKDA 3NJVA 5FZHA 2QQJA 3RZHA 2VUAA 1DF0A 2E53A 5E16A 3U78A 5FR3A 4GH4A 2WO2A 5FZKA 3BGAA 1V0EA 4OCTA 1LHNA 3A23A 4YW1A 3RZLA 1SPPA 4PBOA 2JG9C 3PMSA 1JBCA 1YQ8A 1D4M2 3GCWA 2FQPA 4WM8A 5FZCA 1JOPA 4Y1UA 1DYKA 1ASJ3 1YFXA 3ZYBA 5JCTA 1MS3A 1W9SA 3Q8FA 1KGYA 1XNDA 1HW5A 1Z7S1 1DZQA 5FZ3A 2WN3A 3LFIA 2WFF1 2DDUA 4RR3B 5A1LA 1QJY1 2ZGRA 1JYNA 2ZHKA 2ZACA 4GJZA 1VBB3 1LOAA 1APNA 2Y6FA 3O1OA 5JAXA 4IEWA 2VOXA 5LWBA 4QQPA 2VNOA 4UXAA 4AGVA 5DDJ2 1CX4A 4A2UA 3JQWA 4KI5M 3LLOA 4XFGA 1GP5A 5FTTC 2NLRA 2K0GA 2W92A 2YUEA 3TNPB 4RD7A 4OZOA 1RUD2 2R041 3BPSA 1RL3A 5L9VA 3U11A 1VMFA 2CY6A 4AEDB 3IN9A 4W50A 2ZGLA 1POV1 3G6JB 4UW3A 3OPTA 1QOSA 2D5HA 3OUIA 3P3PA 2VMEA 3VDDA 1H6YA 1PX4A 1AR92 4FFGA 3M3CA 4MOAA 4XJ9A 1F2NA 5I0UA 3J9SA 1QJX1 2R1DA 4DFSA 3LDFA 1CZVA 4QXCA 4BWOA 1N6DA 3ZYJB 1PMJX 2BWAA 2X5IC 5FMCA 4YW5A 3PHMA 4OI4A 4JQTA 3K77A 3K50A 2XJSA 4YLZA 2JJ6A 5JXHA 1TG7A 4NPMA 3DPRC 4LA2A 1ZRIA 3DKWA 2XLAA 4XFAA 1PO11 3IKWA 4CUGA 1PM7A 3CHXA 4LHLA 3RMXA 1S2BA 1WA6X 5IYYA 4CZSA 1RUJ2 5H9QA 5HBAA 1REDA 2ZEXA 1DHKB 1AYM1 1OFNA 2DV9A 1HX6A 3OPWA 5DXDA 4QB6A 4MGYE 5TSWA 1LHWA 2YG0A 1CAUB 3QBQA 4KH9A 3ZN6A 3EH7A 4CP9A 2XL7A 2Y26A 3JD72 1D0HA 2PQSA 5J36A 4ASKA 2FD8A 1VBA2 2OPKA 1DQ2A 2Y6JA 3MHZA 1UXXX 1W2AX 3WLUA 4L92A 3WG2A 4B3NA 3PU3A 2B9VA 2CAVA 3VSEA 4CCEA 1R64A 1BMV1 3N9QA 5L9BA 1OH3A 3ZSEA 3GZAA 1CWPA 4Y1YA 1GLHA 4OMCA 4XUPA 3ZM8A 5H9RA 4CEYB 5KXEA 2PTMA 3ACHA 3NAPC 2RMU1 1OVPA 2NP0A 4OHWA 5BNNA 2JENA 5T54A 4ZS3A 1HN0A 1NCRA 1UKGA 2QJVA 4N43C 2BWCA 3NMBA 1WUVA 3OG2A 2YMZA 3CZJA 2RG4A 1YCIA 2LTNA 2WAOA 4AGRA 1RUE1 1CJDA 1C8M1 4MO3M 4YVWB 5FZ6A 2ZS6B 4KGGA 1NKGA 2XVGA 5D8AC 4R8HA 4QPIA 4Q8KA 3AL5A 1MZ5A 3IWZA 1LOGA 4XC9A 1FOD1 1AZDA 1XNCA 2IXJA 3AYDA 3LAGA 2RS11 5DAPA 1UMZA 1YQCA 4YVWC 4YW3A 5K7PA 3SH4A 2ARAA 2E9QA 1LHVA 3WF4A 1WMDA 3MIFA 2V5YA 3BPZA 3MIDA 2LROA 3LCPA 4QB2A 4XURA 1NOVA 5FPVA 4Q2FA 4D6SA 2PQQA 3WNPA 1QY4A 2FHRA 4Y26A 4COVA 1L3JA 4W8JA 1RUI1 3GVLA 3ZLIA 4XABA 2DWRA 4Q4W3 5FZLA 2BNMA 3USUB 4YZ1A 2OIIA 5FUIA 2HWE1 5ACA2 2WLPA 3NV3A 4Q4Y3 2QQMA 3THTA 1S1AA 3K4AA 3M70A 3POEA 4Y1VA 3PLQA 4PDWA 5IVEA 3POWA 4N9IA 2DFBA 4HXCA 4BU2A 5T50A 2VZSA 3ACGA 1XC6A 1ZVFA 2OPWA 4KU8A 3FBYA 4NRQA 5IJRA 2QVSB 2RJKA 4LE4A 4PIZA 5T5OA 4B29A 4TN7A 4Y4YA 4K8RB 3A21A 1OHFA 4YWAA 3ACLA 4AFBA 2XBO3 4KWLA 1NE6A 5FJKA 2VQAA 3NY7A 1FV2A 4CEWC 3NKTA 4JVAA 4BQXA 2HLEA 4DY5A 4IEZA 1UQXA 2W95A 4PF1A 1UY3A 2JG9A 2VO5A 3WQ1A 4BDVB 2R32A 1SACA 2VD7A 1T6RA 3GJAA 1KJRA 3WW4A 4QAWA 2ZAAA 3NWKA 3ON7A 3VKMA 2A75A 4IGOA 3WT3A 2GMPA 5GLUA 5CFCC 3SQOA 1EUUA 2EIDA 1GOFA 4AI8A 4ARXA 4XBQA 5BNPC 2GNTA 5E8AA 1LGBA 2JG8B 1PGW1 2XLGA 5FLHA 4AHXA 1JYWA 3H7JA 1DZTA 2WS92 1QXJA 4W4ZA 4OULA 4CDQB 1RJ8A 1WBFA 2P1BA 5F2SA 5F2WA 3W21A 4I01A 1B09A 1V6KA 3SH5A 3WR0A 2P17A 3BB6A 3ZXLA 3NNMA 2HWB3 1HRI2 1W6PB 4QT6A 4AEMA 5FMOL 1R1A2 3NRUA 3ZXDA 1JUIA 1LGNA 4ZKTB 1ZBA3 4IL7A 3ZXKA 4GIQA 1OSGA 2RR12 4AGGA 3OIRA 2VY9A 1JMUB 3R4UA 2BNNA 4EWAA 5LA1A 2K46A 1YIFA 2IUWA 4KQ7A 4QKNA 3URFA 3VKFC 1TNFA 2BOJA 1W2UA 2MNGA 4JGYB 5IAVA 2JDKA 5L9RA 4XQDA 4ZU7A 5H9SA 3WP4A 4AXOA 3A0KA 3KV6A 4LUMA 4XYXA 5EZWA 2X5IA 4OUEA 1Q43A 4D8MA 1AR62 5JOXA 4ZHNA 1K42A 2AR6A 1YFUA 4C91A 3DPRA 4LLFA 4N53C 3N9NA 5FXWA 5A1AA 1OC1A 2XMLA 2YGLA 2C9KA 4IEUA 2C0ZA 1ZBE3 5ANQA 4YYOA 4BQ1A 4HKOA 1ULEA 3WCSA 4BB3A 1W6OA 1NCQB 3KVAA 4FP3A 1XNKA 3UYJA 5GZDA 1CAVA 2PLV1 4XW3A 5T55A 3ALQA 1QEXA 3UGGA 3ZIWA 5F9TA 2A3YA 2ZGNA 3ZYPA 4BLJA 4UFKA 2A1XA 3EXUA 3W20A 3RSJA 4YSFA 1CJPA 1RUH3 2VMHA 1AJKA 3ES1A 4PQ9A 3T2QA 2I2SA 2PXJA 1C28A 4A41A 1O5LA 3TEYA 2OX0A 1OQ1A 3C2UA 2B7YA 4K6BA 2PHUA 3DYMA 5F3GA 2QQLA 3V0BA 3NAPA 2JIJA 4L8KA 1H4HA 1U5XA 2E7TA 2F6BA 5FV3A 5ANNA 5EUSA 3I3QA 3POJA 4IE7A 4UF0A 1PGL1 4IV1B 3ZKYA 3AKSA 4N43A 1FXZA 2ZBJA 2WA4A 5AVPA 3PJYA 3WVJA 1V6JA 2WT2A 5FIXA 4R9DA 4YGEA 1V6OA 4IV1C 1UMHA 3KQ4B 1RC6A 1ZRFA 3FHQA 3LPGA 4YNIA 5D8AA 1JU3A 2Q1MA 5J7MA 3W5NA 5DUXA 5FBJA 2WO1A 1XNBA 2WR9A 2XJUA 1AR91 1HIXA 2XUMA 3B94A 3I3BA 4KBZA 3T0BA 5G04L 4GJYA 1UZYA 2WC2A 1GZWB 3MGUA 4I0BA 5FY4A 4LBQD 3V64A 2VOWA 4KWKA 5FREA 1M06G 5CIRA 1NQJA 2VMIA 2WQZC 3MGLA 1RUF1 2VJXA 1Y7BA 4KU7A 4Z1VA 3I2DA 2ZGSA 3BI3A 3MW4A 1W8NA 1RUJ1 1B35C 1W90A 3I54A 5F5CA 4M4PA 1PZ8A 3DL3A 4M0NA 5J3UA 3TN92 2KA3A 2MEV2 3JD71 1JYCA 2OXBA 4NRMA 5LA2A 5T5PA 1K5MB 2JB8A 3IAQA 4W6XA 4XJZA 5IT6A 2NYYA 5JMCA 2PHDA 4BE3A 5GZGA 5I0TA 1OA3A 5EQUA 4DMGA 1H1IA 4CEWA 2DVDA 3T1MA 1LOFC 3QH7A 1F4HA 1YI9A 4XF3A 3I2OA 1OKOA 1MEC2 3ROUA 2W68A 5F8PA 2WAAA 4DEVA 1SEFA 1T6BX 3MV01 2CWMA 2VW2A 3ZPOA 3LZZA 3FC0A 1GSLA 1H6XA 2Z2SB 3DGTA 4HETA 2VQ0A 2W94A 3LFMA 5IWFA 3VGIA 1QJY3 5KR7A 5CKNA 2ATFA 1DGWX 2ORZA 3BIWE 4FSJA 3MIHA 5C3RA 3AMMA 3NSTA 4IEOA 3N9PA 2R6QA 4QXHA 3SKVA 1ZZ7A 4XBLA 3VBOB 5CFCA 2XH6A 3KT7A 3M3EA 4P02B 5BNPA 2DCKA 4AHZA 3J7NA 3I7DA 3RG0A 1UY1A 2IFWA 1WXXA 4UT5A 4XETA 5DZGA 1W9TA 4E4HA 4E2QA 3H7YA 4WBBA 5EPAA 4DS0A 4FTSA 1FPN1 2GZWA 1LHUA 4K40A 1YIPA 4BISA 2WWSA 4XAAA 3MV11 2WNEA 5SV5A 3CJXA 1LODA 1POV3 2EIEA 1LGCA 1QQP2 4AFMA 1XYPA 2RHPA 3RNSA 1LU2A 1RHI3 2VTXA 2WZEA 5C4WB 5KHJA 4I2OA 1QGLA 1UYPA 5SV8A 4J25A 5T5JA 1IS6A 1MZEA 1AL23 1QJX3 3R4SA 5D1IA 2VUDA 1FCFA 1W0OA 2HWC3 2VCMA 4GKXA 4YVSC 2FDIA 4QTPA 3ETPA 1UPIA 4FPFA 5K0UB 1OA4A 4ZZ5A 2R073 5A3UA 3L2YA 2VZPA 3RWKX 4WV8A 1AR82 1OLRA 4NVPA 4B4QA 3ZXNA 2BBVA 4RN5A 3DJAA 1RMU2 2ZEWA 1FYUA 1R091 2VOKA 2UU8A 5FZGA 1S0DA 1MS1A 2FMYA 2ZX1A 3NV1A 4YZ3A 4ZZ8A 1NY71 1ZZ9A 4R4ZA 5JR7B 5BNOC 2HWF1 2DCJA 4N53A 5CG8A 1MZFA 2MHFA 4ZU4A 4EV0A 4Y1XA 1SDWA 1YRZA 3SITA 2AGSA 2BDRA 4K20A 5IK8A 2HWD1 4QX2A 5FP4A 4DY3A 1ND2C 5E6HA 4EJRA 4S2FA 3ZFGB 2ZPXA 4ATEA 2XJVA 3O1MA 1UY0A 5AC93 1PMIA 1FV3A 4QHZA 2WNVC 3ES4A 2XGXA 3KLSA 3KT4A 2ORXA 2CGNA 5EYYA 3ZIXA 4CDWC 1OXCA 1GMMA 3VZJA 3ZVXA 2DVAA 4GHNA 3ATGA 2KR2A 1IOAA 3JBG2 4H3WA 1DQ5A 3CL1A 1W99A 1OPMA 2EXKA 2JDHA 1GQPA 2RDNA 1SBFA 5LW9A 3IF5A 2YY1A 4HFSA 4JV4A 1ULDA 2G4IA 3JU4A 4DUWA 4URAA 4Y5TA 2A6VA 5FY8A 4HMZA 1IS5A 2QDRA 3VZOA 4L99A 3LSEA 4LLOA 1ULOA 4H2AA 2ZMLA 4A42A 2DCZA 1YUDA 5FCCA 4DIQA 1C8M3 3AKQA 2GC2A 4K8FA 4Q26A 1R1A1 1NXD1 2XDVA 4AVSA 5FAXA 1JI6A 1ACCA 3BIEA 1W28A 3LQCA 1KEXA 4PIXA 3WQ0A 5AFEA 2QQNA 4KNCA 3UL2A 3PIGA 4XAEA 3VZLA 1UU6A 4D94A 2CYFA 3E6CC 1US2A 3AP9A 1RUI3 1PVC1 2B9UA 3J4UH 1TILB 4PHZA 2D98A 4XDQA 3N7JA 4B7EA 1AR61 1EV11 1N3OA 4OMDA 4AYUA 3VD4A 1IQDC 4HG6B 5JDBA 3PUAA 1UMIA 4GWJA 2BFUL 2IXIA 5GLZA 3J8F2 1CQ9A 3ZFFC 4QGMA 4OHZA 1FC7A 2RV9A 1W6MB 2XJTA 5C7GA 1B35A 1HN1A 3RYKA 4AVAA 1WCQA 3UT0A 4DRVA 1BBT2 5JSRA 2WWUA 5FYVA 5K4LA 4Q4X3 1SHWB 4XBNA 5FO8B 4BQ4A 1E5HA 2E7QA 4P14A 1VC1A 3D5OA 1I6XA 3BOWA 3UNPA 4N90A 3N7KA 4XMIA 4AG4A 3HEIA 1RVF2 2V09A 5FXZA 1IGOA 2XB6C 1U5ZA 2ILMA 3AMNA 3DUPA 2ZEZA 4TYSA 5DG1A 2FZ1A 1LOFA 2FDGA 1COV1 4JGZB 1BLZA 1JOBA 1OD3A 3VZNA 4XEZA 2R7EB 5LBCA 3IH9A 4MH0E 2W39A 2ZGPA 1VIWB 4V1PA 4FXGB 4CPBD 4LHNA 3VBUC 1G9DA 4GWNA 3FLRA 1GNZA 4RA0A 4GQ7A 1IG0A 1GZCA 3LIGA 3GMFA 2R0FA 3RZZA 1WCUA 3LDRA 1V6LA 2OVUA 5FZMA 1TMF3 1X36A 1H9PA 2PELA 2HEWF 4META 5T3NA 4AEJA 1LAJA 2WZ8A 2BEOA 5A7WB 3KMHA 1WXWA 2OT7A 1J1LA 4JC0A 1BK0A 3OGVA 3SLIA 2GDFA 4GXLA 4CDUB 3O1VA 5FYUA 2J1TA 1FATA 1CPMA 1WWYA 3HQRA 3K3NA 4LKFA 4X8NA 4XJAA 3QH6A 2LM3A 1UN1A 2D43A 3G7DA 5A32A 1O3SA 5A7SA 1UNBA 1EAH1 4Y20B 1UXZA 2VCBA 1N6EA 3QD6A 4BQ5A 5A33B 3IMMA 5FZAA 1YLLA 4GD4A 2XG3A 3GVJA 4PQQA 3LEGA 2VZ1A 4W65A 2QQIA 2BRTA 4LBOA 2VBDA 4YVSA 3WDXA 4FT8A 1Y9MA 3ZR6A 1QF3A 2YROA 3GZUC 2E31A 4AR2A 1AYN1 1W06A 1JZ6A 4XFIA 1A8DA 1C57A 2FCVA 3E6BA 5FQ0B 4YRDA 3VBSB 2WRAA 4HVOA 3SXWA 1YQ5A 3FUQA 4JTNA 2UWAA 5FY9A 5BNOA 2YBSA 3IBMA 4NROA 4MXWA 3QLQA 1GOHA 5IK7A 1S0BA 3Q8EA 2NMOA 5FO9B 2BYVE 2PLV3 4B1LA 4PLOA 1ND2A 1PZ9A 2R1BA 4CU7A 4Z2WA 5GJ6A 2B45X 2WNVA 1YYNA 1F8VA 2WWJA 1WLDA 5A7PA 1K3IA 4CDWA 4LBQB 5FKCA 1O59A 1MZ6A 4FQ4A 4QKBA 1TME1 2ARXA 1POV0 4HIZA 3GXUA 1UY4A 3VV1A 1WMFA 1ZZBA 1E5RA 5FZOB 5J37A 4FPYA 2HYXA 4NRPA 2Z5WA 4EZ4A 4IEXA 2DF7A 4O7XA 4D0QA 1CX1A 1S0CA 2QBXA 5BXXA 3ZOIA 1QQP1 4M3CB 3NJYA 5FP3A 2JIGA 2Q0AA 5GM0A 1W2TA 4PJYA 2C26A 1PK6C 1RUC3 4MSVA 3HD8B 4RSUA 4H55A 3WINE 2YV8A 1DBNA 1UCXA 4XHXA 1DLLA 3FE5A 4MVTA 5I0DA 3B93A 2W5FA 3WG4A 5ISLA 1W9FA 4L0PA 1RUF3 1AXKA 4H7LA 4IEYA 1VRH1 4L97A 4Z82A 4NHKA 1RMU1 5IVYA 1Q8QA 1I5PA 1S0FA 3UJOA 3ZR5A 3WNOA 5FOBB 2WNUB 5LBEA 4XCBA 3AGEA 4S2GA 1BXHA 3FHIB 3PVNA 4EWEA 3CO2A 5FWJA 2D5FA 4LO5B 4WM7B 4XACA 3UKNA 1SQ4A 2XJPA 3IDEA 4MZUA 3ZFFA 5CU1A 4QGLA 4AI0A 4D7SA 1W6QB 2W91A 3T6OA 3MLLA 4UW4A 1DDLA 4V2VA 1FNYA 1XXNA 2UURA 1X50A 1E5IA 5J09A 5IW0A 3FFQA 2J1UA 2GN7A 5JI9A 1VBD1 1HJFA 4P9JA 4Q4X2 1SFNA 2XJRA 3WDVA 4C90A 3M7AA 4IV3B 2CHHA 1W8HA 2A71A 4TLGA 4YZ5A 5F6KA 1IPSA 2J1RA 2OS2A 3T09A 5DAQA 4MG2A 1QJU2 1RUG2 3CJIA 1NYWA 4Q0QA 3ZMNA 3O0XA 1NE4A 2D6PA 4A45A 2VULA 5ABJB 3B01A 1LR5A 1O4TA 3VBUA 3FWEA 1MS9A 5DUUA 3WW1A 4HOOA 4LOSA 2B8MA 1OVSA 2VZOA 5L7OC 2AUYA 3I2FA 4KWJA 1H9WA 4DINB 3IHAA 1R082 1FPN3 4JDOA 2P37A 1S0GA 3O1TA 1CZTA 3OBRA 4QQ2A 5DG2A 2W2IA 3ZYFA 4LQRA 3ZYRA 5IVJA 1UWWA 2RM23 2NZ9A 1Y43B 3C7GA 1TMF2 3HVDA 2XUEA 4QQOA 4DQAA 4CCKA 5IFTA 4Q0PA 4XUOA 2E51A 5B2GB 4GB33 1W03A 2ZEYA 2GAUA 1OLME 3ZXFA 2WJSA 3GHFA 2W1QA 4MLOA 1OUSA 1OQEA 1QH7A 5JSPA 5FOJB 3J8F1 1ZNPA 4Y22B 3QCWA 4R9CA 1PHMA 3WV6A 1HXS2 5F5AA 2Z79A 1ALYA 1S0IA 1GQGA 1R093 1UU5A 2D40A 3P5BA 3T0DA 5FRAA 5B4NA 4WZFA 1H30A 1JYVA 3VBHB 2XVLA 2XR4A 1V9U1 3MPBA 4FPLA 3OGRA 3IDBB 5A7NA 2HWF3 2G9GA 1KQRA 4P5YA 2D3PA 1RVF1 2C24A 3EQEA 1QIQA 2HWD3 3POGA 2OUHA 2CDPA 4BQYA 4CUAA 3OYWB 3MIBA 4BOWA 2O8QA 1XYNA 3OY8A 1U5YA 1SDDB 2YDEA 4P00B 3WW3A 1HRV2 4JAAA 4RR3C 2XKPA 2Y6LA 5FK8A 4CXWA 3V0AA 4TTGA 1ND3B 2Y38A 1VBE2 2ARCA 3SCFA 2YPDA 4Q1RA 3KF3A 4QU2A 2DUPA 2VNGA 1EUTA 2QE3A 1MS5A 1YC61 1F5FA 1AXYA 2LALA 4M00A 1GBGA 5I0RA 2WNOA 2OKXA 4DXRA 4E27A 3VHOA 4AEDC 3B00A 2OZ6A 3TYJA 4Q29A 2J1AA 1PVXA 3H9AA 3H0OA 4BZ4A 1H4ZA 5BYNA 5JPMB 1F9KA 1YWKA 4P9XA 3R0RA 5EYXA 4JHTA 3SEEA 1WLCA 4E8CA 4GKYA 4LO4B 3U75A 1ZRCA 4AQTA 1PK6A 1H8TB 4I02A 4Q4V3 3JZVA 3OPZA 1PVC3 1T6GC 3AXDA 1W3VA 1YO8A 4LE3A 2ZGKA 3RWNA 1HV1A 1Y4WA 2WZR3 1XQNA 2X09A 3O1SA 1C3HA 1AXZA 3I2IA 2DVGA 3V56A 3WF1A 3T30A 2XXZA 3WSOA 4AVBA 3DYOA 5C8CB 3GHNA 3F43A 3UK9A 4OHYA 5EV7A 2ZX2A 4IGPA 4ASMB 2A6ZA 2JDAA 4AVTA 4BYYA 5HCHA 3CZUA 5FPZA 4JDMA 4EZHA 1ZX5A 2JDZA 1UOJA 1HLCA 2D97A 2WABA 3FUOA 4U2AA 1HF2A 4LO7A 4YW2A 1J84A 3WP5A 5KC5A 3FX3A 3K75B 2DXLA 1ZRRA 2FZ2A 2PAEA 2RDRA 4E9KA 3OUJA 1AR72 3THPA 5A3MA 2J7MA 2QZ2A 1ULFA 5EWSA 2ZTNA 1JS9A 4QQHA 3VKLA 3EBRA 5KHHA 5I0SA 5L73A 1PIV3 2R063 4CEYC 4IEQA 3I59A 4IE5A 3TEXA 3IAPA 3IDCB 3RFRA 5LCWL 4Q0UA 3C3VA 5FUNA 1JHJA 1LCLA 1W6NA 1TE1B 2VECA 1COV3 4QHBA 4QKFA 4UYBA 4UBGA 2XQXA 5FZ8A 4D6QA 3IB3A 2AH2A 3JU9A 4OYUA 4DB5A 5I93A 4D69A 3T3YA 1XOYA 1XE8A 1NAEA 1IPJA 1EYBA 2ADEA 2NN8A 2W46A 3IPVA 3QOPA 3ZO0B 5HI0A 4NIGA 1AF9A 1VP6A 4YM2A 1G8WA 3D0JA 3LSDA 1VJ2A 5IK5A 1BEV1 2VPVA 2MPFA 2PA7A 2PN5A 3VD9A 1PO21 3WNKA 1N6FA 4ITCA 3HIFA 5KHIA 4RHV2 3K3OA 3I3EA 2DURA 1V0AA 4RS5B 5FPXA 5L7OA 1WBLA 2HBUA 1CAWA 2ZHNA 5FYYA 1OF3A 5A3TA 1QDCA 5C9AB 2BBAA 2VVDA 4A4AA 3H8UA 5EUXA 3HT1A 2EXHA 4JX0A 1EAH3 2ZOAA 5LA9A 3VKNA 5LZ6A 1MPXA 4QPWA 1MVQA 4JQRA 2P34A 4LIVA 4XFFA 3H8OA 4PCRA 2ZA9A 1OOPB 1QDOA 3B02A 4GMP3 4GB32 1ONAA 4IQPA 1AYN3 2A3XA 1QHDA 3VN4A 1QJZA 1VBC1 3M3OA 4MGKE 3VLBB 3VD7A 5I8TA 3TB0A 2RS33 3VZKA 1OD5A 3AXEA 3RS6A 4ARYA 1XNTA 4ZXEA 4RL7A 4DGHA 3LA7A 1AL0G 2VW0A 1ASJ2 3DORA 3IMNA 3PJQA 1C4RA 2C5DA 4DEQA 4M0HA 2ZGOA 2YXSA 2GC1A 3N9OA 3S5AA 5C33A 3MZHA 2BVBA 3ZFEB 5KHKA 4ZS2A 1PNFA 4CCOA 1BK1A 2JG8C 4RR3A 1AVBA 1V70A 5GZCA 4LPLA 1VBB2 4NHYA 3HJRA 1RITA 3ZFEC 3WDUA 2DVBA 4CDQC 2CAUA 3ZDSA 2HYKA 1TME3 2A3WA 3DCQA 4CCMA 2Y0OA 3LGRA 5LBBA 4DRRA 4L11A 3WF0A 4COUA 2F17A 2ZXQA 5KWRA 3K4DA 1XE0A 5FYIA 4C1XA 1PZ7A 1ZA4A 4COYA 2BP6A 4A3ZA 1H8VA 5CB7A 4BA6A 3ILFA 4AEDA 4Y33A 2C1FA 4CDXB 1YJLA 4UFLA 5FWEA 1O3TA 2VTXJ 3EMRA 5FXXA 1J7XA 3WHTA 2I45A 1FNZA 2VQUA 4JGYC 3AX4A 1ENQA 5FPLA 1W2OA 1UYZA 1US3A 1DYOA 4O9GA 3LKJA 2Q8DA 1DU3D 3TBDA 3ZSLA 2QQVA 5JOZA 1VRH3 1D4M1 4CU8A 3BTYA 1H2LA 2F4PA 4LITA 1NLRA 2VXJA 2PHRA 3KWVA 4TXWA 1TZOA 4Q4V2 1VAMA 5A3WA 5I91A 4R9AA 2OQ6A 3ME2A 4LBJA 3MF6A 1NCQC 2P6HA 4BK4A 1GU3A 1CAUA 2Q8OA 1LULA 2CWWA 1SLLA 5JLVA 1VB4A 5FPBA 3UETA 4QX7A 1VB2A 3AKTA 1NLSA 3BOPA 4K3UA 4A3XA 5DDJ1 3EB7A 4QM8A 1VBE1 2VOTA 3FJSA 2RS53 1VBD3 3R4DB 4CPBA 4F7ZA 3CEWA 4AHYA 2VR4A 1DG6A 1JZ7A 1RUD1 4CEYA 1W0NA 3K4ZA 3KGZA 3MUY1 4TWTA 4OHVA 4F83A 3I4IA 1GP6A 4FPGA 3OSDA 4NPLA 3ZXEA 5LY1A 2R062 5AFBA 2R0HA 1LNSA 4HT1T 4QGNA 3WG1A 2ZO9B 4MX3A 4XXAA 1ZRDA 1QH6A 4LJHA 4AQ6A 2DTYA 4YVWA 4XF9A 1NXMA 4S2DA 4H14A 4CCCA 1I9RA 3GBWA 1GZ9A 4QDRA 4E4SA 5DUVA 1WKYA 4XF1A 4Y3OA 3WG3A 4BQWA 4P9IA 2VMGA 3H3ZA 4FPKA 2FDJA 3THDA 3MF9A 3LEIA 4UI9L 2BVVA 1FMD3 3NVCA 2VZ3A 1KS5A 2GSYA 4XF0A 4Q4W2 2R16A 3VHNA 1RTVA 3MLJA 3USUA 3FBMA 5IFPA 4P9GA 1DQ6A 3IM0A 4Q4Y2 3IIIA 1GNYA 1BHGA 1VBA1 4HPKB 5HCFA 3AZWA 3OEAA 4DPNA 4RQPB 1O3QA 2KA5A 1X8MA 4NPRA 4TSVA 3C7EA 3ZX7A 5A70A 4NJ4A 3PTYA 5LBFA 3O0VA 4AOCA 1K5MC 1VRBA 5CA6A 2VCCA 5JXGA 2JE8A 2XBO2 4NWVA 2WBKA 5FPAA 3PVEA 4LKEA 1V9U3 2DFCA 5FMDA 3AP7A 1QKQA 1AR71 1Z7S3 2E32A 4NO4A 4R4XA 1KD7A 2X10A 1Y3TA 5FLJA 2WFF3 2D93A 1V6MA 2NMNA 2RDSA 1I1EA 4B7KA 3AP5A 3VBRB 3Q9OA 1O8PA 2D6NA 3WUCA 4GULA 3BTZA 1RYYA 1DFQA 2E63A 1LJ7A 2ZGTA 3N35A 2XWJB 1SCRA 3CLPA 4FQZA 4QPGB 4KWUA 4CRQA 3I49A 1FI2A 4Q5OA 3WOGA 4PLNA 3VBOC 3AGDA 1W8OA 1NZCA 3Q8CA 3OB8A 1MS0A 4NIIA 3AFGA 2JXAA 2OZJA 5LY2A 1ZM1A 2JG8A 2JICA 2R043 3OF1A 1BYHA 2G19A 2W0XA 5JPNB 4EWDA 2WDBA 4CDQA 3HN3A 4HSJA 3MBWA 3B9IA 2J1EA 3P3NA 2V72A 4AI3A 2Y60A 3I3DA 5ACA1 2HWB2 1W6PA 3IT8A 3ZDVA 2VVEA 4OQ8A 3WCRA 5D2AA 5C4WC 4R9BA 1ZBA2 4GALA 2GNBA 1PO13 3C7HA 3O7OA 2XKOA 4NN0A 4GMP0 4A6OA 4IEVA 4C0HA 5K0UC 1OURA 3AZZA 4JGYA 2B42B 1AYM3 3AZYA 3AP4A 3H8XA 1Q56A 1J1TA 3WXPA 2E33A 4NMIA 5GZFA 3RYPA 5KXDA 4G3YC 4IE0A 4OUMA 5F39A 4AI2A 4CP0A 3PU8A 4GAZA 3RZKA 4ZXKA 4DOUA 5JOWA 3H50A 4ORFA 4G9SB 4CP1A 4LKDA 2CSGA 2D6OX 4OFGA 1DQ0A 3N4MA 1W2NA 3LEMA 3HMYA 1GNHA 1ZBE2 2KD7A 1CPNA 1IS3A 1LHOA 1TEIA 4M3CE 3GDBA 5FY1A 3V65A 3ZFGC 4BK5A 1GV9A 2ENRA 1NCQA 3O1PA 3RJ2X 3PUQA 1ASJ1 2FDKA 4HN0A 2ZABA 2RMU3 3EYPA 1W05A 2PHTA 1JUHA 1DQ1A 2ZZQA 1VMJA 3T4VA 2WS91 1WD3A 3PMEA 3DECA 5HV4A 3BCWA 3SKJE 5C3PA 1GKBA 3AFKA 2K9ZA 3O12A 1RUH2 4O9EA 4KG0A 5EXOA 3OIZA 5CFDC 1LOBA 3OCPA 5C3SA 4K1ZA 1RUE3 1WMEA 4PBPA 2D3RA 4QXKA 4NWWA 1SLAA 5C70A 4Q0VA 3VUOA 2J22A 1HRI1 2C6SA 2KM2A 3Q8AA 5FYCA 5A6ZA 4OUSA 4AE2A 4YM1A 4CXXA 4K7JA 1FOD3 2W9XA 3LWCA 3WQ7A 2Q1ZB 2RS13 2HH9A 2RR11 1F35A 1N3QA 2W47A 4IV1A 1OKQA 4QXBA 5LASA 4BMEA 1BEV3 5FYBA 3MI8A 5FYZA 3SH3A 4COWA 1ODNA 2XLFA 4I09A 4LEJA 1D0GA 2I74A 3AJYA 3D6EA 5LA0A 3GGLA 1NA1B 4JRLA 4BXSV 1C5HA 5DABA 1WA4A 4K9SA 2HWE3 1JZ4A 3RI8A 3GVKA 3S5QA 3KVBA 2QCSB 3FHAA 4CVUA 1L7RA 1GZWA 3HOBA 1UIKA 2V4AA 3OBZA 4OI1A 4XTPA 1KITA 5EHDA 4AQ2A 1WD4A 3APBA 4YW7A 4CYDA 1XYOA 1Z78A 3BYWA 4XVHA 1FX5A 4XTMA 5DZFA 3E5UA 2DXNA 4QX0A 1CD3G 1QXPA 1V00A 3LOIA 2AYHA 4Q1PA 3VL9A 2YU1A 4ZU5A 1FAYA 4EN6B 2IXCA 2WIIB 3HT2A 4OQ9A 1GOGA 5A3NA 2P3IA 3HR9A 4FOVA 4HBNA 1MQTB 5FJHA 3T0AA 2W87A 3TWIA 4URTA 5J1XA 3WNXA 1G9BA 1OH4A 4XUTA 3AZVA 4HL0A 4C0BA 3T1LA 1H1AA 1K5MA 4BM8A 4XFCA 1JZ3A 3DXTA 4QQLA 1KRIA 3UJQA 4DXZA 1W9WA 4Z07A 4UBHA 5EFUA 1UY2A 1LENA 5F5QA 4QD2A 2HJIA 3AC0A 4AFDA 4GWIA 1YFYA 4JGZC 5H9PA 4OZXA 1BJQA 3WX5A 3U4XA 1CAXB 1UAIA 1JW6A 4MV2A 4NAOA 5C71A 3B5LB 4XDPA 3O1UA 4DO0A 5JZGB 2P3YA 4XHBA 5HXMA 5A80A 1QJY2 1WCDJ 4IXLA 2YC2A 4N9HA 4ISRA 3AMHA 3VBOA 4AZZA 4PI2A 1JXNA 5JZGC 2QZ3A 5CZKA 4QX5A 1SMVA 1OFSA 1H4XA 1WLWA 5C6CA 3T08A 2AACA 3VBFB 2AREA 4J1XA 4WVWA 1NX9A 4UFHA 3X29B 3D0SA 3WQBA 1MS8A 4ASLA 2YB7A 4HLTA 3ZPYA 4CDUC 2YBKA 1BZWA 2H0VA 2R49A 4PT6A 5CFDB 5EZBA 3R05A 4XQ4A 1A3KA 3ECQA 4QHOA 1VALA 1RJ7A 4FPEA 4B8EA 1HB1A 5FY7A 5I8YA 4XJWA 4BJ0A 1RHI2 4FFHA 5C4WA 2WO3A 4LBKA 4E4DX 2C4XA 4FFIA 4LBMA 3WY6A 3HNYM 3LPFA 3TN91 4EROA 1AL22 1QJX2 2RJLA 2TUNA 3AB0A 3H3LA 3MUZ1 2MEV1 4GH4B 3RRDA 3WEZA 4Q4Y1 5CEHA 2OASA 1KDMA 2HWC2 1SPPB 3C7OA 5K0UA 3AJZA 2R072 1D2QA 1D4M3 4HKLA 4IERA 4WM8B 3WDYA 2P2KA 4GZ9A 4L9BA 4UFIA 3SISA 1U0AA 4JDNA 2GNMA 2XBO1 3VBSC 4Q27A 1GYKA 1MEC1 1ULPA 1XB9A 2CGOA 3I2KA 2QQKA 1WZXA 1N47A 4LR4A 4WZCA 1NQDA 2VCAA 1ZREA 2GALA 5DQ0A 3W9AA 4LO8A 2ZAHA 1S2EA 3KF5A 1V0FA 5DPNA 5FYMA 3ZFGA 5AC92 4PI0A 1S0EA 2JEMA 4AFAA 4JC1A 5DDJ3 4UW5A 1MACA 1A8MA 5IATA 1BMV2 4AL9A 1FC6A 5GLVA 3ELNA 1POQA 1RUD3 3VD3A 2WZPP 1RINA 2AEYA 2AEZA 2D7FA 2I07B 4WVVA 2VMCA 4BIOA 4DUXA 2ZX3A 1O91A 3O0WA 1QNWA 3ORJA 1N1TA 1GUIA 2F4LA 2QQWA 1GFF2 1UYXA 1IZ3A 3T2PA 5FMBA 3FL7A 3FLPA 3VDDB 1DLCA 1AR93 5FZ9A 5A1FA 4DGFA 1C8M2 1WW7A 3OD4A 4DUVA 1TQ5A 3HQXA 2ZGUA 2L9LA 3E5XA 3J7MA 3W58A 5FP9A 3ILNA 2ES3A 1FOD2 1YI7A 2CU5A 2GC0A 2YBPA 3CDZB 1AR81 5CYYA 2Y6GA 1V6NA 3POIA 1J3PA 4XMAA 3UKTA 3VDAA 5F1RA 2XHKA 3LDBA 1KJLA 1CR7A 3EHKA 1Q5OA 2CDOA 4Q8LA 3ETQA 1RUJ3 5JOYA 1Q8SA 3ZYIB 2WQ4A 1LTEA 3OOXA 2Q8CA 2GMMA 3E97A 5EUZA 1RUI2 2O0OA 2JECA 2QTWB 3ZN6B 2KXLA 3TAYA 2W1SA 4UOJA 2D6LX 2WNUC 2HWE2 3L9JT 4M01A 4CP9B 1GZTA 4EQVA 3JD73 3Q8BA 5FP8A 4HANA 1VBA3 2LW8A 4WM7C 2XVKA 4RYDA 4HZFA 3ZN4A 1UOBA 2HEVF 2DUOA 4N7IA 4QWNA 1ZBE1 1W6MA 3AL6A 3LA2A 1CN1A 1SLBA 1XNAA 5E89A 1AUYA 2VG9A 3USSA 3ZYGA 4P9LA 4YFZA 1UU4A 4I0AA 4JCKA 3JBG1 3HNBM 3HNMA 4BHPA 1GP4A 2P6CA 4FOYA 1QOOA 4CUCA 5BNNB 5A7QA 4YG0A 5IVCA 4NAMA 4ZPIA 1NCRB 1SLIA 5C3QA 2WT1A 4O65A 1RUH1 1IS4A 1W8UA 2ZX4A 4IV3C 2FDHA 1DP0A 3NJZA 1W04A 3WF2A 3I97A 4JGZA 5IVBA 4QPIB 1F31A 5A3LA 5CISA 1W8FA 4UWDA 2A6WA 1BKZA 4KMQA 1M4WA 3LKLA 2P5BA 5ABJC 1PGW2 3NL1A 4RFT0 2BTVC 2W1UA 4SLIA 1HQWA 4BMBA 2DCYA 2DYCA 5CKMA 3SEPA 1JYXA 3EJKA 2A7AA 4FPOB 5F5IA 3N7LA 2VGDA 4ES9A 2XHNA 3ASIA 1JODA 1OUXA 5I8SA 3U07A 4PF5A 4MGTA 1X33A 3U37A 5A7WA 5ACA3 1BCXA 4MYEA 5FZFA 1HB3A 3ZSJA 4ONUA 4CDUA 5A6XA 4PDWB 4EE2A 4HSLA 3THCA 4CCDA 1KDKA 3I2JA 3LE0A 5M0TA 1ST8A 3A7QA 5CVRA 1UOFA 1WCKA 1BBT1 1S0JA 4Y20A 3H1MA 4ZONA 2QUOA 1E57A 4NHMA 3ZMOA 1R1ZA 4KL1A 5A33A 4BPZA 4XCAA 3K51A 4L2NA 5A3PA 5HV0A 3RMYA 3LA3A 3HBZA 1QU0A 4SBVA 3GYDA 2WN2A 4QX1A 4A6SA 4C1WA
chains in the Genus database with same CATH topology
2JG9B 3VBHC 3MYXA 1PNGA 2GH8A 4I3GA 4CP2A 3TOJA 4A7KA 4QM9A 1JTZX 1K32A 3AK0A 1J3QA 5FQ0A 3O14A 3INAA 3VBSA 3I8TA 5FDBA 3H1WA 3N36A 1ZZ8A 4EN0A 2Q5TA 2AZ5A 3U0ZA 2ZJCA 3S0MA 1ND3C 2PLV2 2WS93 3T2TA 1RIRA 1HV0A 3AMPA 2ET1A 1H4GA 3CU7A 3JB4C 2XL9A 2EF6A 2B39A 4MXVA 5BUVA 1DIWA 1HRI3 4LBQA 2HKXA 2OUJA 4L8QA 1R1A3 5GLWA 2A6XA 3AP6A 1I3HA 3VZMA 2ARBA 4I0WB 3AM2A 2O8OA 1PGL2 2CGPA 2RR13 1URXA 1SLCA 1IPKA 1BPLA 4FPCA 4E4ZA 1KS4A 5CADA 2PHWA 4M3CA 2JE9A 1RHI1 4W6WA 2X5IB 4MGZE 1EP0A 1AR63 1EV13 1RUC2 5CAZA 1H8TC 1CIWA 1AL21 1Q8OA 2ETEA 2PHLA 3DPRB 5T52A 3WP3A 4H7MA 4ISQA 5JIUA 2VUJA 2TBVA 2JX9A 2HWC1 3AYCA 5JWPA 2PAKA 3RPQA 2R071 2DCTA 5C8CC 3M2MA 1RUF2 4XILA 1W6OB 2PHFA 4BCUA 4GWMA 2WNUA 1CAVB 3FLTA 4D7YA 3AKRA 1J58A 4WM7A 1G9CA 4YZ4A 3KGLA 2A5ZA 3RI9A 3BODA 4BH9A 4AW7A 1REFA 1W6QA 3MIEA 5AC91 2ZHLA 1QWRA 1KFUL 3V0BB 3NAPB 1ULCA 1N1YA 4WVMB 3MOGA 4J6GA 4B4PA 1HKDA 2CTVA 3J26N 4N43B 2EA7A 2IFRA 4NHLA 2ZGMA 2VNRA 4IV3A 4YM0A 4YW4A 4LULA 4LTAA 3E6DA 4XFBA 2VXRA 2UYAA 1QNYA 2ZZJA 5D8AB 1H2MA 5IK4A 3GALA 5FBZA 3BTAA 3FMGA 5EJ3A 2WSVA 3KQRA 2VW1A 3GZTB 2ZCWA 4NOTA 5ABJA 1LEMA 3D03A 1SFYA 4RS5C 2UY8A 1VAVA 2D6KA 1DGLA 1H2NA 3OGGA 5C9AC 1FPN2 2UY9A 1OI6A 4LA3A 5J96B 5DUWA 3PVBB 4YG6A 3WD5A 5CG9A 1DYPA 2IXLA 2RM22 4Z92B 2WL1A 3ENRA 2DVFA 2FMDA 2ZHMA 4AHWA 1LEDA 1UKRA 2OA2A 4FXKB 3MICA 1UPSA 1DQ4A 3TN93 1UD1A 1AX1A 3VKOA 2MEV3 4AFCA 5HCBA 4QMAA 1OOPC 4YGDA 4E2GA 5JSOA 4J1WA 2OW4A 4Y22A 4MGIE 4CEWB 3DUIA 1R092 2SLIA 4R52A 4U36A 3L2HA 2YC0A 4Q4X1 4XOGA 1Q8PA 1MEC3 1C1FA 1NY72 3VBHA 4WVZA 1HDKA 4MUVA 4EN9B 2HWF2 4QPYA 1MR5A 1WW5A 1S2KA 3D82A 3POSA 1QJU1 2H6BA 1RUG1 1ULGA 2HWD2 5IUQA 3KM5A 3CNAA 3OYWA 4FAHA 4M3CF 5CFCB 2QQPA 2GH2A 2ZOEB 1CVNA 3JB8A 3M3IA 4BIFA 5BNPB 5HCAA 1AX0A 4FTEA 1ND3A 1JYIA 3WUDA 3ZXGA 4HN1A 1U5IA 1MVEA 1SLTA 2GNDA 3WP6A 1ZZCA 1R081 1IQAA 4LUKA 3BALA 1HQNA 3IIAA 4KGQA 1QQP3 2EXJA 3KCXA 3ST7A 1TMF1 1V6IA 1MS4A 3JCIA 5FMOS 3MEPA 4CDXC 2TNFA 4P9YA 3MW2A 5LK7B 1OA2A 1REEA 2IXHA 3RQ0A 5KC6A 2D3SA 1LRHA 1AR83 2ZMKA 1RMU3 1HXS1 3VHPA 1UL9A 1H8TA 3POYA 2Y0IA 2QNKA 1PVC2 4N53B 3ZN5A 4KG8A 3TRSB 3HWJA 3SMHA 2WZR2 3KD4A 1EV12 2GC3A 5C8CA 2EIGA 2WFPA 1SCSA 3OJBA 3OGJA 1HRV1 2X29A 2IC1A 1I5ZA 1YXWA 4OI0A 1H0BA 3LOBA 5FO7B 1RGSA 2R30A 5LK5A 5LEKA 3AYEA 3JBG3 1WW4A 3OD0A 2ZKNA 1CGPA 4OHXA 3SCHA 5CNAA 4XQWA 3GBGA 4B4RA 3RYRA 1PIV2 4E2SA 1LKNA 4DZGA 1JN2P 1GANA 2AENA 5L19A 1COV2 1XU2A 1FT9A 4WVMA 1VAKA 4CTEA 1ENSA 3W59A 1YFWA 2GU9A 2X8KA 1J3RA 2EVXA 1AHSA 1LESA 5BV6A 1UIJA 2XWBB 3WDTA 1WW6A 4XIKA 4RS5A 1RUC1 1CESA 2W52A 5C9AA 4EN8B 5K9YA 1GICA 4YGBA 4XXPA 2CWSA 2V73A 2YPJA 3J8F3 3RDIA 1ENXA 2A73B 1B35B 5GZEA 3UKVA 2W08A 1BBT3 1EAH2 2SBAA 4RQPC 3DN7A 5J48A 5KXCA 5GALA 3B7MA 4JRAA 1TNRA 1OOPA 5LRSA 2UWCA 1D2SA 1XE7A 1RVF3 2PAMA 4P9WA 3N3HA 1AYN2 3VL8A 4P5HA 2WINB 3DV8A 2RS32 3VBRC 4QPGC 3S30A 1ZYBA 2GMEA 1LB2A 2YZ4A 3ZFEA 3RJRA 5LEJA 3A4UA 4RHV1 4IETA 3KCCA 4AI1A 3KSCA 3OTFA 3JQXA 2X53S 1TME2 4FPJA 4LNVA 3M4FA 5A32B 2WKKA 4OVEA 4K21A 1F5JA 5E1RA 1JHNA 3S6PA 3MFAA 3MFCA 3OBTA 4FTBA 2PHXA 2RM21 1O5UA 3B3QE 4CDXA 1X7NA 4YVSB 1KXGA 4Y24A 1G9FA 1WCSA 1C1LA 2IXKA 4JC0A 2FBEA 4G4FA 4GA9A 4GB31 5KBFA 4A7YA 3EO6A 1OLQA 3D8CA 2NQYA 5LRRA 4YM3A 1VRH2 3WHUA 1Q3EA 5BNOB 1UF2C 3E5QA 4MXWB 2Q30A 2G9FA 3WW2A 1X82A 1ND2B 2ET7A 1UZZA 3GBFA 2GN3A 1WLTA 1HQLA 2WNVB 3S7EA 1C5IA 5J98B 1VBB1 2JKBA 3NW4A 3KT1A 4CDWB 3N7MA 4JTOA 5KXBA 2Z42A 1H2KA 2RS52 1VBD2 1BVVA 1UW8A 3AYAA 2NPIA 1KFXL 3ILRA 1VR3A 3WDWA 3WZ1A 1PO23 3A0NA 5FLIA 1UX6A 5AVAA 1S55A 3M8LA 4XJUA 3M3QA 1NA1C 4X6QB 4X6RB 3MW3A 2UYBA 5K8SA 2A70A 1OQDA 1J59A 4N7UA 4YZ2A 3ZXJA 2IZWA 1A78A 4RGGA 4XJ8A 4Q4V1 5BNQA 1GR3A 5HXVA 1FMD2 3NV4A 2B5HA 2WZR1 1O3RA 3ZFFB 4EN7B 2CNAA 4OLLA 2E7AA 4HK8A 3NO8A 2BFUS 3ZSKA 3DF0A 1VBC3 2JD4A 3MIGA 1MQTC 4HPKA 2WA3A 4RQPA 1QMJA 2IWGB 2XPJA 5JI7A 4ATFA 4YG3A 4XFHA 4L1CA 5T5LA 4FCAA 1D4VB 2ERFA 4D7TA 1A6CA 3B9CA 1W39A 4AQSA 4YGCA 1EPWA 2VVFA 1V9U2 1SBDA 1JOJA 1Z7S2 2Z69A 2D6MA 2E6VA 2WFF2 1Y9QA 1QJU3 3GHMA 2N7GA 1PIV1 3CJIB 1RUG3 1BVP1 2CL2A 2R061 2UWBA 3VBRA 1SBEA 3BU7A 3CF6E 2O1QA 4Z8BA 2ZGQA 4D3WA 2BPA2 3VBUB 4QPGA 3CJIC 3JUUA 4TLFA 4F3JA 3D4KA 1NG0A 4BLIA 1CONA 2WLQA 4PIYA 3VHRA 3ZXAC 1O4ZA 1R083 2ZX0A 4FOWA 4RGAA 4LT5A 2R042 4FBFA 1G7YA 4ES8A 3VBFC 3QACA 1LOCA 2YHJA 4AVCA 4AVVA 4OI2A 3HN1A 4Q4W1 2EXIA 4HK9A 4TZDA 4LHKA 2VOVA 2DTWA 3AZXA 3H1YA 4XE9A 2K2SA 5KHGA 4GH4C 5JIAA 4XZPA 2Q4SA 1HXS3 4AK3A 1PO12 5BPXA 1OMIA 4HVRA 4FAGA 4F8AA 1AYM2 2YYOA 1YJKA 4X8PA 4WM8C 4HKWA 3SNMA 1LECA 3SHRA 1G6NA 4PLMA 4GMP1 3HAGA 1IKPA 1QOTA 3OY8B 2VY0A 1HRV3 4Y5Z0 3V0AB 2BNOA 1RUNA 1G86A 2RS31 1GQHA 1C8NA 1VBE3 3FFZA 1LOEA 2VU9A 3FZ3A 3MPPG 4INDA 2P3JA 2BW8A 2YGMA 2RMU2 4W6YA 5CFDA 3KB5A 4DMIA 1LU1A 5BY5A 4LO6B 3TNQA 1DGRA 2EALA 2OYZA 2RRLA 4KBBA 2CV6A 2LUWA 2A6YA 2ZMNA 1RUE2 2HWB1 1AX2A 3B69A 4NR1A 1BQPA 4K1YA 4LBNA 1W0PA 1X8EA 1EY2A 4A7ZA 1FC9A 3VDDC 1N1VA 1ZBA1 3AKPA 3K48A 2RE9A 2RS12 1O4YA 3U10A 5E88A 2XJQA 4Q0SA 4DNYA 3GF6A 2C9AA 1IKQA 1BEV2 3AMQA 3GNEA 1PK6B 1XRUA 1PO22 3H3UA 3NV2A 1NA1A 2JE7A 1VLNA 1DGWA 3LB9A 4HVQA 1DZRA 3KS7A 4XF4A 2DU0A 2P3KA 5C8WA 1ZZ6A 5L36A 4FVVA 5CBLA 1RB8G 2EAKA 3PNAA 4I30A 5FFOC 4COZA 5GKAC 1XU1A 4AEKA 2PYTA 4FPHA 1O7FA 4YFWA 1AJOA 2D44A 2BGCA 4I3PA 1AR73 5GLTA 1OPOA 1MQTA 2H0BA 3I59B 1YHFA 1WGPA 5BNNC 2DUQA 1W6NB 4XIOA 1VBC2 1NCRC 1ENRA 3SCGA 1N3PA 2VH9A 3KZ4C 1IHMA 2RS51 1U12A 1H1MA 3IPVB 4AF9A 1EPZA 2H6CA 3M1HA 4IESA 2B46X 1CAXA 4QPIC 5F6LB 2QFEA 2TEPA 1G9AA 3ZSMA 1JH5A 5JZGA 3UV9A 1DGRN 4RHV3 2DU1A 2PFWA 2BQPA 3S7IA 5L7OB 1Q8VA 3NKGA 1Z0HA 3KCYA 1CAWB 4FP2A 4IEPA 1N1SA 3MLKA 2ZKLA 2NM1A 3VBFA 4XPVA 3O5SA 4FOQA 1YNAA 2EAAA 4Y1ZA 4AWDA 4PDWC 5JVVA 3R6SA 2HEYF 1QXRA 3PVOA 1PGSA 2WT0A 4UW6A 4YARA 3MDPA 4S2HA 4LBLA 2QDNA 2BUKA 5DZEA 2WSUA 4FO9A 1FMD1 2QKDA 2VUAA 1DF0A 2E53A 5E16A 4GH4A 1LHNA 4YW1A 4PBOA 2JG9C 3PMSA 1JBCA 1D4M2 2FQPA 4WM8A 4Y1UA 1DYKA 1ASJ3 1YFXA 5JCTA 1MS3A 1XNDA 1HW5A 1Z7S1 1DZQA 2WFF1 4RR3B 1QJY1 2ZGRA 2ZHKA 2ZACA 1VBB3 1LOAA 1APNA 5JAXA 4IEWA 2VOXA 4QQPA 2VNOA 4UXAA 4AGVA 5DDJ2 1CX4A 4A2UA 3JQWA 4XFGA 5FTTC 2NLRA 2K0GA 2YUEA 3TNPB 4RD7A 1RUD2 2R041 1RL3A 3U11A 2CY6A 4AEDB 3IN9A 2ZGLA 1POV1 3G6JB 4UW3A 1QOSA 2D5HA 3P3PA 3VDDA 1AR92 3M3CA 5I0UA 4XJ9A 1F2NA 4DFSA 3J9SA 1QJX1 2R1DA 4BWOA 1N6DA 3ZYJB 2BWAA 2X5IC 4YW5A 3PHMA 4OI4A 3K50A 2XJSA 4YLZA 2JJ6A 3DPRC 4LA2A 4XFAA 3DKWA 2XLAA 1PO11 3IKWA 1PM7A 4LHLA 3RMXA 1S2BA 4CZSA 1RUJ2 5H9QA 5HBAA 1REDA 1DHKB 1AYM1 1OFNA 2DV9A 1HX6A 5DXDA 4MGYE 5TSWA 1LHWA 3ZN6A 1CAUB 3QBQA 4KH9A 2XL7A 2Y26A 3JD72 1D0HA 5J36A 1VBA2 2OPKA 1DQ2A 3WLUA 4L92A 3WG2A 4B3NA 2CAVA 1BMV1 3ZSEA 3GZAA 4Y1YA 1GLHA 5KXEA 5H9RA 4CEYB 2PTMA 3NAPC 2RMU1 2NP0A 4OHWA 5BNNA 2JENA 5T54A 1NCRA 1UKGA 2QJVA 4N43C 2BWCA 1WUVA 2YMZA 1YCIA 2LTNA 4AGRA 1RUE1 1CJDA 1C8M1 4YVWB 2ZS6B 4KGGA 2XVGA 5D8AC 4R8HA 4QPIA 4Q8KA 1MZ5A 3IWZA 1LOGA 1FOD1 1AZDA 1XNCA 2IXJA 3AYDA 3LAGA 2RS11 1UMZA 4YVWC 4YW3A 5K7PA 3SH4A 2E9QA 1LHVA 1WMDA 3MIFA 2V5YA 3BPZA 3MIDA 3LCPA 1NOVA 4Q2FA 2PQQA 1QY4A 2FHRA 4Y26A 4COVA 1L3JA 1RUI1 2DWRA 4Q4W3 2BNMA 3USUB 4YZ1A 2OIIA 2HWE1 5ACA2 2WLPA 3NV3A 4Q4Y3 3THTA 1S1AA 3M70A 4Y1VA 3PLQA 4PDWA 3POWA 4N9IA 2DFBA 5T50A 1ZVFA 5T5OA 4KU8A 3FBYA 2QVSB 2RJKA 4LE4A 4PIZA 4B29A 4Y4YA 1OHFA 3ACLA 4AFBA 2XBO3 4KWLA 1NE6A 2VQAA 1FV2A 4CEWC 3NKTA 4JVAA 4DY5A 4IEZA 2JG9A 3WQ1A 2R32A 1SACA 1KJRA 3WW4A 2ZAAA 3NWKA 3VKMA 3WT3A 2A75A 2GMPA 5GLUA 5CFCC 4AI8A 5BNPC 4XBQA 2GNTA 5E8AA 2XLGA 1LGBA 1PGW1 2JG8B 5FLHA 4AHXA 3H7JA 1DZTA 2WS92 1QXJA 4OULA 4CDQB 1RJ8A 1WBFA 4I01A 1B09A 1V6KA 3SH5A 3WR0A 2P17A 3BB6A 3ZXLA 2HWB3 1HRI2 1W6PB 4QT6A 4AEMA 5FMOL 1R1A2 3ZXDA 1JUIA 1LGNA 4ZKTB 1ZBA3 4IL7A 3ZXKA 4GIQA 1OSGA 2RR12 4AGGA 3R4UA 4EWAA 2BNNA 1YIFA 4KQ7A 3VKFC 3URFA 1TNFA 4ZU7A 1W2UA 2MNGA 4JGYB 4XQDA 5H9SA 3WP4A 4AXOA 3A0KA 4XYXA 4LUMA 5EZWA 2X5IA 1Q43A 1AR62 5JOXA 2AR6A 1YFUA 4C91A 3DPRA 4LLFA 4N53C 2YGLA 4IEUA 2C0ZA 1ZBE3 4BQ1A 4YYOA 4HKOA 1ULEA 3WCSA 1W6OA 1NCQB 4FP3A 1XNKA 5GZDA 1CAVA 2PLV1 4XW3A 5T55A 3ALQA 3ZIWA 5F9TA 2A3YA 2ZGNA 3ZYPA 4BLJA 3EXUA 3RSJA 4YSFA 1CJPA 1RUH3 2VMHA 1AJKA 3ES1A 4PQ9A 2I2SA 1C28A 1O5LA 3C2UA 1OQ1A 4K6BA 2B7YA 2PHUA 3V0BA 3NAPA 4L8KA 1H4HA 1U5XA 2E7TA 2F6BA 1PGL1 4IV1B 3AKSA 4N43A 1FXZA 2ZBJA 2WA4A 5AVPA 3PJYA 3WVJA 1V6JA 2WT2A 4R9DA 4YGEA 1V6OA 4IV1C 1ZRFA 1RC6A 4YNIA 5D8AA 5J7MA 1RUOA 2Q1MA 5DUXA 2XJUA 1XNBA 1AR91 1HIXA 2XUMA 3B94A 1UZYA 2WC2A 1GZWB 3MGUA 4I0BA 4LBQD 3V64A 2VOWA 4KWKA 5FREA 1M06G 5CIRA 1NQJA 2VMIA 2WQZC 1RUF1 1Y7BA 4KU7A 4Z1VA 3I2DA 2ZGSA 3MW4A 1RUJ1 1B35C 3I54A 1PZ8A 3DL3A 4M0NA 5J3UA 3TN92 2KA3A 2MEV2 3JD71 1JYCA 5T5PA 1K5MB 4W6XA 4XJZA 5IT6A 2NYYA 5JMCA 2PHDA 4BE3A 5GZGA 5I0TA 1OA3A 1H1IA 4CEWA 2DVDA 3T1MA 1LOFC 3QH7A 1YI9A 4XF3A 1MEC2 3ROUA 2W68A 1SEFA 2CWMA 2VW2A 3LZZA 3FC0A 1GSLA 3DGTA 2Z2SB 4HETA 2VQ0A 3VGIA 1QJY3 2ATFA 1DGWX 4FSJA 3BIWE 3MIHA 3AMMA 3NSTA 4IEOA 3VBOB 2R6QA 5CFCA 2FZ2A 1ZZ7A 4XBLA 2XH6A 3KT7A 3M3EA 5BNPA 2DCKA 4AHZA 3I7DA 3RG0A 2IFWA 4XETA 5DZGA 4E2QA 3H7YA 4WBBA 4DS0A 4FTSA 1FPN1 2GZWA 1LHUA 4K40A 1YIPA 2WWSA 5SV5A 2WNEA 3CJXA 1LODA 1POV3 1LGCA 1QQP2 4AFMA 1XYPA 2RHPA 3RNSA 1LU2A 1RHI3 5C4WB 5KHJA 4I2OA 1QGLA 5SV8A 5T5JA 1IS6A 1MZEA 1AL23 1QJX3 3R4SA 5D1IA 1FCFA 1W0OA 2HWC3 4GKXA 4YVSC 1UPIA 4FPFA 5K0UB 1OA4A 2R073 3L2YA 4WV8A 1AR82 1OLRA 4NVPA 4B4QA 2BBVA 3DJAA 1RMU2 1FYUA 1R091 2VOKA 2UU8A 1S0DA 1MS1A 2FMYA 2ZX1A 3NV1A 4YZ3A 1NY71 1ZZ9A 4R4ZA 5JR7B 5BNOC 2HWF1 2DCJA 4N53A 5CG8A 1MZFA 2MHFA 4ZU4A 4EV0A 4Y1XA 1SDWA 1YRZA 3SITA 2AGSA 4K20A 5IK8A 2HWD1 4DY3A 1ND2C 4EJRA 4S2FA 3ZFGB 2ZPXA 4ATEA 2XJVA 5AC93 1PMIA 1FV3A 2WNVC 3ES4A 2XGXA 3KLSA 3KT4A 2CGNA 5EYYA 3ZIXA 4CDWC 3VZJA 3ZVXA 2DVAA 4GHNA 3ATGA 1IOAA 3JBG2 4H3WA 1DQ5A 3CL1A 1OPMA 2EXKA 1SBFA 2YY1A 4HFSA 4JV4A 1ULDA 2G4IA 2A6VA 4HMZA 1IS5A 2QDRA 3VZOA 4L99A 3LSEA 4LLOA 2ZMLA 2DCZA 1YUDA 5FCCA 1C8M3 3AKQA 2GC2A 4K8FA 4Q26A 1R1A1 1NXD1 4AVSA 5FAXA 4PIXA 3WQ0A 5AFEA 4KNCA 3UL2A 3VZLA 1UU6A 4D94A 2CYFA 3E6CC 3AP9A 1RUI3 1PVC1 2B9UA 3J4UH 2D98A 4XDQA 3N7JA 4B7EA 1AR61 1EV11 1N3OA 4AYUA 5JDBA 2BFUL 2IXIA 5GLZA 3J8F2 1CQ9A 3ZFFC 4QGMA 4OHZA 1FC7A 2XJTA 1W6MB 1B35A 3RYKA 4AVAA 5JSRA 4DRVA 1BBT2 4Q4X3 4XBNA 5FO8B 2E7QA 4P14A 3D5OA 1I6XA 3BOWA 4N90A 3N7KA 4XMIA 4AG4A 1RVF2 2V09A 1IGOA 2XB6C 1U5ZA 2ILMA 3AMNA 3DUPA 4TYSA 5DG1A 2FZ1A 1LOFA 1COV1 4JGZB 3VZNA 4XEZA 4MH0E 2W39A 2ZGPA 1VIWB 4V1PA 4FXGB 4LHNA 3VBUC 1G9DA 4GWNA 3FLRA 1GNZA 4RA0A 4GQ7A 1GZCA 3GMFA 2R0FA 3RZZA 1V6LA 2OVUA 1TMF3 1X36A 1H9PA 2PELA 2HEWF 4META 5T3NA 4AEJA 2BEOA 3KMHA 1J1LA 3SLIA 2GDFA 4GXLA 4CDUB 1FATA 1CPMA 4XJAA 4X8NA 3QH6A 2LM3A 1UN1A 2D43A 3G7DA 5A32A 1O3SA 1EAH1 4Y20B 1N6EA 3QD6A 5A33B 1YLLA 2XG3A 4W65A 4LBOA 4YVSA 3WDXA 4FT8A 1QF3A 2YROA 3GZUC 1AYN1 4XFIA 1A8DA 1C57A 3E6BA 5FQ0B 4YRDA 3VBSB 4HVOA 3SXWA 3FUQA 4JTNA 2UWAA 5BNOA 3IBMA 4MXWA 3QLQA 5IK7A 1S0BA 2NMOA 5FO9B 2BYVE 2PLV3 4PLOA 1ND2A 1PZ9A 2R1BA 4Z2WA 5GJ6A 2B45X 2WNVA 1YYNA 1F8VA 1WLDA 4CDWA 4LBQB 1MZ6A 4FQ4A 1TME1 2ARXA 1POV0 3VV1A 1WMFA 1ZZBA 5J37A 4FPYA 2Z5WA 4IEXA 2DF7A 1S0CA 5BXXA 1QQP1 4M3CB 2Q0AA 5GM0A 4PJYA 1PK6C 1RUC3 4MSVA 3HD8B 4RSUA 4H55A 3WINE 2YV8A 1DBNA 1UCXA 4XHXA 1DLLA 3FE5A 4MVTA 3B93A 3WG4A 1RUF3 1AXKA 4H7LA 4IEYA 1VRH1 4L97A 4Z82A 4NHKA 1RMU1 1Q8QA 3UJOA 1S0FA 5FOBB 2WNUB 4S2GA 1BXHA 3FHIB 3PVNA 4EWEA 3CO2A 2D5FA 4LO5B 4WM7B 3UKNA 1SQ4A 2XJPA 3IDEA 4MZUA 3ZFFA 5CU1A 4QGLA 4AI0A 4D7SA 1W6QB 3MLLA 4UW4A 1DDLA 1FNYA 1XXNA 2UURA 1X50A 5J09A 3FFQA 2GN7A 5JI9A 1VBD1 4P9JA 4Q4X2 1SFNA 2XJRA 3WDVA 4C90A 3M7AA 4IV3B 2A71A 4YZ5A 5F6KA 1QJU2 1RUG2 3CJIA 1NYWA 4Q0QA 3ZMNA 3O0XA 1NE4A 2D6PA 2VULA 5ABJB 3B01A 1LR5A 1O4TA 3VBUA 3FWEA 1MS9A 5DUUA 3WW1A 2B8MA 5L7OC 2AUYA 4KWJA 1H9WA 4DINB 1R082 1FPN3 4JDOA 2P37A 1S0GA 3OBRA 4QQ2A 5DG2A 3ZYRA 2RM23 2NZ9A 1Y43B 1TMF2 4QQOA 4DQAA 4Q0PA 2E51A 5B2GB 4GB33 2GAUA 3ZXFA 2WJSA 3GHFA 4MLOA 1OQEA 1QH7A 5JSPA 5FOJB 3J8F1 1ZNPA 4Y22B 3QCWA 4R9CA 1PHMA 3WV6A 1HXS2 2Z79A 1ALYA 1S0IA 1GQGA 1R093 1UU5A 2D40A 5FRAA 4WZFA 1H30A 3VBHB 2XVLA 1V9U1 3MPBA 4FPLA 3IDBB 2HWF3 2G9GA 1KQRA 2D3PA 1RVF1 3EQEA 2HWD3 2OUHA 3OYWB 3MIBA 4BOWA 2O8QA 1XYNA 3OY8A 1U5YA 3WW3A 2YDEA 1HRV2 4JAAA 4RR3C 2XKPA 3V0AA 1ND3B 2Y38A 1VBE2 3SCFA 4Q1RA 4QU2A 2DUPA 2VNGA 2QE3A 1MS5A 1F5FA 1AXYA 2LALA 4M00A 1GBGA 5I0RA 4E27A 3VHOA 4AEDC 3B00A 2OZ6A 3TYJA 4Q29A 1PVXA 3H9AA 3H0OA 4BZ4A 5BYNA 5JPMB 1F9KA 1YWKA 4P9XA 3R0RA 5EYXA 1WLCA 4GKYA 4LO4B 1ZRCA 4AQTA 1PK6A 1H8TB 4I02A 4Q4V3 3JZVA 3OPZA 1PVC3 1T6GC 3AXDA 1YO8A 4LE3A 2ZGKA 3RWNA 1HV1A 2WZR3 1XQNA 1C3HA 1AXZA 2DVGA 3V56A 5C8CB 4AVBA 3GHNA 3UK9A 4OHYA 5EV7A 2ZX2A 4ASMB 2A6ZA 4AVTA 4BYYA 5FPZA 4JDMA 1ZX5A 2JDZA 1HLCA 2D97A 3FUOA 4U2AA 4LO7A 4YW2A 3WP5A 5KC5A 3FX3A 2DXLA 1ZRRA 2PAEA 4E9KA 1AR72 3THPA 5A3MA 2QZ2A 1ULFA 5EWSA 2ZTNA 4QQHA 3VKLA 3EBRA 5KHHA 5I0SA 5L73A 1PIV3 2R063 4CEYC 4IEQA 3I59A 3IDCB 4Q0UA 3C3VA 1LCLA 1W6NA 1TE1B 2VECA 1COV3 4QHBA 4UBGA 2AH2A 3JU9A 4DB5A 5I93A 4D69A 1XE8A 3ZO0B 1IPJA 1EYBA 2NN8A 3IPVA 5HI0A 3QOPA 1AF9A 1VP6A 4YM2A 1G8WA 3D0JA 3LSDA 1VJ2A 5IK5A 1BEV1 2VPVA 2MPFA 2PA7A 2PN5A 1PO21 1N6FA 4ITCA 3HIFA 5KHIA 4RHV2 2DURA 4RS5B 5FPXA 5L7OA 1WBLA 2ZHNA 1CAWA 5C9AB 1QDCA 2VVDA 3H8UA 3HT1A 2EXHA