4AEJA

Crystal structure of human fibrillar procollagen type iii c- propeptide trimer
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
213
Chain Sequence
SPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQQITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords COLLAGEN ALPHA-1(III) CHAIN
publication title Structural Basis of Fibrillar Collagen Trimerization and Related Genetic Disorders.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 213
sequence length 217
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01410 COLFI Fibrillar collagen C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1000 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aejA02
3.30.750.130 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4aejA01
4AE2A 4AK3A 4AEJA
chains in the Genus database with same CATH superfamily
4HANA 1HN0A 2VU9A 1EP0A 1BJQA 1B35A 4FOQA 5JI9A 3DORA 1S0FA 2ZHLA 1J1LA 1D2QA 2ZA9A 4MYEA 4Q4W2 4TYSA 4AHZA 4E2SA 4JGZC 4ARYA 1L7LA 4P9YA 4NIIA 3FJSA 4DEVA 2F6BA 5BXXA 4Q8KA 2A5ZA 5BYNA 1H4ZA 4FTBA 4QDSA 1O6UA 1E5HA 1X7NA 3BTZA 4YW3A 4DRRA 5FBJA 2BGPA 1PVC2 2R16A 4PDWB 3EQEA 3TOJA 4L11A 1OA2A 4KWJA 4XABA 2K9ZA 5APAA 5FP9A 3SCFA 3WZ1A 4CP9B 3AVRA 3ME2A 1FOD3 3UNPA 4YW2A 5F6LB 4NHMA 5JWPA 4MLOA 1OHFA 3LPFA 4QHOA 3HQRA 4AEDB 1OLME 4XURA 1XNCA 3ZO0B 4FPJA 4QT6A 5BUVA 1X8MA 3ASIA 2R7EB 3HNYM 4R9CA 3DYPA 5DAPA 5FAXA 1FPN3 5HV0A 1UZWA 4XFGA 4LO6B 5J1XA 3ITQA 2VNVA 3H9AA 1PIV1 4ZONA 1ZZCA 4BM8A 1W9FA 2X5IA 4MGYE 5FUPA 4CDXA 1QWRA 5IT6A 3LEMA 5DUWA 2E51A 2B9UA 1GP4A 4H2AA 1VB4A 4EN8B 5BNNA 1H30A 3UETA 3GVKA 4GA9A 2BNNA 5C7GA 4QDQA 3MLJA 4Q4V3 2GC1A 3WV6A 4A41A 2MPFA 1BXHA 4D3WA 1RC6A 5FPAA 1OH4A 2AEZA 4AZZA 4AAPA 2BOJA 3I59B 4NPMA 4YWAA 4BQ1A 4I30A 2WT0A 1AYM3 4UWDA 4CP2A 5ACA1 1VBC3 1YIPA 5EUXA 2R073 4RA0A 4Y22A 2BTVC 5DAWA 1QOTA 3UL2A 5BNQA 1H2KA 2XL9A 2GMMA 1QXPA 4PI0A 4BYYA 1AR71 1UXXX 4FTSA 2VCAA 1Y3TA 1RUH3 1ZA4A 1FOD2 3OYWA 4Z2AA 5DZFA 1D4M1 1ZZ6A 3JU4A 3V0BA 3WVJA 5C6CA 3MI8A 3AMHA 4AVAA 3C7HA 2DVGA 3FLRA 3AP5A 4UAPA 1ZBE1 4GWJA 1JUHA 4Q4Y2 5C8CC 1GZTA 1SBDA 2DYCA 3GF6A 3T6OA 2V5DA 3AYDA 1FPN2 3IAPA 4QX3A 4C8DA 1W6OA 2MEV3 4CDWC 1V6NA 4CEYB 1YNAA 2ENRA 4IV1A 5ISLA 2XMLA 1DYPA 2JDAA 1HRI2 4ATFA 4QQLA 2IZWA 3I3DA 4F83A 1OFNA 1VBE3 3LEIA 4AFAA 2XOMA 4N9HA 3VBSC 2EXHA 2HWB3 2E63A 4Q5OA 4FT8A 3ACIA 3T4HB 3THTA 3KZ4C 1K3IA 2Q0AA 2GH8A 2XJQA 4Q4V2 3RJRA 3EJKA 3CIHA 4WVMB 4L97A 1S0IA 5BPXA 4C90A 4CP0A 1XNAA 2DCTA 3T08A 5FZ8A 5B4XA 1OVSA 5DUUA 2EIEA 3NV3A 4QU2A 3U14A 4OULA 3VD5A 3NAPB 3NNMA 4WBBA 4AGVA 4ZKTB 3MLLA 1SACA 2ZKLA 2JDKA 3RRDA 3R05A 4GXLA 2I45A 5CFCB 1IS6A 3G7DA 2VUDA 4B7KA 4GWMA 1RITA 1WD3A 1PO21 3GVJA 4IXLA 4P14A 4RGKA 4E8DA 4URAA 2CV6A 1CAUB 4Z8BA 4LPLA 2MEV2 5JIUA 2ZOAA 3K48A 4WV8A 2JECA 4LUKA 1CVNA 5J98B 4FOVA 2C9KA 4QKDA 1PVXA 3ES4A 1VBE2 2GALA 3AVSA 4MV2A 4QPIB 4TTGA 4HYLA 2HWB2 3RS6A 1H4XA 1GNYA 4OYUA 2R1BA 1MS8A 5GLTA 1H6YA 5LZ6A 2WYFA 4A7KA 2VOXA 3B69A 4XF3A 3AMNA 3ZYBA 3KVBA 5A1AA 3ZN5A 3NNGA 1IPSA 1UL9A 1ZZ9A 4RD7A 1NCQC 4RHV3 5GKAC 2D97A 3ZSJA 1UU6A 2A1XA 1DQ2A 4IETA 5FO7B 5CYYA 4JGYB 2LM3A 1U5ZA 3WDVA 2ZHKA 1WLDA 1PX4A 2RS12 5IHRA 5A7PA 1WXWA 2WFF2 4XIOA 4QKNA 3ZFFA 1CWPA 4YG6A 3O12A 1JYWA 1T6GC 4GD4A 1YEWA 2RRLA 3NV4A 4BLIA 2RVAA 2WO7A 3N4MA 1R1A1 1GYKA 1E5SA 3M2MA 3B3QE 3OSDA 3S57A 3ES1A 2WS91 1I3HA 3LWCA 2P37A 1V9U3 3URFA 1K42A 1FC7A 3GGLA 1PGW1 1H4HA 1IKPA 2D40A 4LO7A 5JPNB 3LIHA 4MGQA 3H1MA 3U07A 2GDFA 4Y4YA 2R063 3S7EA 3BUCA 2WSUA 3O0XA 4OZXA 1ZRCA 1G9CA 4XHBA 4XFBA 4QX0A 3G6JB 4N7UA 5I0SA 4M01A 3BB6A 1LOFA 2DUQA 2UU8A 3PUHA 2QNKA 1BBT2 5T5LA 2KLNA 4Q0UA 1RYYA 1UOBA 1X9TA 4XILA 1ODNA 1QXJA 3K77A 2W1SA 5EJ3A 1VBD2 5FWEA 1LRHA 4XJWA 1TME1 2RR13 3GBGA 1LENA 4YZ5A 1C4RA 5T55A 5BY5A 3OBZA 4LA3A 4XF9A 3WF3A 2WZR1 5IAXA 3IPVB 1BK1A 2LROA 2QQKA 2FDFA 4NIAA 2IXLA 1QDCA 4CEWA 1W6NA 2PQSA 2ZACA 4M0NA 4YNIA 4Z1VA 3AKPA 3CJIA 1POV1 3FBYA 4QXHA 4S2HA 5HV4A 1YRZA 1V9U2 1JBCA 3L2HA 5FYIA 3AFKA 5JOXA 2ZPXA 4MHRA 3VBFC 4A6SA 2JDUA 4BLJA 4DGHA 1XPWA 4IE7A 3USSA 2ZKNA 2ZX0A 1QJX3 1HF2A 5C71A 2VTXJ 3AJYA 2WNEA 3NO8A 3GZTB 2CGPA 5BV6A 3T0AA 5M0TA 4Y1UA 4A3ZA 2IVIB 3UKNA 1ENQA 4UW3A 4GULA 4IDZA 1QU0A 5C9AA 3C7GA 3ZFEB 3AK0A 1ULDA 4E9KA 1A78A 3IB3A 5LASA 4HONA 4Y5SA 4K6BA 1W9WA 4FXKB 5GLZA 3WDTA 4BU2A 3WF2A 5CEHA 3HVDA 1C5IA 1US3A 1MS1A 3WP3A 5F7UA 2PTMA 4E4HA 1AR81 4OQ8A 1A3KA 4ZY9A 5KHKA 2PHDA 1J58A 1APNA 3J4UH 4JKMA 1WA6X 2OZ6A 1NQDA 2YFUA 4PHZA 2YBSA 1COV1 1GICA 5A3UA 2ARAA 2A6ZA 2GC0A 4BISA 3QH7A 3OUJA 1OA3A 4P9GA 4QMAA 3AC0A 3FUQA 1ALYA 4I01A 4JX0A 5AVPA 5SV5A 1K32A 3IHAA 5FZ7A 5KWRA 4Q1PA 4LTAA 5FZ4A 3OTFA 3ZLIA 4QPGB 3PUIA 3N9OA 3IWZA 3NQHA 3U1XA 3Q9OA 5JXJA 4G4FA 5EUZA 1QQP3 4LMFA 2JG9A 1LECA 2ZGPA 5FZMA 4ZHNA 3C0KA 3EH7A 3PDQA 5GZGA 4LIVA 4RQPB 2VZPA 5FCCA 5LRSA 4QM8A 1W9TA 2ZGMA 4FVVA 3V0AA 3L2YA 4XF4A 1EUUA 3VKFC 5LA0A 1YI7A 4MO3M 5DN2A 1Q5OA 3DXTA 1UYYA 3FUOA 2EA7A 4ITCA 3VBHA 4G9SB 4Y1VA 1EAH3 1KJLA 3MHZA 5J09A 2HWE3 2DCZA 4FAHA 4YARA 1UY2A 3WT3A 3GBFA 2RM21 1NLSA 2C1FA 2WA3A 1A34A 4I2OA 2OUJA 2WJSA 5FZ6A 1RUOA 1JMUB 4QHBA 2WRAA 4XAEA 2VNGA 4K1YA 1MZEA 1U12A 3VBRA 5C4WB 3E97A 5FY1A 2FBEA 3H3UA 2A6VA 2ERFA 1DLLA 2D6LX 1F5FA 1SFYA 4YVSC 1CONA 4LKEA 3CZUA 4NWWA 4QB6A 4KWUA 3ZDSA 2RJLA 5H9SA 4IGPA 2VMFA 1LHUA 4LBNA 4MGKE 3DJAA 4YM0A 3VKLA 3GZAA 2AEYA 2C6SA 1RUD2 4LBJA 4MGZE 1ZZ7A 2CYFA 2QCSB 4PI2A 2HBTA 4JC0A 4YYOA 2D6OX 2WNVA 2J42A 3T2QA 1AUYA 1YQ5A 1MQTA 1YQ2A 4AGGA 1F4HA 3RSJA 3TB0A 2W1QA 4AQ6A 2P17A 4HOOA 2R49A 3JXSA 1YIFA 4Y20B 4W6XA 3VHPA 5HXVA 1FATA 1YQ6A 1H8TA 3C8XA 2HWC1 1H9PA 4MXWB 3R6SA 1UOJA 2D7FA 3N7MA 5EPAA 4RR3B 3DKQA 2ZHMA 3GZEA 3KD4A 1PX3A 1RUC2 4CCLA 3LD8A 1W05A 2DU1A 2VOKA 3ELNA 4UFJA 2ZEYA 4NUBA 1KGYA 1JODA 1PZ7A 4NR1A 4V2WA 1NA1A 5FZ1A 1C28A 3OF1A 5FZBA 3JCIA 3UGFA 5IFPA 1SCSA 3PUSA 1SPPB 1UOFA 4JGZB 1G86A 2HJIA 4JQTA 2IC1A 2VC9A 3TBDA 2D5HA 1JYTA 3IHBA 5LW9A 4FBFA 2K46A 2SLIA 2ZZJA 3BVCA 3H1YA 1GFF2 4IE6A 2F4PA 3LF7A 4UI9L 2P3IA 2WLPA 3IDBB 1AJKA 2DXLA 1W2TA 3S5QA 4BDVB 2TNFA 3FLTA 3OGGA 4CEYA 2J1TA 5J37A 4OHXA 1BLZA 2ZGRA 1OURA 1IHMA 2F4LA 2FDIA 3AMQA 4P5HA 4BPZA 3WF1A 3AMPA 2GNBA 5LWBA 3U4SA 5ACA3 4LNVA 3RWNA 5IVJA 3AP6A 4Q0QA 4OLLA 1V6KA 1AR73 3RYRA 1IS5A 1WLWA 3OGJA 4HT1T 3V97A 1RHI1 2ZX2A 3OGRA 5FUNA 3UGGA 3C3VA 4DUWA 3FFQA 5FO9B 3BTXA 4HETA 1LHOA 2XBO1 1ZBE3 3VKNA 1UNBA 2ZBJA 3FHAA 1ASJ3 3MW2A 4J1WA 1XQNA 3IMMA 1U0AA 3SC7X 3WNKA 4EN9B 1PIV2 1CAXA 5CFCA 2WQ8A 3LKLA 1G8WA 1JXNA 4JTOA 3AFGA 1YJKA 3QACA 5K0UA 5HCHA 1R091 2AENA 2RS33 3LB9A 3GVLA 5FY7A 4CPBA 5IK4A 4BMBA 3KSCA 1AZDA 1CAUA 3ZSLA 3J8F1 1X36A 2HH9A 5G05L 1OPMA 3AZXA 4L8KA 4D7YA 2XLAA 5LATA 3KV5A 2RHPA 3MYXA 1UWWA 1ENXA 3VDCA 4R9DA 3MIFA 4B4PA 2BFUS 2C26A 4XDPA 5ACA2 1F4AA 1VPHA 4FOYA 3T3YA 3WW4A 5C8CB 5F1RA 5J7MA 1NY71 3PU3A 1W6PB 1BEV1 5JOYA 2PFWA 1XB9A 2WABA 2WC2A 4CDWB 5LBFA 1AR72 3K4AA 5B2GB 4UW4A 4HIZA 1D4M2 1OMIA 2RS51 3I97A 1URXA 3SH4A 1WGPA 4HBNA 4OCTA 5FZEA 3C7FA 3VBSB 1BCXA 1W8NA 1YLLA 1ZBE2 2J1UA 3D3AA 1ASJ2 3FHIB 5FUIA 4COUA 5A7WA 2GAUA 2IWGB 1MS4A 2BERA 3K3OA 1DG6A 2AH2A 4DXSA 4A45A 4WZCA 3DPRC 1HKDA 1IPKA 2G4IA 3POIA 4JKKA 1LJ7A 4EZ4A 3IF5A 4V1PA 1KITA 2GP5A 1UMZA 2HWF1 4IUGA 1QH6A 3ST7A 3P3PA 5E6HA 1ZBA1 1H6XA 3O1UA 3DN7A 4IEZA 3ZFGA 3L9JT 5A7OA 3V64A 1MZFA 1Q8VA 1NXD1 2JG8C 5LK5A 3CQOA 2VZQA 1GQPA 1IGOA 2W2IA 3CBNA 2RDQA 4EN0A 3VKOA 2G9ZA 5HCFA 4D6QA 1XYPA 1JYXA 3T09A 1YHFA 3CL1A 4K20A 3SQOA 1AXYA 2QQWA 3C7OA 3OD4A 4EJRA 5L9VA 1D7PM 4E4DX 1NCRC 4TZDA 5EUUA 3VBOC 3MV11 4URTA 3AZWA 4RS5C 1UMHA 4BXSV 3VD7A 1XJAA 4W4ZA 2YGLA 2IFRA 1KXGA 3VGIA 2EAKA 2VOWA 3I54A 1QJEA 1R1A3 4AI2A 3ZYFA 2HWD1 2VBBA 1NUKA 1OSGA 3ILFA 1RUE1 1FC6A 3RZKA 2X10A 5FJHA 4XE9A 5IK7A 1HJFA 4XF1A 4ISQA 4PIZA 3ZOIA 1NCQB 3LEKA 4N53C 5JOWA 2UYAA 3ACGA 1POQA 1PO13 2DVBA 1QJU1 2Y6JA 3OEAA 4H14A 4O9EA 4WM8C 3NJZA 4LK7A 4SBVA 3SKJE 3JZVA 4HPKB 1RUNA 4XCAA 2HYKA 2EXIA 1WD4A 3MUY1 5E8AA 4GH4C 4YG0A 1KS5A 4CUGA 4ZPIA 5D8AC 2RE9A 3WF4A 2A71A 3JD71 1D0HA 3OG2A 4AW7A 4UBHA 4HK8A 4WM7C 2Y0OA 4PQ9A 4QQPA 5F37A 1MZ6A 1U5XA 4Y3OA 4NVPA 2JE7A 2QQJA 4NHXA 4XETA 5FZAA 1IG0A 1NZCA 1N3QA 4L9BA 4AGRA 1UU4A 2OA2A 4BQXA 4DNYA 1SBOA 4UXAA 1QKQA 4LJHA 2G1MA 1R1A2 1YQCA 3IBMA 1W9SA 3JB4C 1MEC1 4Z82A 1OUXA 1XOYA 2ETEA 3FWEA 4FFGA 1OOPC 1PGW2 4XF0A 3S6PA 4LHKA 1IKQA 1ND3A 2L9LA 3ZN6B 2MHFA 2YZ4A 3OBRA 1A8DA 3S5AA 1PM4A 1R083 3KF3A 5CBLA 4OUSA 1ZM1A 5FY4A 1K5MC 4DO0A 4BQYA 3E6DA 3V0AB 4QX5A 2WBKA 3J9SA 5JR2A 1Z78A 5A6YA 2Z2SB 1OLRA 3F95A 4LO8A 2LRPA 1GZWB 1AR63 5DG1A 5F2WA 4YVWA 1CZTA 3LSDA 2HKXA 3ALQA 3JBG1 4GALA 2BU9A 4DEQA 1XE8A 3GCWA 3E5UA 1FNYA 1S2EA 2O0OA 3D6EA 1DQ6A 1TNFA 1J3QA 1Y4WA 5G04L 5FR3A 1TME2 3RMXA 4N43A 4XFIA 3EXUA 2RMU3 3VBFB 1AR83 2WZR2 2JIGA 2D3SA 2VQ0A 5DUVA 5FXZA 5EUWA 2W47A 1HQNA 4RQPA 3RZGA 3SXWA 1W04A 3BTAA 3H7YA 2FHRA 2GMPA 2X53S 4FXGB 4E2GA 5AFEA 3DGTA 5JZGA 1ST8A 1LR5A 1WW7A 3QOPA 4D7TA 2CGOA 3GNEA 4DQAA 3ON7A 4LBQA 5IUQA 2VECA 1WMDA 3AL5A 4NMIA 1W6QA 4META 2HBUA 3QDQA 2EF6A 3H8RA 1JYIA 3RI8A 2XLFA 3WQ0A 4PLNA 3NL1A 5IVEA 3ZN4A 3DKWA 2K0GA 5C4WA 2OIIA 4AQSA 4LBKA 3MIHA 5FZKA 3VV1A 3WG3A 4DXTA 2VGDA 1DZTA 4QKBA 5LB6A 3E6CC 1W6MA 1WA4A 1NT0A 5H9RA 3IIIA 3BGAA 3PTYA 2QVSB 4KL1A 2RDNA 4E8CA 3POYA 1DGWX 3AZYA 2FD8A 5A3PA 4L1CA 1SDWA 1AR82 2EIBA 4QWNA 3UJOA 2BGOA 2XWJB 4GWIA 4OHWA 5FDBA 2YB7A 1XU2A 2FCUA 2VL4A 1G9BA 3LQCA 1XU1A 4B29A 1G9AA 1DHKB 1KRIA 4MG2A 4MHUA 3MLKA 4CCKA 5C70A 4Y20A 1BKZA 3HAGA 1LGNA 4J25A 2XQXA 4CCDA 4X8NA 5LBBA 2E33A 3VHRA 5ABJB 2WN2A 2B4KA 1MVQA 4I02A 4XXPA 1ND2A 4O61A 2IVJA 4XUQA 3SISA 2QQPA 3IKWA 2Y34A 3I2GA 4KGQA 5FYZA 5GLVA 3TYJA 4DOUA 3LDKA 5JZGC 2FQPA 3T2OA 1JZ8A 4NE9A 3LDBA 1VRH1 4A42A 5JDBA 4LLOA 3GK7A 1SLTA 5A32A 4CZSA 4JGZA 4CU6A 1UPIA 2Y0IA 3NVCA 2ZEZA 3W58A 3DV8A 1HB3A 2QDRA 3QBQA 1PK6A 3K50A 2WO3A 2JDZA 5JLVA 2UURA 2XG3A 3O1OA 3LIGA 4YZ2A 1RUG1 2AR6A 2VZOA 1QDOA 5KXDA 4Q4Y3 1E57A 3SH3A 3F43A 4LK6A 4AEMA 4LIUA 2BW8A 3AGDA 3NRUA 1LCLA 1O59A 2BVVA 3N9MA 4XOGA 4AOCA 4MGTA 2BWAA 4CVUA 2JWPA 3H7JA 3USUA 2UWAA 5CU1A 3ZYIB 4XJAA 4TSVA 3AKSA 3QH6A 4YGDA 5LRRA 1HRI3 5LBEA 2QTWB 4YVSB 5LK7B 4CDQA 2ZZQA 4TXWA 2RM22 1TMF1 2DCYA 5GM0A 2A75A 1N1YA 2VMHA 1DGRA 1JU4A 4LKDA 2X5IC 4CDXC 3FN9A 2J1AA 3GXUA 3WP4A 2AACA 3CU7A 4DFSA 5DMYA 2A6YA 1WMFA 4XFCA 4GMP0 1M06G 2VXJA 1HDKA 5A1FA 5BNNC 2YBPA 1JUIA 1W8OA 4IEWA 1DIWA 2ZO9B 2IXJA 3O1PA 3RZZA 4IGQA 3C7EA 4K7JA 1LTEA 3CLPA 4CDUB 4HN0A 2VMGA 3IDEA 2ZX1A 3WQ7A 1DDLA 3WDUA 3MF6A 4UF0B 1LOEA 3H8XA 3PJYA 3HR9A 4WVWA 1XYNA 2P3YA 2XL7A 3POFA 4B7EA 3DEMA 2ZEWA 1NX9A 1CZSA 1N6EA 1F35A 2CNAA 1JHNA 3M3EA 3KQRA 4Q29A 5A3MA 3VBUC 5FYTA 2FDKA 1WMEA 4KWLA 4LEJA 5FPLA 3UT0A 3N9QA 4IERA 1ULOA 2ARBA 2MNGA 3PVNA 1XRUA 1RHI3 1Q8OA 2XVKA 3J7MA 4MZUA 4P9XA 2PELA 3FHQA 4M3CA 2P5BA 3OIRA 4IEVA 2XBO3 1AX1A 3K4ZA 2B39A 2UWBA 4JDMA 2JD9A 2JB8A 5FPVA 1HXS1 4YM3A 4IV1C 5EQUA 5JPMB 2W92A 3ZIXA 2DVAA 3ABZA 2WR9A 2WNUA 1XNKA 1N3OA 1JHJA 1UZ0A 5KBFA 2CAVA 2EIGA 2VQAA 1SLIA 4AI9A 3VBSA 2QQUA 4QU1A 5BNPA 2B45X 2JXAA 1DBNA 1R093 4COYA 2Y33A 2NMOA 4IE5A 2VH9A 3K46A 2RS13 4LA2A 4S2GA 2WFF3 1W8FA 1QH7A 2D93A 4L2NA 2O8QA 1OXCA 3ZYPA 5J3UA 2VCBA 1UO9A 5DPNA 5FIXA 4HXCA 4M00A 3TN91 3SEEA 1Z7S1 3CNAA 4Y1XA 1UMIA 3WLUA 2NYYA 3H50A 1JH5A 4HVRA 4PCRA 4YRDA 1ZRRA 1XE0A 2D98A 4B4RA 1ZVFA 2R1DA 4JQRA 4YZ1A 4C1XA 4A7ZA 1I5ZA 3NV2A 5LY2A 1VBB1 1RHI2 5A3NA 4FPFA 1RJ7A 3ORJA 2VPVA 1UKGA 1OPOA 3K75B 3NY7A 3JUUA 2G9GA 1AVBA 2XBO2 4PT6A 5JCTA 1O8PA 4Y5Z0 1BQPA 4ZU4A 2AC1A 1GWMA 4HK9A 4FFHA 5L73A 2JX9A 1N1VA 2D3RA 3POBA 3VHNA 1MACA 2ZTNA 3RQ0A 2QFEA 4AHWA 1BBT3 1HLCA 2W5FA 2I74A 4FPOB 1BMV1 2VAUA 1OVPA 1DP0A 3ZYJB 1R092 2HWF3 1PHMA 3POEA 5FKBA 3VZLA 3WEZA 2W39A 3J8F2 1J84A 1VBD3 5LBCA 3O0VA 4I09A 1NE4A 2WL1A 4DMIA 2VZUA 3WHUA 3JQXA 4AVTA 3R0RA 3KV9A 1D4VB 4D0QA 3QCWA 1JZ6A 1SLCA 5FZFA 2VO5A 2VOTA 4UYBA 1BK0A 1CJPA 5L9RA 4AQ2A 1FCFA 4FPKA 5JSPA 1Q8PA 3ZFFC 1KD7A 1NY72 5A6ZA 1BEV2 3AZZA 5A3WA 5C5TA 3LEGA 4RSUA 1VMHA 4UW5A 3DPRB 2BJSA 4AFDA 2Y6KA 2RS52 4FPYA 5FMCA 1EPZA 3D0JA 3OY8B 1S0CA 2Q5TA 1RUF1 3PNAA 4U36A 3CHXA 4DXRA 2IXIA 3S30A 5FYCA 1W39A 1K5JA 2HWD3 2JG8B 2Q8DA 1E5RA 3EMRA 3LCPA 1UY3A 3FX3A 2B42B 3I3MA 3T1MA 1W99A 1YC61 4NWVA 3CO2A 3H8UA 5DAVA 2JDYA 5IYYA 5JXGA 2HWF2 2KA3A 1W06A 1ZBA2 3BOWA 5HI0A 1LOFC 3UK9A 4QD2A 1NCRB 1IPJA 3RWKX 2E6VA 1C57A 1RUI1 2QE3A 4OUEA 4K1ZA 3T4VA 3ZN6A 3N9LA 5FOBB 1AYN1 2KXLA 3HD8B 3NW4A 2ZJCA 3ZSMA 3FZ3A 2H6CA 1V70A 3DXUA 2GC3A 3H42B 3JD73 1RL3A 1QIQA 3ZDVA 2AGSA 2DVDA 5F2SA 5DZEA 1JOPA 1IZ3A 1GWKA 1S2KA 4ATEA 4PF1A 4CEWC 2BVBA 4XFFA 5AC91 2Y6GA 3CJIC 1PNGA 3BTYA 4N53B 2E32A 4P9WA 5KXEA 1WW5A 4ORFA 1NLRA 1MEC3 1Y43B 3BODA 4IV3A 4U2AA 2PHWA 3OJBA 5EYXA 1IG3A 3W5NA 2HWD2 2Q8OA 5FPUA 1O5LA 1RUE2 1REDA 3HN1A 4GH4B 5JIAA 1VBA1 4TWTA 2BNMA 1FAYA 5K7PA 2R30A 5D8AB 4E4SA 2NP0A 3IIAA 3WW3A 4WM7B 2PYTA 4EWEA 2PN5A 1OBNA 5C9AC 3OOXA 3PVOA 5A33B 4AR2A 4O65A 2JDPA 4Y4RA 1TEIA 3VDDA 5T54A 3ETQA 4ISRA 1PMIA 2GP3A 3ILRA 4COWA 3R4SA 3JBG3 4RN5A 3LFMA 3JD72 4ZZ5A 1AL21 2OPKA 4KQ7A 5FP4A 3TAYA 1S0DA 2VY9A 1JZ7A 3D8CA 5L7OA 1X33A 1OOPB 5F9TA 1OFSA 1YJLA 3HMYA 3ECQA 3I49A 5FZCA 3KV6A 3I2IA 3ZSKA 4JTNA 1CAWB 5FLHA 1L7RA 1SG3A 3MPBA 4XYXA 1OQDA 2H0VA 1VR3A 1GOGA 1K5MB 4NAOA 3SCGA 1RVF1 4AE2A 5FOJB 4FCAA 5F3EA 1MEC2 2XVLA 1L7QA 2DV9A 2HEWF 4XMAA 5FPXA 4CCEA 2XUEA 4HVOA 2H6BA 4JAAA 4ZXKA 5BNOA 1RUD3 4M3CE 2DUOA 2PLV1 4J1XA 4K3UA 3MICA 2GNDA 1N3PA 1JZ3A 1KDKA 2BZDA 2VQTA 1XYOA 2I2SA 3B93A 4B4QA 2BUKA 4OHYA 3OIZA 3WNXA 4R4XA 1N47A 2YBKA 1RMU1 4NHLA 5DAXA 5FP8A 2JG9C 2DF7A 2W3JA 2V09A 4OI0A 1US2A 5ABJA 3CDZB 4AYUA 1QJFA 1DYOA 5JVVA 5L36A 2OZJA 1WUVA 2LW8A 2WDBA 3AP9A 5EP9A 1RUC3 5I8YA 3KGZA 3JBG2 5A6QA 4K8FA 4XQDA 1H1AA 4PDWA 4NRPA 2OQ6A 3H1WA 3D3UA 2P4EA 3CF6E 4LKSA 3PVEA 1G7YA 3VBHC 2E31A 1UCXA 1PGSA 1W8WA 4CP9A 1LHVA 3EYPA 3E6BA 1FMD1 1TH8B 4N90A 5FYMA 4CCOA 1ZA7A 4I3GA 3W9AA 5FQ0B 1C8NA 4H7LA 4AEDA 2P6HA 5FZGA 5CFDC 1GKBA 1UN1A 2BEOA 3GCXA 3PUAA 5EWSA 3VBRC 2DTYA 5JSOA 3WNMA 1ULGA 3EO6A 3QLQA 3WF0A 4GB31 1YO8A 2WT2A 2XJVA 1VAMA 1RUJ1 4YLZA 1ULEA 3WY6A 1OQ1A 2OASA 4CCMA 5EV7A 4C0BA 1HB1A 4HKOA 3AB0A 3ZXFA 5C8WA 3OD0A 1GOFA 3T1LA 1IOAA 5FY5A 2PHFA 2WNVC 4LBLA 5DZGA 1TILB 1MQTC 5FMOS 5DABA 2ZOEB 3I59A 2W87A 4LUMA 3RNSA 2R041 3IH8A 3WX5A 4XS5A 2VVEA 3APBA 4FOWA 4XUOA 3BPZA 1ZRDA 3KWVA 1VE0A 1H8TC 1S2BA 2JE8A 3GYDA 3A4UA 2B5HA 3V56A 1F31A 4CDUA 3BIEA 1SBFA 2PAMA 3HN3A 3IMNA 1S55A 1ACCA 2RJ2A 2VMEA 1W3VA 1HJGA 4FPHA 3Q8CA 4XPVA 1JZ5A 1PIV3 3IT8A 3M8LA 2WKKA 4BMEA 3PIGA 5FZDA 4G3YC 5GZCA 5JZGB 4LE3A 1TQ5A 5GZFA 3ZVXA 1UPSA 3U0ZA 1NLQA 1NA1C 2KD7A 2W9XA 4PLMA 4FP2A 5F3GA 5FZ9A 4XBNA 1W3XA 1H2MA 2WQZC 1LEMA 2GC2A 3A0NA 3UKVA 1S0GA 1DQ1A 3LZZA 4Q0PA 1YFUA 4QX8A 5T52A 4CXYA 1JOJA 2RDRA 1ULCA 3RDIA 1J3RA 2WA4A 1CZVA 3W21A 3A23A 2ARCA 4D6RA 4OMDA 1BVP1 2A70A 3R4UA 5HXMA 3MIGA 4DMGA 5FJKA 5FV3A 4CEYC 1VRH2 3EB7A 5JUVA 5CISA 1SFNA 3KM5A 2D5FA 2YC0A 4AHXA 1IS3A 5FY9A 4WVMA 2J1RA 4YW1A 1UF2C 5IW0A 3ZMNA 1AYM1 2DBIA 1D4M3 4YZ4A 1VBC1 4COVA 3NKTA 2R071 4NROA 5FPZA 3S0MA 3HQXA 1RUG2 2E7TA 4LORA 2KA5A 1RUH1 2PMWB 4W6WA 1UU5A 3DL3A 3NAPA 5JAXA 3ETPA 4JVAA 1SFPA 4BA6A 2X5IB 4BB3A 4CDXB 1W28A 3O1TA 3MDPA 2QUOA 3SEPA 3U11A 1CAVB 2X8KA 3OEBA 4FQ4A 4IEOA 4QGMA 2IXCA 1F5JA 1ZZ8A 5BNNB 3HWJA 4BJ0A 1HQWA 5GZEA 4YW5A 2FDHA 1TMF2 1QJY1 1BHGA 3WR0A 4XFHA 1PGL1 3Q8FA 5CFCC 1VBE1 2ZGNA 2A3WA 2EVXA 3NMBA 1AJOA 4IE4A 3WUCA 3ZXLA 5IVCA 1Y7BA 2HWB1 1GV9A 4C0HA 2VUCA 3TNPB 5K0UC 3BU0A 4QPIA 4XQ4A 3T0DA 4GMP1 2E7QA 4CU7A 2W1UA 3IM0A 5EZBA 3POGA 4QX7A 3LGRA 5E16A 3VBUB 2WLQA 3RI9A 3T2PA 3ILNA 3WCRA 4MGIE 4AI1A 3U37A 3OYWB 1HV0A 1TZOA 5LA1A 2PXJA 1AR91 4LXLA 4AEJA 3U10A 3V0BB 4KI5M 4LT5A 2UY8A 4XACA 1GBGA 2VBPA 3VZJA 1FXZA 1STMA 3LE0A 3MF9A 2J1VA 1V0AA 1PMHX 4WVVA 5A3OA 3O1SA 2WAOA 1VLNA 4OHZA 4JGYA 2W0XA 5IJRA 4R9AA 1PO23 1W6OB 3W5MA 5FXXA 3RYPA 4IV1B 1C5HA 3HNMA 4PBOA 4LHNA 4QB1A 3IDCB 4BQ4A 4D7SA 2AS0A 1VRBA 2I07B 5A3LA 4PIYA 3VZOA 2WAAA 4MSVA 5F5IA 4B1MA 2R32A 2WN3A 1F8VA 1Y9QA 4BQ3A 2VZTA 3RFRA 3ZR5A 4AL9A 3LOBA 1YFYA 2QQLA 2VTXA 3A7QA 5CKQA 2BRTA 1HXS2 4X8PA 3WXPA 1Y9GA 1UQXA 1RTVA 4BK5A 1UZVA 5IK8A 1XNBA 4OI1A 3DUPA 2XR4A 3ZXEA 1HRV1 1REFA 5EXOA 5FFOC 5KHIA 3ZFGC 3LA7A 3BU7A 2PHUA 4P5YA 4ES9A 4PJYA 5ERLA 5CB7A 3WQBA 3OPZA 3POJA 1PNFA 2GSYA 4AHYA 1YUDA 4RHV1 2P2KA 2YUEA 1DU3D 2TBVA 2XGXA 2ZAHA 4ONUA 4OQ9A 3T2TA 4IEPA 5KR7A 1N1SA 3LDRA 2VZ1A 3TN92 4BCUA 5FZ3A 3ATGA 4LHLA 1PO22 4OUMA 1I9RA 4Q26A 5FXVA 4Y1ZA 1QEXA 2RDSA 3PURA 2WS93 2Y6LA 2X05A 4LHSA 1J3PA 1VBB2 3IPVA 1YQ8A 4QB2A 4XBQA 3GM8A 4WZFA 3HT1A 3O14A 3VHOA 2WIIB 1MZ5A 3O7OA 4H7MA 2WZPP 1EY2A 1EUTA 2XB6C 1GANA 1LEDA 4LOSA 5HCAA 4FPLA 2OUHA 1H1IA 4DUVA 5J36A 3SITA 3AP7A 1LU2A 3MO4A 5FZIA 3FC0A 1QGLA 2R061 5KHJA 4DY5A 2VMDA 4R9BA 3AKQA 1UIKA 1H8VA 2AREA 2Y64A 3J7HA 4E4ZA 2O14A 1MPXA 1WCKA 4N53A 4XDOA 2QBXA 3ZYGA 4BOWA 3D5OA 3JU9A 3E5XA 3OBAA 5EHDA 4LE4A 1DQ5A 4OFGA 2YC4A 2XJTA 4HSJA 3ZTBA 3DUIA 1V6IA 4HFSA 1TME3 2JEMA 3U78A 4CRQA 1RIRA 4FPCA 1AF9A 2C0ZA 2DTWA 2WZR3 1Q8QA 4LQRA 3ZFEA 2Z5WA 5D8AA 3B02A 5F39A 4GWNA 1ODMA 3UESA 2E26A 1CPMA 3R4DB 4GIQA 3TWIA 2RR11 4UFMA 4A3XA 2YYOA 3WINE 1CPNA 3ZPOA 4AVCA 2EIDA 2VD7A 1POV3 4HL0A 1OQEA 5F32A 3SCHA 2Y38A 2WS92 4CCNA 1ENSA 2GNTA 5A33A 2OPWA 4Q4X1 1LU1A 3ZM8A 4BQWA 4XBLA 4NRMA 1CIYA 5FK7A 3BIWE 3OCPA 3ZYHA 3OUIA 2JKXA 2JD4A 5GALA 2JDNA 3RZJA 2VUJA 1QNYA 1JOBA 1RUF2 2ORXA 1FT9A 2XDVA 3MFCA 1NAEA 4AVSA 5CKNA 2WO1A 3MIBA 1QJX1 1ND3C 5FZ0A 1THNB 1OUSA 2VZRA 2E53A 3LDFA 3WOGA 1CAWA 1ENRA 1EV11 1VBA3 2D6NA 4HZFA 4QPGA 4CA9A 2XKOA 1IQAA 2E9QA 2CAUA 5EZWA 3VZNA 3AXEA 1OLQA 4FFIA 3O0WA 3CZJA 2VJXA 5CADA 3GHFA 1W0PA 4YVWC 4TLFA 1RUI2 4XAAA 4ZS2A 4CEWB 3GDBA 1W6NB 1AYN2 1K45A 1OA4A 4A2UA 5FYVA 3GALA 1LOAA 4UFKA 4YGCA 3SH5A 3CJIB 1F9KA 3LOIA 1OF4A 2Y6HA 1UYZA 1I5PA 1COV3 1DGLA 3B00A 4N43C 5A80A 3N36A 4UFHA 4Z92B 1YI9A 2ADEA 2QJVA 4BHPA 2CDOA 2HYXA 2GH2A 5F3IA 1X8EA 1JZ2A 1CR7A 4QGLA 2QKDA 3D03A 4Q0SA 1W0OA 1QXRA 4QXCA 4AI3A 1QNWA 1RB8G 1GWLA 1O4YA 1HW5A 4FI9A 4IEUA 2P3JA 3O5SA 1VC1A 4H3WA 4QDRA 1G9FA 2WQ4A 3LA2A 4Y5TA 3FLPA 2V73A 3CJXA 3I2KA 3GMFA 4TN7A 2Q30A 1VBA2 4P9LA 1O91A 5I0DA 1CQ9A 3MEPA 1JI6A 1TIDB 1QQP1 1WBLA 1RMU3 1SDDB 5C4WC 2Q1MA 3B7MA 1OKQA 5A7QA 4DZGA 5LEJA 3DYOA 1NQJA 2NZ9A 3PL0A 5FP3A 5I8SA 3AZVA 4XEZA 2W95A 4CTEA 2PAKA 4MADA 4BXFA 1NOVA 4NAMA 2Y26A 3PMSA 4YPJA 3KHCA 1JS9A 2RV9A 4KWKA 1WLCA 2RM23 3NWKA 1COV2 2DURA 4JRAA 4Q1RA 1WZXA 1XC6A 1EAH1 2HEYF 2OT7A 1RXFA 3POSA 4KG8A 4OZOA 4MXWA 2HWE1 4ASKA 4D6SA 2QQIA 4RR3A 3PUQA 4GZ9A 2CWSA 1AHSA 2AUYA 4QGNA 3VLBB 4FTEA 1B35C 2X29A 3N9NA 2YFZA 2ZX3A 4CCCA 4EQVA 4QTPA 4DGFA 4PIXA 4B1LA 2FDGA 1S4CA 4RGAA 4YSFA 2JG9B 1GQGA 1ND2C 5B4NA 3MOGA 1WBFA 4P9JA 1LAJA 1SPPA 3LFIA 3P6BA 1WW6A 4QX2A 4GB33 1WW4A 4KMQA 3UV9A 1WXXA 1UIJA 1RUJ3 5F5AA 2PLV2 1ZZBA 2Z69A 5CVRA 2GN7A 3ZMOA 1VAKA 3MW3A 3RVHA 3ZSEA 1LULA 3PJQA 4BIOA 3W20A 4FAGA 5CKMA 1UY0A 1VB2A 4UFIA 1RMU2 1MVEA 4LOTA 1H0BA 1LOBA 4AFMA 2VMIA 5KXCA 4XJ8A 2DBNA 4QX1A 3VBHB 4GHNA 2JDHA 1PK6C 3B9CA 3NKGA 5ANNA 2HWC3 3SLIA 4X6RB 2VE1A 5DQ0A 4EN6B 3KT1A 4EV0A 2HEVF 2R043 3KVAA 2V72A 4XZPA 4WVZA 5IVFA 1V6LA 3HBKA 2NN8A 4YM1A 5CFDB 3VBRB 3JB8A 1O3RA 3AM2A 3MGLA 3AMMA 3RZMA 1SCRA 1FMD2 5GLUA 5JXIA 1FV2A 1DGRN 5FYYA 4CDQC 3ZPYA 1C1LA 4NO4A 4OHVA 2G9FA 4YFZA 4FSJA 3HPNA 3LSEA 3AYEA 2J22A 3DF0A 2QQOA 3OUHA 4KGGA 4K9SA 1XSRA 3OPTA 4AI0A 4BQ2A 3MPPG 5C3RA 2VZVA 3PVBB 2R0HA 4GB32 2WNVB 1CAVA 3P1IA 1MQTB 1RUJ2 3K4DA 1W8TA 1P8JA 1XXNA 2P1BA 3KS7A 1JU3A 2BWCA 2WFPA 4NHYA 4YZ3A 3ZR6A 4EWDA 1NE6A 1Q3EA 4ZU5A 1ZX5A 2WINB 3M70A 5K4LA 4CUBA 1H8TB 1C3HA 1YXWA 2ATFA 2F17A 2PHLA 2VZSA 4B3NA 2HWC2 1YWKA 1YCIA 3ACLA 5F8PA 1UW8A 4XDQA 2VVFA 2D6PA 2YMZA 2R042 3E5QA 4NIGA 4OI4A 1NA1B 4LO4B 3UKTA 3VBUA 4GJYA 3THPA 4F8AA 1T6BX 5C8CA 3J7LA 5I0UA 4LO5B 1W6PA 5IVYA 4Q0VA 4RGGA 4QAWA 4Y33A 4CDWA 3LLOA 1GSLA 1J59A 4JV4A 4L8QA 3I4IA 1HQLA 1ASJ1 2W08A 5F5QA 5IVBA 5D1IA 4ASMB 3F2ZA 5I93A 5AVAA 2VNOA 4ZZ8A 1LOGA 1QJY3 3TEZA 2OW4A 4PBPA 1WWYA 2VW1A 4W50A 1KFXL 3S7IA 4A6OA 3J8F3 2WNUC 1PZ8A 5LCWL 1L3JA 1W2NA 3WD5A 3HIFA 4CUAA 4D69A 4AFCA 2RS31 3M7AA 5BNPC 2H0BA 3TEYA 4S2FA 2WUHA 1J7XA 5FY0A 1KDMA 4MUVA 4FPEA 1XNDA 4W8JA 2ZGQA 3RZHA 4GMP3 5A7SA 4IW3A 1GQHA 1K12A 3PHMA 1O4ZA 2P34A 3WG1A 5K8SA 1XNTA 1M4WA 3NJVA 4UT5A 5HCBA 1UZZA 1BEV3 3WNNA 3ZXGA 1AR93 1WCQA 2B7YA 2QZ2A 3LAGA 1C8M1 2XWBB 1AL0G 1S0JA 1AYM2 4CU9A 1VBC2 1UYXA 2R072 2RS53 4E2QA 4LULA 2ZHNA 3WNLA 3GHNA 2CWMA 1RUH2 1VIWB 2C9AA 2TEPA 3IDAA 4IEXA 4CE8A 4NIHA 4NJ4A 2NLRA 5JMCA 1CAXB 4FP3A 3WW2A 1ZNPA 4ES8A 2DU0A 2VBDA 4HVQA 2BPA2 5K0UB 5FYUA 2DVFA 1OF3A 1ZYBA 4MH0E 4Q27A 2X09A 4EYUA 1QJY2 2GNMA 3WHTA 4JHZA 3VUOA 1ZBA3 2YROA 3RYKA 3PTRB 1GR3A 2LALA 5FY8A 3VDBA 1PGL2 2NPIA 5DG2A 1LHNA 1UY1A 2YC2A 5T3NA 4RFRB 1O8SA 1NCQA 2P6CA 3Q8BA 1H4GA 1HRV3 4PLOA 5FP7A 1LKNA 1YYNA 2NQYA 3I7DA 1HX6A 2W52A 2JKBA 2Y8KA 5H9PA 1GNZA 2DCKA 1WCUA 4HPKA 1SQ4A 1UZYA 4F7ZA 1AR92 2ILMA 2O8OA 2ZCWA 5FPBA 1VMJA 4ET7A 2VTFA 1SLLA 1SLBA 3TRSB 4I3PA 2CY6A 4UBGA 2ZEXA 5A7WB 3VD3A 4IEYA 4BIFA 1RJ8A 2Z42A 4E27A 2FZ1A 2QQMA 3ZYRA 4AK3A 1FYUA 3M3CA 1PM7A 2JENA 2WT1A 4K40A 2WWUA 5T50A 2CL2A 2JIJA 3RJ2X 5EFUA 1RUE3 2WNOA 1SMVA 1Q8SA 3KT7A 4COZA 1GP5A 5EYYA 1C1FA 3ZFGB 3KT4A 5L19A 3J7NA 2XJRA 4NIDA 2JJ6A 2RG4A 1QJU3 1SLAA 2ZGUA 1V0EA 1V0FA 5IWFA 1BZWA 4XZUG 1N6DA 4ASLA 3ZXNA 1AX0A 3AXDA 3VBOB 3BALA 3D82A 1DQ4A 2V4VA 3FL7A 2XONA 1PO11 4CU8A 4YM2A 2VCMA 4RS5B 1HRV2 1W8HA 4QPWA 4JDNA 4ARXA 3UYJA 1W8ZA 1O3QA 1KEXA 4EWAA 2KR2A 3NNLA 2GZWA 3WW1A 5DXDA 3MFAA 2DUPA 2WWJA 3M1HA 5A1LA 4RHV2 1KQRA 2UWCA 4HKWA 4I0AA 4AXOA 1GZWA 5C33A 1GMMA 4MVTA 1OD3A 4YGEA 1T6RA 3A0KA 2OQ7A 4IE0A 1AXKA 4DS0A 3KB5A 5F6KA 3THCA 3LKJA 4CXWA 1OD5A 4WM8B 2ET1A 2BV4A 3M3IA 2UYBA 2FMDA 1HN1A 1LESA 4SLIA 3VBFA 3Q8EA 4Q4X3 2Q1FA 5CG8A 3D0SA 4BQ5A 2W91A 2BYVE 1GP6A 3ENRA 4QKFA 1ULFA 5DDJ1 4ZS3A 1CX4A 3W59A 2FZ2A 4FO9A 2V5YA 4IV3C 1NXMA 2BNOA 3VL8A 1QJU2 1O3SA 3B94A 4H55A 1RINA 3P3NA 1R081 2EICA 2XHKA 2ZGLA 5EIYB 2A6XA 1X50A 2VZ3A 2ZGKA 1W2AX 1VMFA 2R062 3OGVA 2ZMKA 4NHKA 1FC9A 1EV13 1ONAA 2JB4A 4PF5A 4RFT0 4GAZA 4DUXA 2CWWA 4XXAA 4FPGA 5D21A 3VD9A 2CU5A 1AR61 3VDDC 4M4RA 5LA2A 4XQWA 2EAAA 5LEKA 3ZX7A 3Q8AA 1GZCA 1OKOA 3H0OA 1FI2A 5GLWA 3HQUA 1HB4A 3WSOA 3X29B 2RR12 2YV8A 4HKLA 4XUTA 3MGUA 5FTTC 4ZXEA 5L7OC 1WLTA 2RMU1 1QOOA 4UW6A 5FLIA 1GU3A 4A4AA 3M3QA 5K9YA 1ND3B 5D2AA 4O9GA 2GMEA 3WP6A 2DFBA 4Q4X2 4KNCA 4YW4A 4A44A 2CHHA 3BKZA 2ORZA 1LNSA 4D94A 2VY0A 1MR5A 2YHJA 3KQ4B 3WNPA 5A70A 2DWRA 2PQQA 3DECA 4N9IA 4Q2FA 2ID4A 4AQTA 4CP1A 1KFUL 4QHZA 2LTNA 4AEKA 4Q4W1 5FMOL 2VUAA 5EUSA 2VMCA 1W2OA 5BNOC 3OGSA 4QQHA 1QJX2 2IXHA 4YVWB 1UKRA 5FK8A 1ZREA 2JICA 4M3CF 4QXKA 1HV1A 2O1QA 1PVC1 3EBRA 1EV12 4J6GA 2YDEA 1SZBA 4QXBA 2EXKA 1REEA 2XHNA 1LOCA 2QDNA 4EE2A 5KXBA 4JDOA 5ABJC 2Y6FA 4N43B 5FZOB 5T5JA 1LGCA 5JXHA 2B78A 1NYWA 1BUZA 2ZAAA 2ZS6B 3SMHA 2YU2A 2PA7A 1JTZX 1NG0A 1R64A 1UOGA 5CG9A 3BN6A 4PDWC 1DLCA 3AKRA 1QJZA 3WP5A 4L92A 3I2JA 1DZQA 5E88A 2BDRA 2ARXA 2XJPA 2YGMA 2Q8EA 5CA6A 5FO8B 5I91A 4N7IA 4HN1A 2Z79A 2RJKA 4UFLA 1ZRFA 2D6KA 4LBQB 3N7LA 1GOHA 3NV1A 4K8RB 5IAVA 1W6QB 1BVVA 2D43A 4AEDC 2W68A 4R8HA 3JQWA 3N7JA 1RXGA 5EJZB 3ACFA 4YVSA 2N7GA 3TNQA 2Z4FA 1BYHA 1V00A 3WG2A 1H2NA 1QF3A 5CFDA 3H8OA 4GKYA 3BPSA 1VRH3 4GJZA 3N35A 1U5YA 2JE9A 4HSLA 1BPLA 3VL9A 1X82A 3AX4A 5T5OA 3SKVA 1H1MA 3NSTA 1W6MB 1XBFA 2VCCA 5J48A 2XKPA 3AGEA 2XVGA 1CN1A 5FZHA 4LKFA 2VW0A 3CEWA 3AJZA 1SHWB 4CSWA 1QY4A 1RUG3 3D4KA 1LB2A 2AZ5A 1QQP2 5FZLA 1FOD1 5JMOA 4JKLA 4M0HA 3ZKUA 1VP6A 1HB2A 3ZXAC 5F5CA 1D2SA 5DUXA 1WMXA 4UF0A 3MV01 4Q4Y1 4QQ2A 2TUNA 3IH9A 1GUIA 1OH3A 3HBZA 4BWOA 4L99A 4EROA 1B35B 5FMBA 1FPN1 4CDUC 4PQQA 4Q8LA 1TMF3 3GBWA 4HLTA 3KGLA 4IEQA 3I2OA 2VW2A 3FMGA 4XTMA 1EAH2 1ND2B 5FYSA 1HRI1 3HJRA 2HWE2 2BFUL 1O5UA 4JRLA 4CYDA 1W03A 1DQ0A 3FFZA 1MS9A 5I0TA 1NKGA 4IGOA 3ZXKA 3FE5A 2YXSA 2W94A 3N7KA 2XJUA 2SBAA 2FCVA 4QPYA 4AWDA 5A32B 4Q4V1 3I8TA 3AYAA 3VZMA 4ZU7A 1DYKA 2YPJA 1H4YA 2Y60A 1EYBA 1QMJA 2OS2A 4MX3A 3WDXA 3O1VA 1PK6B 5IFTA 1VJ2A 3TEXA 1IS4A 2LUWA 3B9IA 4XW3A 1V6OA 2EALA 1XSQA 4Z2WA 1I6XA 2OYZA 1ULPA 3I2DA 1I1EA 3AP4A 3WUDA 1V6MA 4OMCA 5TSWA 5LY1A 3USUB 2J7MA 3ACHA 1U5IA 3HNBM 4XC9A 2B9VA 5H9QA 2G19A 4AFBA 3U4XA 1O3TA 2YG0A 1T2XA 5FMDA 4XJUA 4CDQB 2ZMNA 1RGSA 4P00B 1DF0A 4BZ4A 4DRVA 5EJ1B 2A6WA 4IL7A 4P9IA 4Y26A 4NN0A 3NAPC 2MEV1 3B5LB 4XMIA 5C5UA 1MS0A 3U75A 2XQRA 3WQ1A 2VULA 4YW7A 2VVDA 1HXS3 2BBAA 2ET7A 3HEIA 4FQZA 2K2SA 2ZGSA 3GJBA 1AX2A 1GNHA 1OT5A 1R1ZA 5CZKA 2WYSA 2IFWA 3I3QA 2EXJA 2CGNA 2B46X 2A3YA 1B09A 3KCYA 1JYCA 3ZXJA 4Y22B 3RPQA 4B8EA 4XIKA 5A3TA 4IQPA 4XHXA 2BOIA 1FNZA 2YY1A 1WKYA 1FX5A 4YW6A 4RL7A 2ES3A 2ZX4A 4YG3A 1O4TA 2CTVA 4QPIC 1DCSA 3I2HA 4CPBD 3TEWA 2E7AA 4CUCA 2XUMA 1A6CA 2RS11 3TN93 1Z7S3 2WFF1 4QQOA 4HG6B 5CNAA 1W2UA 2ZGTA 4BK4A 2DXNA 1VALA 1NZIA 3KV4A 4NOTA 2OX0A 3DYMA 2XPJA 2PHXA 5CIRA 4FFFA 1C8M3 1VBB3 4M3CB 4OI2A 4TLGA 3ZIWA 2P3KA 4F3JA 4JGYC 3SNMA 4MOAA 3VD4A 1N1TA 3VN4A 3PU8A 1H9WA 2VG9A 4KU7A 1Y9MA 3VZKA 1AXZA 4DY3A 4XFAA 3KCXA 2WNUB 3WG4A 1LHWA 3GJAA 3OPWA 3RG0A 3DPRA 3VSEA 3K2OA 1JYNA 2BGCA 3P5BA 5BNPB 5FYHA 2J1SA 4XTPA 3OY8A 5GJ6A 4Y24A 2C5DA 5KC5A 1OI6A 1FV3A 1PZ9A 4P08A 5C3OA 4XCBA 5I0RA 2FMYA 3B01A 2V4AA 1BBT1 1W0NA 2JG8A 2WZ8A 5FREA 3T30A 4DXZA 3MZHA 3VDAA 2RS32 1JW6A 3MUZ1 3PMEA 3ROUA 1JYVA 3V8VA 5E1RA 5JOZA 5C3SA 3GZUC 1OLMA 1VBD1 1Z7S2 3HOBA 3IAQA 1VAVA 4XVHA 1DZRA 5E89A 4W65A 3FBMA 2QQVA 1TNRA 2LS6A 3SHRA 2JDMA 4UOJA 4JHTA 1NCRA 3ZXDA 4I0BA 2BQPA 3VBOA 2R6QA 5KC6A 2KM2A 2CSGA 1POV0 3THDA 1KS4A 5C3QA 3I2FA 1C8M2 3K3NA 4R4ZA 3VKMA 1A8MA 2VR4A 3HT2A 3IZOA 4RS5A 4XUNA 3V65A 2YU1A 2C24A 1V9U1 2VOVA 4R52A 4AAXA 1TE1B 1RUF3 4GKXA 4JZRA 1F2NA 1S0BA 1YFWA 4DB5A 3INAA 2VQUA 2WSVA 3M4FA 4XJZA 3RGBA 5FXWA 1CGPA 1GZ9A 1LGBA 4NRQA 3MIDA 4W6YA 4KBZA 5JR7B 4LLFA 5FLJA 2DCJA 2VNRA 1BMV2 5LA9A 4CXXA 4D8MA 3KHBA 4AG4A 3A21A 3I3EA 3WDYA 3KF5A 1E5IA 3N9PA 3GHMA 3ZFFB 4WM8A 5A6XA 1DGWA 3WNOA 3H3ZA 4P02B 5AFBA 4XJ9A 5IATA 3A22A 1WCDJ 2FCTA 4DIQA 1RUI3 3N3HA 4GH4A 3LA3A 1AYN3 5C3PA 2QQNA 2XH6A 3E1F1 5FYBA 3MW4A 3VB9A 3BI3A 2W1WA 4WM7A 1HIXA 1WCSA 5HBAA 2D3PA 2WZEA 4M4PA 3ZFEC 4OVEA 4K21A 3DCQA 4DPNA 4KG0A 1O7FA 3PIJA 5JI7A 5F3CA 3I3BA 3WCSA 5AC93 2IUWA 5CAZA 4KH9A 4IESA 3KLSA 2XJSA 3AL6A 4BE3A 2DDUA 3T0BA 5SV8A 1YFXA 3NNFA 2A73B 1CJDA 3IN9A 5FBZA 1JZ4A 3MBWA 1OOPA 1S0EA 1W90A 1UYPA 2OXBA 2C4XA 3POWA 1W8UA 4NPRA 5GZDA 3RZLA 3BYWA 4LBMA 2ZABA 2YPDA 1GLHA 5DDJ3 1K5MA 3BCWA 2VM9A 4INDA 4RYDA 5KHGA 4HMZA 2XXZA 4YGBA 5IVVA 1QOSA 3J26N 4EZHA 4QPGC 1EPWA 2FDJA 1CD3G 1F15A 1PO12 1TVGA 4QM9A 5ANQA 2Q8CA 1G9DA 1IQDC 4KBBA 3C2UA 1LODA 5DAQA 4A7YA 3RMYA 3ZKYA 5HPOA 2A3XA 2D6MA 1AL23 1Q43A 2WO2A 2XLGA 4AVVA 2Q1ZB 2PHTA 3CMGA 3WDWA 3NNJA 3UJQA 3AKTA 1JN2P 1CIWA 4RQPC 2NMNA 4EN7B 5AC92 1CESA 1KJRA 1DFQA 1H2LA 1SEFA 1UX7A 4AF9A 4BH9A 4DINB 4C91A 4IV3B 3KCCA 2GN3A 4CCJA 1SBEA 5FZOA 2W46A 1RVF3 3UGHA 3AYCA 4V2VA 5FRAA 5I8TA 2BBVA 5JSRA 2R0FA 2ZGOA 4I0WB 5C9AB 2B8MA 5A7NA 4N8MA 2NM1A 1N6FA 4LR4A 2PLV3 3CKHA 5FQ0A 1CX1A 1J83A 5DDJ2 2ZXQA 5FKCA 4XUPA 5T5PA 2OKXA 5J96B 1OC1A 4O7XA 1RUD1 3K51A 4Q4W3 4LBQD 3NJYA 2D44A 3VDDB 2IXKA 1R082 1W9YA 2WWSA 4GQ7A 1PMJX 2ADDA 3O1RA 1G6NA 2PAEA 4Z07A 1MS3A 4AVBA 1PVC3 4YFWA 4X6QB 1XE7A 1Q56A 1S1AA 2UY9A 3OB8A 3EHKA 4AI8A 1J1TA 1TG7A 1V6JA 5FWJA 1AL22 1QHDA 4LITA 5L7OB 3OBTA 3NJXA 3BOPA 1AR62 2GU9A 3PLQA 2Q4SA 1UY4A 4MGSA 4MXVA 1RUC1 1UAIA 2J1EA 3H3LA 1FMD3 1Z0HA 3M3OA 4NPLA 3MIEA 1MS5A 5L9BA 1X9PA 1UD1A 3QD6A 2HLEA 5KHHA 5IK5A 2ZMLA 1AUZA 2QZ3A 2BP6A 4KU8A 4LBOA 1UX6A 3O1MA 1ZRIA 1RVF2 2RMU2 3LPGA 1D0GA 4Y1YA 4RR3C 3KMHA 4JC1A 1UXZA 4S2DA 5BNOB 2PHRA 2AYHA 2CDPA 4L0PA 2A7AA 2VXRA 4JCKA 4C1WA 2DFCA 2OVUA
chains in the Genus database with same CATH topology
4HANA 2VU9A 5JI9A 1EP0A 1BJQA 1B35A 4FOQA 3DORA 1S0FA 2ZHLA 1J1LA 1D2QA 2ZA9A 4MYEA 4Q4W2 4TYSA 4AHZA 4E2SA 4JGZC 4P9YA 3FJSA 4Q8KA 2F6BA 5BXXA 2A5ZA 5BYNA 4FTBA 1X7NA 4YW3A 4DRRA 1PVC2 2R16A 4PDWB 3EQEA 3TOJA 4L11A 1OA2A 4KWJA 2K9ZA 3WZ1A 3SCFA 3ME2A 1FOD3 4YW2A 5F6LB 4NHMA 5JWPA 4MLOA 1OHFA 4AEDB 3ZO0B 1XNCA 4FPJA 4QT6A 5BUVA 1X8MA 3ASIA 4R9CA 5FAXA 1FPN3 4XFGA 4LO6B 3H9AA 1PIV1 1ZZCA 4BM8A 2X5IA 4MGYE 4CDXA 1QWRA 5IT6A 5DUWA 2E51A 2B9UA 4EN8B 1VB4A 5BNNA 1H30A 4GA9A 2BNNA 3MLJA 4Q4V3 2GC1A 3WV6A 2MPFA 1BXHA 4D3WA 1RC6A 4BQ1A 3I59B 4I30A 2WT0A 1AYM3 5ACA1 4CP2A 1VBC3 1YIPA 2R073 4RA0A 4Y22A 2BTVC 3UL2A 1QOTA 5BNQA 1H2KA 2XL9A 1QXPA 2GMMA 4BYYA 4FTSA 1AR71 1Y3TA 1RUH3 1ZA4A 1FOD2 3OYWA 5DZFA 1D4M1 1ZZ6A 3V0BA 3WVJA 5C6CA 3MI8A 3AMHA 4AVAA 2DVGA 3FLRA 3AP5A 1ZBE1 1JUHA 4Q4Y2 5C8CC 1SBDA 2DYCA 3GF6A 3AYDA 1FPN2 4CDWC 1W6OA 2MEV3 4CEYB 1V6NA 1YNAA 2ENRA 4IV1A 1DYPA 1HRI2 4ATFA 4QQLA 2IZWA 4F83A 1OFNA 1VBE3 4AFAA 4N9HA 3VBSC 2EXHA 2HWB3 2E63A 4FT8A 3THTA 3KZ4C 2Q0AA 2GH8A 2XJQA 4Q4V2 3RJRA 3EJKA 4WVMB 4L97A 1S0IA 5BPXA 4C90A 4CP0A 2DCTA 5DUUA 3NV3A 4QU2A 4OULA 3NAPB 4WBBA 4AGVA 4ZKTB 3MLLA 1SACA 2ZKLA 3RRDA 3R05A 4GXLA 2I45A 5CFCB 1IS6A 3G7DA 4B7KA 4GWMA 1RITA 1WD3A 1PO21 4IXLA 4P14A 2CV6A 1CAUB 4Z8BA 2MEV2 5JIUA 2ZOAA 3K48A 4WV8A 2JECA 4LUKA 1CVNA 5J98B 4FOVA 1PVXA 3ES4A 1VBE2 2GALA 4MV2A 4QPIB 2HWB2 3RS6A 2R1BA 1MS8A 5GLTA 4A7KA 2VOXA 3B69A 4XF3A 3AMNA 3ZN5A 1UL9A 1ZZ9A 4RD7A 1NCQC 4RHV3 5GKAC 2D97A 3ZSJA 1UU6A 1DQ2A 4IETA 5FO7B 4JGYB 2LM3A 1U5ZA 3WDVA 2ZHKA 1WLDA 2RS12 2WFF2 4XIOA 3ZFFA 4YG6A 3O12A 2RRLA 1T6GC 3NV4A 4BLIA 3N4MA 1R1A1 1GYKA 3M2MA 3B3QE 3ES1A 2WS91 1I3HA 3LWCA 2P37A 1V9U3 3URFA 1FC7A 1PGW1 1H4HA 1IKPA 2D40A 4LO7A 5JPNB 3H1MA 3U07A 2GDFA 4Y4YA 2R063 3S7EA 2WSUA 3O0XA 4OZXA 1ZRCA 1G9CA 4XHBA 4XFBA 3G6JB 4N7UA 5I0SA 4M01A 3BB6A 1LOFA 2DUQA 2UU8A 2QNKA 1BBT2 5T5LA 4Q0UA 4XILA 1QXJA 5EJ3A 1VBD2 1LRHA 4XJWA 1TME1 2RR13 3GBGA 1LENA 4YZ5A 1C4RA 5T55A 5BY5A 4LA3A 4XF9A 2WZR1 3IPVB 1BK1A 2IXLA 1QDCA 4CEWA 1W6NA 2ZACA 4M0NA 4YNIA 4Z1VA 3AKPA 3CJIA 1POV1 3FBYA 4S2HA 1YRZA 1V9U2 1JBCA 3L2HA 3AFKA 5JOXA 2ZPXA 4BLJA 3VBFC 3USSA 2ZKNA 2ZX0A 1QJX3 3AJYA 2WNEA 3NO8A 3GZTB 2CGPA 5BV6A 4Y1UA 3UKNA 1ENQA 4UW3A 4GULA 1QU0A 5C9AA 3ZFEB 3AK0A 1ULDA 4E9KA 1A78A 4K6BA 4FXKB 5GLZA 3WDTA 1C5IA 1MS1A 3WP3A 2PTMA 1AR81 1A3KA 5KHKA 2PHDA 1J58A 1APNA 3J4UH 2OZ6A 1NQDA 1COV1 1GICA 2A6ZA 2GC0A 3QH7A 1OA3A 4P9GA 4QMAA 3FUQA 5AVPA 1ALYA 4I01A 5SV5A 1K32A 5KWRA 4Q1PA 4LTAA 3OTFA 4QPGB 3IWZA 3Q9OA 4G4FA 1QQP3 2JG9A 1LECA 2ZGPA 5GZGA 4RQPB 5FCCA 5LRSA 4QM8A 2ZGMA 4FVVA 3V0AA 3L2YA 4XF4A 3VKFC 1YI7A 1Q5OA 3VBHA 3FUOA 2EA7A 4ITCA 4G9SB 4Y1VA 1EAH3 1KJLA 5J09A 2HWE3 2DCZA 4FAHA 4YARA 3WT3A 3GBFA 2RM21 1NLSA 2C1FA 2WA3A 4I2OA 2OUJA 2WJSA 1RUOA 4QHBA 2VNGA 4K1YA 1MZEA 1U12A 3VBRA 5C4WB 3E97A 2FBEA 3H3UA 2A6VA 2ERFA 1DLLA 2D6LX 1F5FA 1SFYA 4YVSC 1CONA 4NWWA 3ZDSA 2RJLA 5H9SA 1LHUA 4LBNA 4MGKE 3DJAA 4YM0A 3VKLA 3GZAA 1RUD2 4LBJA 4MGZE 1ZZ7A 2CYFA 2QCSB 4JC0A 4YYOA 2D6OX 2WNVA 1AUYA 1MQTA 4AGGA 3RSJA 3TB0A 4AQ6A 2P17A 2R49A 1YIFA 4Y20B 4W6XA 3VHPA 5HXVA 1FATA 1H8TA 2HWC1 1H9PA 4MXWB 3R6SA 2D7FA 3N7MA 4RR3B 2ZHMA 3KD4A 1RUC2 2DU1A 2VOKA 3ELNA 1PZ7A 4NR1A 1NA1A 1C28A 3OF1A 3JCIA 1SCSA 4JGZB 1G86A 2HJIA 2IC1A 3TBDA 2D5HA 4FBFA 2SLIA 2ZZJA 3H1YA 1GFF2 2F4PA 2P3IA 2WLPA 3IDBB 1AJKA 2DXLA 2TNFA 3FLTA 3OGGA 4CEYA 5J37A 4OHXA 2ZGRA 1IHMA 3AMQA 4P5HA 4BPZA 3AMPA 2GNBA 5ACA3 4LNVA 3RWNA 3AP6A 4Q0QA 4OLLA 1V6KA 1AR73 3RYRA 1IS5A 1WLWA 3OGJA 4HT1T 1RHI1 2ZX2A 3C3VA 3FFQA 5FO9B 4HETA 1LHOA 2XBO1 1ZBE3 3VKNA 2ZBJA 1ASJ3 3MW2A 4J1WA 1XQNA 1U0AA 4EN9B 1PIV2 1CAXA 5CFCA 1G8WA 1JXNA 4JTOA 3AFGA 1YJKA 3QACA 5K0UA 1R091 2AENA 2RS33 3LB9A 5IK4A 4BMBA 3KSCA 1AZDA 1CAUA 3ZSLA 3J8F1 1X36A 1OPMA 3AZXA 4L8KA 4D7YA 2XLAA 2RHPA 3MYXA 1ENXA 4R9DA 3MIFA 4B4PA 2BFUS 5ACA2 4FOYA 5C8CB 3WW4A 5J7MA 5F1RA 1NY71 5JOYA 1W6PB 1BEV1 2PFWA 2WC2A 4CDWB 1AR72 5B2GB 4UW4A 1D4M2 1OMIA 2RS51 1URXA 3SH4A 1WGPA 4HBNA 3VBSB 1BCXA 1YLLA 1ZBE2 1ASJ2 3FHIB 4COUA 2GAUA 2IWGB 1MS4A 1DG6A 2AH2A 4WZCA 3DPRC 1HKDA 1IPKA 2G4IA 1LJ7A 4V1PA 1KITA 1UMZA 2HWF1 3ST7A 1QH6A 3P3PA 1ZBA1 3DN7A 4IEZA 3ZFGA 3L9JT 3V64A 1MZFA 1Q8VA 1NXD1 2JG8C 5LK5A 1IGOA 4EN0A 3VKOA 5HCFA 1XYPA 1YHFA 3CL1A 4K20A 1AXYA 3OD4A 4EJRA 4E4DX 1NCRC 4TZDA 3VBOC 4URTA 3AZWA 4RS5C 2YGLA 2IFRA 1KXGA 3VGIA 2EAKA 2VOWA 3I54A 1R1A3 4AI2A 2HWD1 3ILFA 1OSGA 1RUE1 1FC6A 4XE9A 5IK7A 4XF1A 5JOWA 4ISQA 4PIZA 1NCQB 4N53C 2UYAA 1PO13 2DVBA 1QJU1 4H14A 4O9EA 4WM8C 3NJZA 4SBVA 3JZVA 4HPKB 1RUNA 2HYKA 2EXIA 1WD4A 5E8AA 4GH4C 4YG0A 1KS5A 5D8AC 2RE9A 2A71A 3JD71 1D0HA 4AW7A 4UBHA 4HK8A 4WM7C 2Y0OA 4PQ9A 4QQPA 1MZ6A 1U5XA 4NVPA 2JE7A 4XETA 1NZCA 1N3QA 4L9BA 4AGRA 1UU4A 2OA2A 4DNYA 4UXAA 1QKQA 1R1A2 3IBMA 3JB4C 4Z82A 1MEC1 2ETEA 3FWEA 1OOPC 1PGW2 4XF0A 3S6PA 4LHKA 1IKQA 1ND3A 3ZN6B 2MHFA 2YZ4A 3OBRA 1A8DA 1R083 5CBLA 4OUSA 1ZM1A 1K5MC 3E6DA 4QX5A 3J9SA 1Z78A 2Z2SB 1OLRA 4LO8A 1GZWB 1AR63 5DG1A 4YVWA 3LSDA 2HKXA 3ALQA 3JBG1 4GALA 1XE8A 3E5UA 1FNYA 2O0OA 3D6EA 1DQ6A 1TNFA 1J3QA 1TME2 3RMXA 4N43A 4XFIA 3EXUA 2RMU3 3VBFB 1AR83 2WZR2 5DUVA 2D3SA 2VQ0A 1HQNA 4RQPA 3SXWA 3BTAA 3H7YA 2FHRA 2GMPA 2X53S 4FXGB 4E2GA 5AFEA 3DGTA 5JZGA 1WW7A 1LR5A 3QOPA 4D7TA 2CGOA 3GNEA 4DQAA 4LBQA 5IUQA 2VECA 1WMDA 1W6QA 4META 2EF6A 1JYIA 3RI8A 2XLFA 3WQ0A 4PLNA 3NL1A 3ZN4A 3DKWA 2K0GA 5C4WA 2OIIA 4AQSA 4LBKA 3MIHA 3VV1A 3WG3A 2VGDA 1DZTA 3E6CC 1W6MA 1WA4A 5H9RA 3PTYA 2QVSB 4KL1A 3POYA 1DGWX 3AZYA 4L1CA 1SDWA 1AR82 3UJOA 2XWJB 4OHWA 5FDBA 1XU2A 1G9BA 1XU1A 4B29A 1G9AA 1DHKB 1KRIA 3MLKA 4Y20A 1BKZA 3HAGA 1LGNA 4X8NA 3VHRA 5ABJB 4I02A 1MVQA 4XXPA 3SISA 1ND2A 2QQPA 3IKWA 4KGQA 3TYJA 4DOUA 5GLVA 5JZGC 2FQPA 1VRH1 5JDBA 4LLOA 1SLTA 5A32A 4CZSA 4JGZA 1UPIA 2Y0IA 3NVCA 3W58A 3DV8A 3QBQA 2QDRA 3K50A 1PK6A 2JDZA 5JLVA 2UURA 2XG3A 4YZ2A 1RUG1 2AR6A 1QDOA 5KXDA 4Q4Y3 1E57A 3SH3A 4AEMA 2BW8A 1LCLA 2BVVA 4XOGA 2BWAA 3H7JA 3USUA 2UWAA 5CU1A 3ZYIB 4XJAA 4TSVA 3AKSA 3QH6A 4YGDA 5LRRA 1HRI3 4YVSB 5LK7B 4CDQA 2ZZQA 2RM22 1TMF1 2DCYA 5GM0A 2A75A 1N1YA 2VMHA 1DGRA 2X5IC 4CDXC 3WP4A 3CU7A 4DFSA 2A6YA 1WMFA 4XFCA 4GMP0 1M06G 1HDKA 5BNNC 1JUIA 4IEWA 1DIWA 2ZO9B 2IXJA 3RZZA 4K7JA 1LTEA 3CLPA 4CDUB 4HN0A 2VMGA 3IDEA 2ZX1A 3WQ7A 1DDLA 3WDUA 3MF6A 1LOEA 3PJYA 3HR9A 4WVWA 1XYNA 2XL7A 4B7EA 1N6EA 2CNAA 1JHNA 3M3EA 3KQRA 4Q29A 5A3MA 3VBUC 1WMEA 4KWLA 4LEJA 4IERA 2ARBA 2MNGA 3PVNA 1XRUA 1RHI3 1Q8OA 2XVKA 4MZUA 4P9XA 2PELA 4M3CA 4IEVA 2XBO3 1AX1A 2B39A 2UWBA 4JDMA 1HXS1 4YM3A 4IV1C 5JPMB 3ZIXA 2DVAA 2WNUA 1XNKA 1N3OA 5KBFA 2CAVA 2EIGA 2VQAA 1SLIA 3VBSA 5BNPA 2B45X 2JXAA 1DBNA 1R093 4COYA 2NMOA 2VH9A 2RS13 4LA2A 4S2GA 2WFF3 1QH7A 2D93A 4L2NA 2O8QA 5J3UA 3ZYPA 4M00A 3TN91 1Z7S1 3CNAA 4Y1XA 3WLUA 2NYYA 3H50A 1JH5A 4HVRA 4PCRA 4YRDA 1ZRRA 4B4RA 2D98A 1ZVFA 2R1DA 4JQRA 4YZ1A 4C1XA 4A7ZA 1I5ZA 3NV2A 1VBB1 1RHI2 4FPFA 1RJ7A 2VPVA 1UKGA 1OPOA 3JUUA 2G9GA 1AVBA 2XBO2 5JCTA 4Y5Z0 1BQPA 4ZU4A 4HK9A 5L73A 2JX9A 1N1VA 2D3RA 3VHNA 4AHWA 1MACA 2ZTNA 3RQ0A 2QFEA 1BMV1 1BBT3 1HLCA 4FPOB 2I74A 3ZYJB 1R092 2HWF3 1PHMA 3VZLA 2W39A 3J8F2 1VBD3 3O0VA 4I09A 1NE4A 2WL1A 4DMIA 3WHUA 3JQXA 4AVTA 3R0RA 1D4VB 3QCWA 1SLCA 1FCFA 1CJPA 4AQ2A 4FPKA 5JSPA 1Q8PA 3ZFFC 1KD7A 1NY72 1BEV2 3AZZA 4RSUA 4UW5A 3DPRB 4AFDA 2RS52 4FPYA 1EPZA 3D0JA 3OY8B 2Q5TA 1S0CA 1RUF1 3PNAA 4U36A 2IXIA 3S30A 1W39A 2HWD3 2JG8B 3LCPA 3FX3A 2B42B 3T1MA 4NWVA 3CO2A 3H8UA 2HWF2 2KA3A 1ZBA2 3BOWA 5HI0A 1LOFC 3UK9A 4QD2A 1NCRB 1IPJA 2E6VA 1C57A 1RUI1 2QE3A 4K1ZA 3ZN6A 5FOBB 1AYN1 2KXLA 3HD8B 3NW4A 2ZJCA 3ZSMA 3FZ3A 2H6CA 1V70A 2GC3A 3JD73 1RL3A 2AGSA 2DVDA 5DZEA 1IZ3A 1S2KA 4ATEA 4CEWC 2BVBA 4XFFA 5AC91 3CJIC 1PNGA 4N53B 4P9WA 5KXEA 1WW5A 4ORFA 1NLRA 1MEC3 1Y43B 3BODA 4IV3A 4U2AA 2PHWA 3OJBA 5EYXA 2HWD2 2Q8OA 1O5LA 1RUE2 1REDA 3HN1A 4GH4B 5JIAA 1VBA1 4TWTA 2BNMA 1FAYA 5K7PA 2R30A 5D8AB 4E4SA 2NP0A 3IIAA 3WW3A 4WM7B 2PYTA 4EWEA 2PN5A 5C9AC 3PVOA 5A33B 3VDDA 1TEIA 5T54A 3ETQA 4ISRA 1PMIA 3ILRA 4COWA 3R4SA 3JBG3 3JD72 1AL21 2OPKA 4KQ7A 3TAYA 1S0DA 3D8CA 5L7OA 1X33A 1OOPB 5F9TA 1OFSA 1YJLA 3HMYA 3ECQA 3ZSKA 4JTNA 1CAWB 5FLHA 3MPBA 4XYXA 1OQDA 2H0VA 1VR3A 1K5MB 3SCGA 1RVF1 5FOJB 4FCAA 1MEC2 2XVLA 4XMAA 2DV9A 2HEWF 5FPXA 4HVOA 2H6BA 4JAAA 4ZXKA 5BNOA 1RUD3 4M3CE 2DUOA 2PLV1 4J1XA 4K3UA 3MICA 2GNDA 1N3PA 1KDKA 1XYOA 2I2SA 3B93A 4B4QA 2BUKA 4OHYA 3WNXA 4R4XA 1N47A 1RMU1 4NHLA 2JG9C 2DF7A 2V09A 4OI0A 5ABJA 4AYUA 5JVVA 5L36A 2OZJA 1WUVA 3AP9A 5I8YA 1RUC3 3KGZA 3JBG2 4K8FA 4XQDA 1H1AA 4PDWA 3H1WA 3CF6E 3PVEA 1G7YA 3VBHC 1UCXA 1PGSA 1LHVA 3E6BA 1FMD1 4N90A 4I3GA 3W9AA 5FQ0B 1C8NA 4H7LA 4AEDA 5CFDC 1GKBA 1UN1A 2BEOA 5EWSA 3VBRC 2DTYA 5JSOA 1ULGA 3EO6A 3QLQA 4GB31 1YO8A 2WT2A 2XJVA 1VAMA 1RUJ1 4YLZA 1ULEA 3WY6A 1OQ1A 5EV7A 4C0BA 4HKOA 3AB0A 3ZXFA 5C8WA 3OD0A 3T1LA 1IOAA 2PHFA 2WNVC 4LBLA 5DZGA 1MQTC 5FMOS 2ZOEB 3I59A 4LUMA 3RNSA 2R041 3WX5A 2VVEA 3APBA 4FOWA 3BPZA 1ZRDA 1H8TC 1S2BA 3GYDA 3A4UA 2B5HA 3V56A 1F31A 4CDUA 1SBFA 2PAMA 3IMNA 1S55A 4FPHA 4XPVA 1PIV3 3IT8A 3M8LA 2WKKA 4BMEA 5JZGB 4G3YC 5GZCA 4LE3A 1TQ5A 5GZFA 3ZVXA 1UPSA 3U0ZA 1NA1C 4PLMA 4FP2A 4XBNA 1H2MA 2WQZC 1LEMA 2GC2A 3A0NA 3UKVA 1S0GA 1DQ1A 3LZZA 4Q0PA 1YFUA 5T52A 1JOJA 1ULCA 3RDIA 1J3RA 2WA4A 1BVP1 2A70A 3R4UA 3MIGA 4CEYC 1VRH2 1SFNA 3KM5A 2D5FA 2YC0A 4AHXA 1IS3A 4WVMA 4YW1A 3ZMNA 1UF2C 1AYM1 1D4M3 4YZ4A 1VBC1 4COVA 3NKTA 2R071 5FPZA 3HQXA 1RUG2 2E7TA 1RUH1 4W6WA 1UU5A 3DL3A 3NAPA 5JAXA 4JVAA 4BA6A 2X5IB 4CDXB 3MDPA 2QUOA 3U11A 1CAVB 2X8KA 4FQ4A 4QGMA 4IEOA 2IXCA 1F5JA 1ZZ8A 5BNNB 3HWJA 1HQWA 5GZEA 4YW5A 1TMF2 1QJY1 3WR0A 4XFHA 1PGL1 5CFCC 1VBE1 2ZGNA 2A3WA 2EVXA 1AJOA 3WUCA 3ZXLA 1Y7BA 2HWB1 1GV9A 4C0HA 5K0UC 3TNPB 4QPIA 4XQ4A 4GMP1 2E7QA 3IM0A 5E16A 3LGRA 3VBUB 4AI1A 2WLQA 3RI9A 3WCRA 3ILNA 4MGIE 3OYWB 1HV0A 1AR91 4AEJA 3V0BB 3U10A 4LT5A 2UY8A 1GBGA 3VZJA 1FXZA 3MF9A 4WVVA 4OHZA 1VLNA 4JGYA 2W0XA 4R9AA 1PO23 1W6OB 3RYPA 4IV1B 1C5HA 4PBOA 4LHNA 3IDCB 4D7SA 2I07B 5A3LA 4PIYA 3VZOA 4MSVA 1F8VA 2R32A 1Y9QA 3LOBA 1YFYA 1HXS2 4X8PA 3WXPA 1RTVA 5IK8A 1XNBA 4OI1A 3DUPA 3ZXEA 1HRV1 1REFA 5EXOA 5FFOC 5KHIA 3ZFGC 3LA7A 3BU7A 2PHUA 4ES9A 4PJYA 5CB7A 3OPZA 1PNFA 2GSYA 4AHYA 1YUDA 4RHV1 2P2KA 2YUEA 1DU3D 2TBVA 2XGXA 2ZAHA 4ONUA 3T2TA 4IEPA 1N1SA 3TN92 4BCUA 3ATGA 4LHLA 1PO22 4OUMA 1I9RA 4Q26A 4Y1ZA 2WS93 1J3PA 1VBB2 3IPVA 4XBQA 4WZFA 3HT1A 3O14A 3VHOA 2WIIB 1MZ5A 3O7OA 4H7MA 2WZPP 1EY2A 2XB6C 5HCAA 1GANA 1LEDA 4FPLA 2OUHA 1H1IA 5J36A 3SITA 3AP7A 1LU2A 3FC0A 1QGLA 2R061 5KHJA 4DY5A 4R9BA 3AKQA 1UIKA 1H8VA 2AREA 4E4ZA 4N53A 3ZYGA 1WCKA 4BOWA 3D5OA 3JU9A 3E5XA 4LE4A 1DQ5A 4OFGA 2XJTA 4HSJA 3DUIA 1V6IA 4HFSA 1TME3 2JEMA 4CRQA 1RIRA 4FPCA 1AF9A 2C0ZA 2DTWA 2WZR3 1Q8QA 3ZFEA 2Z5WA 5D8AA 3B02A 4GWNA 1CPMA 3R4DB 4GIQA 3TWIA 2RR11 4A3XA 2YYOA 3WINE 1CPNA 4AVCA 3SCHA 4HL0A 1POV3 1OQEA 2Y38A 2WS92 1ENSA 2GNTA 5A33A 4Q4X1 1LU1A 4XBLA 3BIWE 3OCPA 2JD4A 5GALA 2VUJA 1QNYA 1RUF2 1FT9A 3MFCA 4AVSA 3MIBA 1QJX1 1ND3C 2E53A 3WOGA 1CAWA 1ENRA 1EV11 1VBA3 2D6NA 4HZFA 4QPGA 2XKOA 1IQAA 2E9QA 2CAUA 5EZWA 3VZNA 3AXEA 1OLQA 3O0WA 5CADA 3GHFA 1W0PA 4YVWC 4TLFA 1RUI2 4CEWB 1W6NB 1AYN2 1OA4A 4A2UA 3GALA 1LOAA 4YGCA 3SH5A 3CJIB 1F9KA 3LOIA 1COV3 1DGLA 3B00A 4N43C 3N36A 4Z92B 1YI9A 2QJVA 4BHPA 2GH2A 1X8EA 1CR7A 4QGLA 2QKDA 3D03A 4Q0SA 1W0OA 1QXRA 4AI3A 1RB8G 1QNWA 1O4YA 1HW5A 4IEUA 2P3JA 3O5SA 4H3WA 1G9FA 2WQ4A 3LA2A 3FLPA 2V73A 3CJXA 3GMFA 2Q30A 1VBA2 4P9LA 1O91A 1CQ9A 3MEPA 1QQP1 1WBLA 1RMU3 5C4WC 2Q1MA 3B7MA 1OKQA 4DZGA 5LEJA 1NQJA 2NZ9A 5I8SA 3AZVA 4XEZA 4CTEA 2PAKA 1NOVA 2Y26A 3PMSA 4KWKA 1WLCA 2RM23 3NWKA 1COV2 2DURA 4JRAA 4Q1RA 2HEYF 4AE2A 1EAH1 3S0MA 3POSA 4KG8A 4MXWA 2HWE1 4RR3A 2CWSA 1AHSA 2AUYA 4QGNA 3VLBB 4FTEA 1B35C 2X29A 2ZX3A 4PIXA 4RGAA 4YSFA 2JG9B 1GQGA 1ND2C 3MOGA 1WBFA 4P9JA 1WW6A 4GB33 1WW4A 3UV9A 1UIJA 1RUJ3 2PLV2 1ZZBA 2Z69A 5CVRA 2GN7A 3ZMOA 1VAKA 3MW3A 3ZSEA 4BIOA 1LULA 3PJQA 4FAGA 3V0AB 1VB2A 1RMU2 1MVEA 1H0BA 1LOBA 4AFMA 2VMIA 5KXCA 4XJ8A 3VBHB 4GHNA 1PK6C 3B9CA 3NKGA 2HWC3 3SLIA 4X6RB 4EN6B 3KT1A 4EV0A 2HEVF 2R043 4XZPA 4WVZA 1V6LA 2NN8A 4YM1A 5CFDB 3VBRB 3JB8A 1O3RA 3AM2A 3AMMA 1SCRA 1FMD2 5GLUA 1FV2A 1DGRN 4CDQC 3ZPYA 1C1LA 4NO4A 4OHVA 2G9FA 4YFZA 4FSJA 3LSEA 3AYEA 3DF0A 4KGGA 4K9SA 4AI0A 3MPPG 3PVBB 2R0HA 4GB32 2WNVB 1CAVA 1MQTB 1RUJ2 1XXNA 3KS7A 4EWDA 2BWCA 2WFPA 4YZ3A 1NE6A 1Q3EA 4ZU5A 1ZX5A 2WINB 3M70A 1H8TB 1C3HA 1YXWA 2ATFA 2PHLA 4B3NA 2HWC2 1YWKA 1YCIA 3ACLA 1UW8A 4XDQA 2VVFA 2YMZA 2D6PA 2R042 3E5QA 4OI4A 1NA1B 4LO4B 3UKTA 3VBUA 3THPA 4F8AA 5C8CA 5I0UA 4LO5B 1W6PA 4Q0VA 4RGGA 4CDWA 1GSLA 1J59A 4JV4A 4L8QA 3I4IA 1HQLA 1ASJ1 2W08A 5F5QA 5D1IA 4ASMB 5I93A 5AVAA 2VNOA 1LOGA 1QJY3 2OW4A 4PBPA 3S7IA 2VW1A 1KFXL 3J8F3 2WNUC 1PZ8A 1L3JA 3WD5A 3HIFA 4D69A 4AFCA 2RS31 3M7AA 5BNPC 2H0BA 4S2FA 1J7XA 1KDMA 4MUVA 4FPEA 1XNDA 2ZGQA 4GMP3 1GQHA 3PHMA 1O4ZA 2P34A 3WG1A 5K8SA 5HCBA 1M4WA 1UZZA 1BEV3 3ZXGA 1AR93 2B7YA 2QZ2A 3LAGA 1C8M1 2XWBB 1AL0G 1S0JA 1AYM2 1VBC2 2R072 2RS53 4E2QA 4LULA 2ZHNA 3GHNA 1RUH2 1VIWB 2C9AA 2CWMA 2TEPA 4IEXA 2NLRA 5JMCA 1CAXB 4FP3A 3WW2A 1ZNPA 4ES8A 2DU0A 4HVQA 2BPA2 5K0UB 2DVFA 1ZYBA 4MH0E 4Q27A 1QJY2 2GNMA 3WHTA 3VUOA 1ZBA3 2YROA 3RYKA 1GR3A 2LALA 1PGL2 2NPIA 5DG2A 1LHNA 5T3NA 1NCQA 1H4GA