4AEJA

Crystal structure of human fibrillar procollagen type iii c- propeptide trimer
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
213
Chain Sequence
SPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQQITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLLAGEN ALPHA-1(III) CHAIN
publication title Structural Basis of Fibrillar Collagen Trimerization and Related Genetic Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 49
structure length 213
sequence length 217
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01410 COLFI Fibrillar collagen C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1000 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aejA02
3.30.750.130 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4aejA01
4AE2A 4AEJA 4AK3A
chains in the Genus database with same CATH superfamily
2WO7A 5FZ0A 3UJOA 2AR6A 2RR12 5J48A 5BYNA 3EBRA 1OOPB 3HD8B 4KWUA 1A34A 4FFGA 3N9PA 5EUZA 3RZMA 4X6RB 3VN4A 2J1VA 3WR0A 1OT5A 4CTEA 3BKZA 1MZ6A 4IEVA 5DAQA 1ULDA 3ZR6A 2B7YA 3ZYPA 4KU7A 4CPBD 1O3RA 1URXA 1O91A 3IPVA 4XTPA 3N9LA 1N6FA 3TEXA 1UPSA 1RUG2 3C3VA 1IS6A 1LEMA 4COUA 1DGRN 1OH3A 3GZEA 3JB8A 1YO8A 3PLQA 3POYA 4Q4W3 3WNPA 1WXXA 1UU6A 2WR9A 1H8VA 4HXCA 1V0AA 1HKDA 4OHVA 1VBB2 5FZ3A 1JHJA 1ZVFA 4XFHA 5C3RA 2BBVA 4XILA 3AJYA 4MG2A 2VZ3A 4QX2A 2C5DA 5LY2A 1K3IA 4GWJA 1RMU3 1UQXA 4HK9A 3IB3A 3ZXGA 3VLBB 2PHUA 2YBKA 4QPWA 5FQ0B 5CNAA 1ZZBA 4XUNA 4COYA 2ZMNA 3Q8BA 5A3MA 5DMYA 1W8FA 2WNEA 2XL9A 2Y0OA 3ZLIA 4NHLA 2MEV1 1XQNA 4CUAA 1EYBA 3RJRA 3TYJA 3GF6A 1FX5A 3RYKA 2DU1A 5DPNA 1COV2 1YFXA 3WG2A 1AR83 4M3CB 1O7FA 2RS51 2VTXA 1WZXA 2DUQA 2QBXA 2RV9A 2B46X 4IERA 3O0XA 4BHPA 1GSLA 5ERLA 3WF0A 4BQWA 2RM23 2ZHMA 3C7FA 4XBLA 3I4IA 1WLDA 2ZGUA 1AX1A 3VBOA 3AYEA 3DGTA 4XPVA 2W91A 5JXGA 3W20A 5LY1A 2YPDA 3BIEA 1CIYA 4XJWA 1Z7S3 4JHZA 1EP0A 4XF3A 3RNSA 5ABJC 4XFAA 2EIEA 4LKFA 3FUOA 1QJX3 2ZEZA 3NNLA 3PIGA 2WFF2 1VB4A 3VBUC 1TILB 1YNAA 4ZZ5A 1V6NA 2X5IB 3O0VA 5FZAA 4L11A 4LK7A 2J1SA 1NQDA 2AH2A 4ZKTB 3JD73 1LHVA 4QXBA 4XDPA 3PTRB 3CNAA 3K3OA 2RR13 3H3ZA 1MS5A 1OLRA 3O14A 3KHBA 5KHHA 2TBVA 4GMP3 4XZUG 1CGPA 1IKPA 1FT9A 2BVBA 3OPWA 2PTMA 3GMFA 3SNMA 2XB6C 3MF6A 1I9RA 1RUG3 1IS4A 2A3XA 2R32A 3HQXA 4IUGA 1I5ZA 2R1BA 4XIOA 2B39A 5FXVA 1R1A2 3ACIA 3GXUA 1LHOA 2HEWF 4H7LA 4N9HA 3WDWA 3ZYRA 1ZYBA 5DAPA 3ZN6B 4YFZA 1E5SA 2IFWA 2YGMA 3IDBB 3AKRA 3FBYA 2AENA 3IZOA 4N7IA 4ZXKA 3SITA 1TH8B 1IHMA 1YJLA 3V65A 2ZAHA 1DYPA 1SLIA 2QQOA 4PDWA 3UESA 4OMDA 2GC0A 3AK0A 5F6KA 4AYUA 3CHXA 2DFCA 5CKMA 2FD8A 3DORA 1DZTA 1FMD2 2WNUA 3LE0A 1F5FA 1PVXA 1O8PA 3CJIB 2ZPXA 3E97A 4B8EA 4E2GA 1LOCA 2OT7A 1W06A 4I30A 3K46A 2XH6A 1AXYA 1EV12 1D0HA 2DUPA 4Q4W1 4BQXA 1UOGA 5CADA 2EXJA 2X29A 1C5IA 1LNSA 1NXD1 2PHXA 2ZMLA 4Q0PA 4UBHA 1VMJA 3VV1A 1A3KA 1LOEA 3NV3A 3CKHA 5CVRA 5EIYB 2ZGTA 3AP7A 1NCQB 1ZZ6A 1RMU1 2XJUA 3PURA 1K32A 4HVOA 3NL1A 4KGQA 5F3EA 4D0QA 4DXZA 1OXCA 5JXIA 4TXWA 5JLVA 4LQRA 2JG8B 1OH4A 3BCWA 3I2GA 5D21A 3KGZA 2PAKA 4PI0A 1J1LA 5JZGB 3DUIA 2EALA 4UAPA 3T1MA 2WFF3 4CDQC 2WLQA 2JG9B 3FN9A 5KC6A 1AR81 1CAUB 2VY0A 2CWWA 3WDVA 1N1SA 2X09A 3HQUA 4OHWA 4WM7A 3AKTA 5K0UA 2GNTA 2RM21 2C0ZA 4UW5A 3HT2A 4N43B 1CWPA 2QZ3A 4MVTA 1HLCA 1KGYA 3NVCA 4UW4A 4W6XA 2XLAA 2MPFA 3RMXA 1SBOA 1Z7S1 1RTVA 4URAA 5JXJA 4Y5SA 3PL0A 1QJX1 5IYYA 1R1A3 2CAVA 5C8WA 3RDIA 3E5UA 2W68A 3A22A 3R4UA 2KA5A 3ZIWA 4K8FA 3JD71 2XJRA 3VHPA 1CAVB 4E4HA 5ISLA 3MIDA 1XB9A 2RR11 4XXAA 3ZFFA 3K51A 1Y43B 2K9ZA 5K0UC 2HYKA 5A3PA 2D97A 4GMP1 2FDGA 3ACLA 4UFHA 4YW7A 4E2SA 1FMD3 5BNOB 4BH9A 3N4MA 1LB2A 1UY3A 1RUG1 1OUXA 2JWPA 5EJ3A 3I2HA 5EUWA 2VY9A 4NAOA 5G05L 3WDXA 1EV13 5FYYA 2P37A 2IFRA 4Y4YA 4FTBA 1QQP3 3DPRB 2I07B 3HR9A 3OD0A 4OFGA 4XMIA 4H55A 3WZ1A 2AEZA 2WNVB 1KRIA 4YGEA 1YC61 3ITQA 4NPMA 5DG1A 5JAXA 1YFYA 2AZ5A 5HV4A 2GC1A 4XTMA 5DXDA 1GNHA 2UWCA 3WV6A 1ZREA 4HKWA 1NLSA 3M1HA 4P08A 2ZX1A 2RG4A 1MVEA 5L7OA 4DRVA 1DGWX 2WWJA 3M8LA 2EIBA 5FAXA 4YVWA 5DAVA 4ES9A 4MGTA 2J1AA 4XJUA 4KWLA 1ZBA2 2QQIA 4COZA 2R49A 4QKFA 4QGMA 1AF9A 2JD4A 4YGCA 4F7ZA 3OD4A 1LGNA 1COV1 2YPJA 4Q4V2 3G7DA 3E5XA 2XXZA 1J3RA 4FPLA 3KQRA 4L0PA 3SHRA 1RUF3 3RGBA 3WCRA 3AP5A 1H4ZA 3POBA 4PCRA 3K3NA 1R092 1PGW2 3GZTB 3CQOA 4FOYA 4YG3A 4AW7A 1GNYA 3GNEA 4RQPA 1NA1B 4EROA 2JDMA 5C70A 2BP6A 2YY1A 4K21A 1VR3A 1N1VA 2B45X 2NLRA 5L7OC 2WQ8A 1FPN2 1CX1A 4YVWC 3IH9A 4IV3C 2VOVA 1ZRRA 2VQAA 4TWTA 1WBFA 2VMHA 4IXLA 2ZOEB 5FY1A 2DXNA 4CP1A 2WFF1 1UMIA 5IK5A 4Q26A 2VH9A 2VZQA 5J36A 2Z4FA 1J1TA 1NY72 1RUD2 3WNKA 1PMHX 2P2KA 1WUVA 3KV5A 3D5OA 2BDRA 3CO2A 4XFIA 4GQ7A 5C8CA 5T3NA 2GP3A 2XJTA 2ATFA 1VBA2 1NUKA 4PIYA 3WHUA 5AC92 3WDYA 4R9AA 3I97A 1Q8SA 4I09A 4PI2A 4ZS2A 3ZXNA 1V6LA 1VIWB 2VQUA 2WKKA 4MHRA 2VULA 3WNXA 5CFDC 2ARAA 2PN5A 2KD7A 3WDUA 4CXWA 4XCBA 5J37A 5A7PA 2WWUA 3JUUA 3K75B 1OD3A 1G7YA 1R1A1 2IVIB 4IE6A 4JZRA 1A8MA 3VBRA 5A3LA 4CP0A 3T6OA 2VMCA 3UGGA 5I0DA 1K42A 2XLFA 1BKZA 5JOYA 1UX6A 1IQDC 2A70A 4JHTA 3LDKA 1HW5A 2CDOA 1QXRA 3OY8A 3PUHA 1ACCA 3E1F1 3VHOA 4N7UA 4CEWB 1T2XA 3EJKA 4YW6A 1N6EA 3PTYA 3ZMOA 5IVCA 5C8CC 5FWJA 1XU1A 1XPWA 1A6CA 3WNMA 1VALA 5FOJB 3M70A 1CPNA 2BNOA 1PM7A 1Z0HA 1FMD1 1ZBA3 3MZHA 4CUBA 1YWKA 2PAEA 4R9DA 3NJVA 4URTA 4CCCA 4ASKA 1EV11 3AM2A 4Q4V3 3VZMA 5A7OA 1DCSA 1PGSA 1QQP1 4QD2A 3KWVA 2J1UA 3VBRC 5A3NA 1W28A 5L19A 2OPKA 1FOD2 4JC0A 1R093 2VMDA 4P9GA 4AAPA 4L99A 3K4AA 3M3IA 2OXBA 1CJPA 1MQTA 1TNFA 1GV9A 5A3WA 4YZ2A 4GJYA 2WAOA 4LUMA 2WS92 4UFKA 3LEMA 1G6NA 4FP2A 2RRLA 3NV4A 3DKQA 4MHUA 2C9AA 4OVEA 3WQ0A 3ZFEA 4INDA 3LA3A 3OIZA 1W8NA 1AXZA 1ZZ8A 1KS4A 4B4RA 3C7OA 1WXWA 3N9NA 3AJZA 1UU5A 2VW0A 2VL4A 5F39A 2FCVA 5IFPA 1ODNA 2F4LA 1T6GC 3NAPA 5A6YA 2ARBA 1SLBA 5A3OA 2DBIA 1S0EA 4AFAA 1RUD3 1PK6B 1RUF1 4QPIB 3LSEA 5L36A 3KMHA 5LW9A 2R062 5C9AB 1LODA 2YV8A 2ZGSA 1D7PM 2E9QA 5FMDA 4UOJA 4EYUA 3BGAA 2JE7A 1JOPA 4QPGC 5FYHA 5L9RA 2VO5A 4XXPA 4KL1A 1FAYA 1YIFA 2BBAA 2X10A 4NRPA 2QQMA 4EZHA 2AYHA 3NKGA 5JMCA 1ALYA 2XQRA 1HRV2 3VDDB 2QQVA 4JVAA 5FYUA 3ZSEA 2OASA 2VCMA 2X8KA 2D6PA 3VKFC 5KXDA 3IIIA 1DYOA 3CMGA 1HF2A 4LITA 2P34A 5C4WA 2O8OA 1UYZA 4YZ3A 4M4RA 1IOAA 1S2KA 3B9IA 3ILNA 4J25A 5GLWA 2JEMA 1IG0A 1OPMA 2OQ6A 4K8RB 5F7UA 1SACA 2RDQA 2ZA9A 3HJRA 3POGA 4XJAA 2EXKA 1FYUA 3IWZA 1JOBA 1REDA 2RVAA 3WCSA 2BVVA 3OG2A 2BQPA 3R0RA 4OZOA 3LA7A 3UL2A 1FOD3 2UYBA 1G86A 4AEDA 4WM8B 2ZGNA 2VGDA 2W1WA 1OPOA 1H8TA 4JKKA 4Y20A 1S0FA 3VBSA 3KQ4B 3L2YA 5CIRA 2PYTA 5T52A 1JOJA 2CAUA 3NNMA 2WS93 4UFIA 5IAVA 2BTVC 1VE0A 3USUB 3SH4A 3TOJA 3NO8A 5C4WC 3OEAA 1ZBA1 2AACA 3GZAA 2BW8A 5E6HA 3I3MA 1UZ0A 4OLLA 4RSUA 3WG3A 4KG8A 2WINB 3BN6A 4BMEA 3RWNA 3QD6A 4Q4V1 1FC9A 3WT3A 1TVGA 2R16A 1W6PA 2RDRA 3DYMA 3S6PA 2DBNA 2G9FA 1OFNA 1UD1A 2QJVA 4WVMA 4NROA 1ST8A 1VAKA 3O1VA 3TB0A 4LUKA 2DCZA 5LB6A 5A6ZA 4FAHA 5IUQA 3T0AA 3WG4A 2ZBJA 1S4CA 3U11A 1R091 1PGW1 1LHWA 4MXWA 2WFPA 3FMGA 3WUDA 3Q8AA 2R063 5FREA 5FZGA 5FZOB 3VBSC 1H8TC 3ALQA 3J9SA 4QB6A 2OIIA 4GWMA 1WD4A 2JE8A 1AR92 4CUGA 3DCQA 1QJU2 3C7EA 5L9VA 1ZBE3 4MXVA 4IETA 4Y1YA 3OUIA 2D6NA 3MIFA 4GD4A 4LBQB 1UW8A 4R8HA 5FLIA 1F9KA 3THPA 4AVVA 1JYNA 4DXRA 3H1MA 5DN2A 1UU4A 2VZ1A 1HRV3 1VP6A 2W1SA 1NY71 1RUD1 2RJ2A 2L9LA 4DINB 4RL7A 4A4AA 4IE5A 1ZNPA 5IFTA 2WUHA 1C28A 2V5DA 2Y6HA 5BY5A 5FWEA 4N90A 3RZKA 2QKDA 1ASJ3 1OUSA 5FTTC 2OZ6A 1XE8A 4A42A 1V9U2 1S55A 2Q8OA 3POIA 3UKTA 4OQ9A 4YVSA 2O0OA 2D3SA 3ZXFA 3L9JT 2IZWA 1YRZA 4FPKA 1NAEA 2D3RA 3LPGA 1S0GA 4DUVA 4R52A 1X8EA 2UY9A 3FUQA 3E5QA 1TNRA 4CDXB 5ABJB 1MR5A 1JZ6A 3Q8FA 3OGJA 3VBUB 3LDRA 3KT7A 5LK5A 1J7XA 4MADA 4BWOA 3ZSLA 4AEKA 2NMOA 5FXWA 3UETA 1JYXA 2VVDA 4JDNA 4EN7B 2B78A 3N9QA 1OD5A 1JZ4A 4IE0A 3NRUA 3NQHA 3OUJA 4HKOA 3UKNA 3KT4A 1GQHA 3SEPA 4SBVA 5IW0A 4P5HA 4OHXA 3P3PA 3ZXJA 1RJ7A 1WMEA 3LFIA 1AX2A 3KVAA 3KCYA 3ORJA 4PF5A 2VXJA 1SLAA 2YGLA 2ZGPA 3B01A 1UY2A 5C7GA 2ZEYA 2P6CA 3H7YA 4RS5A 4XAEA 5GLVA 2CGNA 5F2SA 3T2QA 1FOD1 1WCSA 3C8XA 4G3YC 1C5HA 4LO7A 4ZY9A 2PHDA 5F9TA 2WT0A 5IK8A 4QKDA 2XDVA 5FP7A 4GWIA 3PMSA 5GLTA 3RZZA 1QNYA 2WS91 4L92A 4FOVA 3OBAA 1UO9A 4Q0QA 2AS0A 5FPUA 1K12A 1YXWA 5JSOA 4DMGA 1CAWA 2PAMA 1W2TA 1GYKA 4YM0A 1EPWA 2Q8DA 1NCRB 3AZZA 3WG1A 1W2NA 3MHZA 4OI4A 2DCKA 4GULA 1JYVA 2QQKA 3EO6A 4P9XA 1OLME 1GWLA 2ZTNA 3ES4A 2YC0A 3UK9A 3CDZB 1C8M2 1GFF2 5C3PA 4XC9A 1Y7BA 2Q1FA 4RS5C 4ZU7A 1X9PA 4HOOA 4Y1XA 1AUYA 2WABA 2ID4A 3HVDA 1SFPA 4YSFA 1UY4A 2R061 3I59B 3HNMA 5B2GB 4JTOA 2EXHA 2JD9A 2DCTA 3GHFA 4QB1A 4DGFA 3VD9A 2E33A 1V9U3 1GR3A 3S0MA 4L1CA 2XMLA 1F5JA 3KV6A 4TLFA 4XQ4A 1G9FA 3VBHC 5C3OA 3W5NA 3HN1A 4CCDA 2G9GA 4I3PA 4Y1VA 3H50A 4AGVA 4AI1A 1HRV1 3I7DA 5T5PA 5JUVA 5LEKA 3MV01 4GXLA 1DQ4A 2W47A 4CDQB 1SDDB 2WZR2 3I3DA 2FCUA 4BLJA 1MACA 1VB2A 1AXKA 2C1FA 3OGSA 4XDQA 1ZA7A 1VMFA 3AMPA 2FMDA 3RZLA 1ASJ1 4V1PA 3ABZA 4JKLA 1S0DA 4Z07A 1KQRA 4EWDA 4IGPA 1W6OB 4K20A 5FOBB 4CP9B 3EHKA 2DCYA 1TME2 2YG0A 4OHZA 1DZRA 4QT6A 3BTZA 5EPAA 4QGNA 5BUVA 4KI5M 4CXYA 1Q8QA 5A1LA 3JB4C 4CDUC 4AQSA 3IAQA 3FL7A 4ZZ8A 3GCWA 5IVBA 4CA9A 4P9LA 5F5CA 3H1WA 1J3QA 2XVKA 4AEMA 3ZXDA 2I74A 2IC1A 5F5IA 2ZKNA 1K5JA 3GYDA 1O4TA 1RMU2 4AHZA 3H42B 5JOXA 4BCUA 5LA0A 5GLUA 3RYRA 1HXS2 1E5RA 1WCDJ 4BPZA 3GBFA 2CY6A 2VZUA 5A7WB 1PX4A 5I0SA 4JGYA 2IUWA 4A7ZA 3V0BA 3AC0A 3WVJA 2Y60A 3IF5A 4K9SA 4EV0A 3RQ0A 1B35A 5D2AA 1H9PA 2R072 1C8M3 3VD7A 1QIQA 2WZ8A 4MZUA 3P6BA 4B29A 1XXNA 3ZN4A 4CEYC 3U07A 3RZJA 4E4ZA 5AFBA 2RM22 5BNPA 2XKPA 4KWJA 2G1MA 4W8JA 2ZGRA 1RITA 1WCKA 2Z69A 5D8AB 4HYLA 1QJU1 1W9WA 5GZDA 4RN5A 4AI3A 1ZX5A 4WV8A 4HLTA 4HVQA 4PBPA 4DB5A 4BIOA 1ULOA 1LJ7A 1ND2A 1NG0A 3AGEA 4RR3A 1ND3A 4N53C 1D0GA 2V09A 4NHMA 1SPPB 2MHFA 4XOGA 3LIHA 3WP6A 2ZHLA 1S0IA 2BNNA 3LDFA 2EAAA 2OX0A 5ANQA 4QQ2A 1MZEA 2YYOA 5A32B 3SCFA 3RYPA 2F4PA 3N7MA 5FZLA 2ZGOA 1V9U1 4ZS3A 5JI7A 4L8QA 4FOWA 2E7AA 4K3UA 4YM3A 1HQLA 5KXCA 1PZ9A 1TME3 5L7OB 4QM8A 2KR2A 4LXLA 3UT0A 1CIWA 4IV3B 4CU9A 5G04L 5I8TA 1ND2C 2VMIA 1VAMA 3ACHA 4M00A 1ND3C 2DVDA 3KV4A 4RR3C 1H2LA 3M3CA 4JAAA 3JQXA 1YQCA 2J1EA 4QKBA 3OEBA 5FLJA 3VL8A 2MNGA 1LAJA 1VAVA 3O1PA 2YFZA 5DAWA 1RGSA 1YUDA 2XL7A 3NMBA 4HETA 1XYPA 3CF6E 4A41A 2CWMA 3T0DA 5FP4A 2RHPA 3IT8A 1HXS3 3O7OA 3ZMNA 3WW1A 4XF9A 3M4FA 2JDZA 1V70A 4O61A 4AEJA 1H4GA 1S0BA 2JXAA 1RUH2 1ZZ7A 4AE2A 4B4QA 5HV0A 3MFCA 3OF1A 4EWAA 4E4SA 2Q8CA 2HEYF 3H9AA 3NSTA 3HNYM 2Q1MA 2WN2A 3OYWA 5CFDB 1NZCA 2JDYA 2R073 3NW4A 5LWBA 2RE9A 3Q8CA 2JB8A 3I49A 3KT1A 4YLZA 2GH2A 1JU3A 1LOAA 5IVFA 3FFZA 4EN0A 4CSWA 2WSVA 1HDKA 4LE4A 1UYYA 3UV9A 3VHNA 1DDLA 3D3UA 3NY7A 3B93A 4WVWA 3VBFB 1UN1A 2XGXA 2WLPA 4LKDA 4EJRA 4GH4B 4HN0A 3JU4A 2QDNA 2BPA2 3WEZA 1C1FA 3LF7A 4AOCA 1X33A 3VL9A 5FMBA 2PHWA 4FBFA 4RFT0 1GP4A 4F8AA 3LZZA 2WYSA 5GLZA 3UGHA 3OUHA 4YG0A 1F35A 1C8M1 1SDWA 1D4M2 2ARXA 2J22A 3U4SA 4PBOA 2B9VA 1RUJ2 4I0BA 5EV7A 1ENXA 2H6CA 1JHNA 3KV9A 4LULA 1OA2A 1OHFA 5J98B 4X6QB 2BWAA 2YMZA 1RUOA 3ILRA 1CZTA 1RXFA 3OIRA 2C24A 2GP5A 4AI9A 3MPPG 1G8WA 3UGFA 3VBOC 2HWD2 2D43A 2ZABA 5I91A 1CAXA 2FBEA 2FMYA 2VCBA 4AQ6A 3LCPA 1IZ3A 2DVAA 5T5LA 5K9YA 1NT0A 4LHSA 5ANNA 4HPKB 5FYCA 1VLNA 3ZSJA 4LK6A 5GJ6A 4JGZA 2WZR1 4GKXA 4GMP0 3S5QA 2W46A 1U5YA 2VW1A 5HI0A 4NMIA 1C1LA 4QXKA 1CESA 1X82A 4CDWB 3E6CC 2ETEA 1BCXA 1OVSA 2V4AA 1UPIA 5FMOL 4C91A 3ELNA 1GZTA 4LEJA 5FYVA 3UYJA 4Y4RA 3V0AA 2Y6KA 3TEWA 3GVKA 3LLOA 5DUWA 4A7YA 5BNNA 5JVVA 1CONA 3WP4A 4CP2A 2XVLA 1RUH3 3I3EA 4FP3A 1TME1 2J1TA 3OGVA 4MLOA 4MGKE 4LO6B 4XFFA 2JKXA 2ZHKA 1W6MA 1QQP2 4PJYA 3IIAA 4QPGB 5APAA 1W8ZA 3R4SA 4XUOA 3U75A 1GQGA 3ZYFA 2GMMA 3ILFA 4Q1PA 1BPLA 2BOIA 2FHRA 1PMJX 1TEIA 5F37A 3GVLA 2UWAA 2TEPA 1H9WA 2X53S 5FZ4A 5LK7B 2BYVE 2WO1A 1K5MB 4RHV3 5I0UA 2OUJA 2AC1A 1FC6A 1POV3 1BK1A 2D6KA 2YDEA 3S7IA 4M4PA 3VZNA 1RUNA 1HXS1 3CIHA 4PDWC 2P5BA 5GZEA 1X9TA 4CYDA 5EJ1B 4BK5A 2WNUC 4IGQA 1LULA 5DUXA 3T08A 5FO9B 4QX3A 2JIJA 5C3SA 5IVJA 2R071 1QXJA 3R6SA 5IK7A 1D4M3 1RIRA 1RUJ3 1V6JA 1U0AA 3ZVXA 1RUF2 1PO22 1W8TA 2W3JA 3AFGA 1QDCA 5DZFA 5JPMB 1WCQA 1P8JA 4S2GA 2D5FA 1JTZX 3BUCA 4IGOA 4YM1A 1AJKA 1F2NA 1YQ8A 1OVPA 1W6NA 2VQTA 1TIDB 2A6VA 5J1XA 2HWD3 3FLTA 4LLOA 2W5FA 4XHBA 3H8XA 1DGWA 4QB2A 3J7MA 1OSGA 2DFBA 4JDMA 1UIJA 1L7RA 1MZFA 4FFFA 4IEQA 3MI8A 1S2EA 4KU8A 4ZU5A 5JIAA 4C1XA 1SFYA 1XNCA 3U10A 3LDBA 1GWKA 2VOKA 4CCKA 4D7YA 2XVGA 3PVBB 3MOGA 4B7EA 3UJQA 4CUCA 4QDRA 2WT1A 2WIIB 3W59A 1UWWA 2VTFA 1D2SA 2ZZJA 1RHI2 3DF0A 1IPSA 3POSA 4WM7C 3PUAA 3PUIA 4DEVA 2WA3A 1PZ8A 1PMIA 2ORZA 2UYAA 3LOIA 5FUNA 3DYPA 4Z92B 4X8PA 1NYWA 3INAA 4LHNA 2LRPA 1VRBA 1O5LA 2FQPA 2W94A 3CBNA 3QOPA 1CZSA 1NLQA 3EYPA 4PIZA 4FTSA 2N7GA 1XYOA 3AFKA 4DY3A 1TQ5A 1GZCA 4J1XA 4U2AA 1SCSA 2EXIA 1VBE3 2Q0AA 5A1FA 2HH9A 3AMNA 2E31A 4BB3A 2BFUL 1XNBA 2ZS6B 4EN6B 3R05A 3IKWA 3ZFFC 4Q8KA 2JDNA 3T2OA 3AZYA 2EICA 1WLCA 3FLPA 3ZFGA 1KJRA 1OBNA 1QF3A 1RUH1 4JQRA 5CFCA 4HVRA 1GZWB 1C3HA 2VNVA 3AB0A 1AR62 4CCJA 4ZU4A 1BEV3 1OOPA 2Y6GA 1OKOA 2QFEA 2VD7A 1H1MA 3JZVA 5E89A 1RL3A 2AUYA 1PO23 1LHNA 5FV3A 1UKGA 5FJHA 1NE4A 4DZGA 4G4FA 2ZX0A 1O6UA 2DUOA 2A7AA 2CV6A 4V2VA 1HIXA 4IEYA 2G19A 4RHV1 3NKTA 5F2WA 5FZKA 4HSLA 3ZSKA 1UMZA 1EY2A 4W6YA 1POV1 2A3YA 1MPXA 5H9SA 3ZYIB 3W9AA 3WF3A 5CAZA 3C7GA 4M01A 1WW5A 2OUHA 5FPLA 2Q30A 2HWC2 5KHGA 3ZFGC 3V97A 2QE3A 2OW4A 5C71A 3N7JA 5FXZA 5CFCC 4DIQA 3MIEA 1CX4A 1HQWA 2DURA 4KBZA 4UBGA 1D4M1 1W2OA 1V00A 3H3UA 1RUJ1 3M7AA 1TMF2 1OOPC 4A3ZA 1DP0A 5FQ0A 1HB4A 1IKQA 5T50A 1XE0A 5J96B 5JOZA 5JSPA 1LCLA 5JWPA 2ZOAA 1RHI3 1T6BX 2D93A 3C2UA 3D0JA 4Y22B 5SV5A 3O12A 4QKNA 4RQPC 1SZBA 2E7QA 4C0HA 2HKXA 1QJFA 2HWD1 3VGIA 2SLIA 3OTFA 2PLV2 4BQ2A 5FDBA 2RDSA 2QQLA 3ATGA 3MPBA 4M3CA 4KMQA 4YZ1A 4AQTA 1Q3EA 2VOXA 3MW2A 4XFGA 4QMAA 3CU7A 4CVUA 5DABA 1EUTA 3A7QA 3THDA 3S30A 3O1MA 3CZJA 1D2QA 2CDPA 3ACGA 4IDZA 3ZN5A 3LOBA 5ACA2 4AWDA 4LJHA 2K2SA 2WQZC 4B1MA 2E51A 2P17A 2C9KA 3WD5A 2CGPA 1ENQA 1PNGA 4LKEA 2GN7A 4XURA 4DUWA 2YUEA 5EFUA 3T2PA 4FPCA 3ZXKA 3T3YA 1PM4A 3HN3A 2LUWA 1W6QB 3D4KA 1GMMA 3VD5A 1AX0A 1YI7A 1XJAA 2X5IA 2WWSA 4JV4A 4N8MA 4ONUA 2E26A 3AP4A 5F3CA 1AR63 1JZ5A 1FC7A 3DKWA 3MIGA 3VBHB 4IV1B 1JUIA 2HEVF 4F3JA 3USSA 3J26N 4OI2A 2R1DA 3JXSA 3EMRA 2PXJA 4A6OA 4BJ0A 2ZX3A 1JXNA 4NIHA 2G4IA 4FXKB 5E1RA 1UL9A 1RUE2 2WZPP 1UY1A 2VUCA 5C5UA 3CJXA 5A7SA 4GHNA 4CXXA 3WW3A 3MW3A 4XUTA 2DVBA 1ULCA 4XJZA 4YW2A 5JIUA 2HWC3 2ZXQA 1VC1A 1A78A 3ZN6A 1NE6A 1FI2A 3WHTA 1QOTA 4P5YA 1BEV1 2YB7A 3QACA 4E2QA 4OI1A 2O8QA 1IQAA 1TMF3 2VZOA 1PO21 1SFNA 2RS13 2W1QA 1DQ0A 4HMZA 4PLMA 4QU1A 3MLLA 3U78A 3K48A 4Z2AA 2WQ4A 4CDUB 3I2OA 3CJIA 5LBCA 4META 4UF0B 4U36A 1MQTC 1U12A 4WVVA 1ONAA 2PLV3 5FUIA 5BXXA 1S0CA 1ZBE2 2K0GA 2LS6A 5BPXA 4NIDA 2OZJA 2Q1ZB 1XNDA 4ZHNA 3GDBA 3ZFEC 3GJAA 1YFWA 2QUOA 1OC1A 4F83A 2HWE2 4OYUA 3AL5A 1LOFA 1NCQA 4IEUA 3NAPC 4D94A 5ACA3 2VCAA 5EXOA 5KBFA 2JDPA 1REFA 1SLLA 2JG8A 2JDHA 4WZFA 1QGLA 3OJBA 3WY6A 1RHI1 5EQUA 2D3PA 5JZGA 4OULA 2R0HA 3W21A 2P6HA 3CJIC 4CEYB 1A8DA 1Q8VA 1ASJ2 2JG9A 2DWRA 5I0RA 4OI0A 2QDRA 4Z8BA 5B4NA 1CAUA 5A3TA 2A75A 2DU0A 4OUEA 3QDQA 1JU4A 2GDFA 5FZ6A 3VZJA 4TZDA 1BLZA 4CE8A 3MGUA 2RMU2 1KJLA 4Y33A 3OB8A 5A33B 1DHKB 3AXDA 3PJYA 3WDTA 3H8UA 4LO8A 2V4VA 4M0NA 3PVEA 1BHGA 2OA2A 4N43A 1W9SA 4QX1A 5FZFA 3WP5A 4IL7A 1W9TA 1H2NA 3LFMA 4AVBA 4ARYA 3N9OA 5FMOS 4N53B 2C4XA 3ZXAC 2CWSA 2ZZQA 4LOTA 3OGRA 2Y0IA 1JZ3A 1W2UA 3IBMA 5HPOA 2JENA 1MS9A 2JG8C 4HZFA 3BPZA 3RG0A 1RUE3 4JQTA 5JZGC 2Z42A 1L7QA 3ZXEA 1E5IA 2A1XA 2XWBB 5T55A 1GUIA 4B1LA 3WLUA 1AR61 3E6BA 1I3HA 1MS4A 2OPWA 1CAVA 1AVBA 3K2OA 4XJ8A 1PX3A 4YGDA 3AZVA 3D6EA 3ZKUA 5LBBA 3HMYA 2HBTA 5EYYA 5J3UA 3R4DB 4AI2A 3AYCA 4NPLA 1W90A 4FOQA 1QOOA 2TUNA 2DYCA 4AEDC 4I3GA 4ATEA 5BNOA 5J09A 3AP6A 2WSUA 5JSRA 1F4AA 4MGSA 3ZDSA 1T6RA 4FPHA 5HXMA 1Q5OA 1BK0A 1VMHA 4GWNA 4NR1A 2LTNA 1H4YA 3DPRA 4UFMA 5F6LB 4R4XA 4CU8A 4NHXA 2WNVA 1DGRA 2IXIA 2BGCA 5DUVA 1CZVA 2HWC1 3OOXA 4Q0VA 2J7MA 4EN9B 5IATA 1L7LA 3TEZA 2HWE3 3BB6A 1VRH2 1IG3A 4FXGB 1SHWB 3IPVB 1W03A 4HONA 1BVP1 1TMF1 1O3QA 2GU9A 3FBMA 5EZWA 3I8TA 2O1QA 2XG3A 3HWJA 4NO4A 2XWJB 1QH7A 1XBFA 3LA2A 5FPZA 1MVQA 1W0PA 1DU3D 1PNFA 2JDKA 4A7KA 2PFWA 4RA0A 5BNOC 1JYWA 4AXOA 3THCA 2YFUA 3TEYA 2VZPA 2YROA 3JCIA 4E4DX 2W39A 5A7QA 2PLV1 4AHWA 2RJKA 1AR72 2NN8A 4AFCA 5IT6A 2ZGMA 4XE9A 3ZYJB 3DPRC 4QQLA 4AVTA 4D6QA 3KS7A 3T4HB 4W50A 4AI0A 2RMU3 1THNB 2JDUA 1R64A 4CCNA 1OQ1A 1OI6A 1NA1A 5FUPA 2IXKA 5ACA1 1LGCA 5LA1A 1E5HA 2ZAAA 3LKJA 3PU8A 1PO13 4P00B 2JDAA 1SLCA 2ZCWA 5KHIA 3DN7A 4Q4X2 1GU3A 1XOYA 1UYXA 2ORXA 3H1YA 3HOBA 4QXCA 4Y26A 3KVBA 4A2UA 5A70A 3N36A 4XBNA 3ZO0B 1YYNA 1C4RA 2WN3A 4NWVA 4FVVA 5CEHA 3LIGA 2PA7A 5F8PA 1UOBA 1QY4A 2B4KA 3VBOB 3KCCA 4TN7A 4YVSC 2QQPA 2GNDA 5HCFA 5JR2A 3ROUA 2ARCA 2W52A 3H8OA 3O5SA 2EVXA 4YZ5A 1LESA 2BFUS 3BTAA 3A4UA 1FNYA 4NWWA 4XQWA 3SKJE 5EJZB 3DV8A 3IMNA 3SH3A 3MICA 3NJZA 3OBZA 4Q29A 1RUE1 1VBD2 1QU0A 5FY7A 3IDAA 4ISQA 4WVZA 4CRQA 4MGYE 2HJIA 3I2JA 2NZ9A 2DCJA 4COWA 3BI3A 1N6DA 3WOGA 1APNA 1SBFA 2IXHA 4Q4Y2 2V73A 4Z2WA 2CSGA 3IAPA 4W4ZA 1VRH3 3ASIA 4H14A 2I2SA 3F2ZA 3J4UH 2ZMKA 4MH0E 1S1AA 4DFSA 4DY5A 4HFSA 3LSDA 5F5AA 5CA6A 2PHRA 3GHNA 1ENSA 3QBQA 4K40A 3UNPA 4E8CA 2H0VA 4YWAA 3JBG2 3AKQA 3ETQA 3OPTA 4IEZA 4K6BA 1YQ6A 2Z79A 4MGIE 2VBDA 4XFCA 1AR73 4AR2A 3BODA 4FCAA 3OCPA 3SXWA 1ZBE1 4P9JA 3IN9A 1WW6A 4PF1A 5FY4A 1KFUL 4ARXA 2XKOA 4MSVA 4BQ3A 4YM2A 4PDWB 2HWE1 3DEMA 4OCTA 3IM0A 3ZTBA 5DZGA 2WNUB 2E7TA 2ZJCA 5AVAA 3W58A 2ES3A 1PHMA 1UMHA 3HBKA 3AKSA 2VCCA 3LEIA 4TTGA 4O7XA 1GOGA 3D3AA 4JRLA 5FP8A 4Q4X3 4BXSV 5FO7B 5FZBA 1RUI2 3RSJA 2W08A 1AYN2 2WT2A 4LORA 4B3NA 1M4WA 3C7HA 5HCBA 2VQ0A 1IPKA 5FFOC 3WXPA 4NVPA 5CISA 2GNBA 3RZGA 2CYFA 4AQ2A 4LOSA 4YW3A 3V56A 1PK6A 2VE1A 4XHXA 3GK7A 1H2MA 1KXGA 2RMU1 4OUSA 3DXUA 1NOVA 3CL1A 3FC0A 4MUVA 4ORFA 4QPIA 5IWFA 1LU1A 1VPHA 3AGDA 1IS5A 2BERA 1YIPA 2BNMA 2EAKA 4HG6B 3N3HA 5C9AA 1JYTA 2O14A 3HQRA 1PO11 3AYAA 1DF0A 1VBC2 4XYXA 4KWKA 4QPYA 5GZCA 5I93A 3BTYA 5E88A 1I6XA 1VBD3 3SLIA 2C26A 1KS5A 1RC6A 4Q0SA 5L9BA 3ZPOA 4QAWA 2BOJA 3KB5A 4KNCA 5CKNA 4E27A 3NJXA 1BVVA 4GA9A 3NWKA 4XQDA 1OF4A 1H1IA 2VECA 3RMYA 1BXHA 1UAIA 1W8HA 3LEKA 4WM7B 1HV1A 3I3QA 3VDDA 3VKMA 5F1RA 5K0UB 1O8SA 1OMIA 4LA3A 4Q4Y3 3RJ2X 4EE2A 2VBPA 4RGGA 1PK6C 3TRSB 4HT1T 4XACA 4V2WA 1FV3A 3TWIA 4ASLA 4FAGA 2PQSA 2PMWB 1Q56A 4P02B 4Y1ZA 1AYM2 3B3QE 5I0TA 5C9AC 5JXHA 1W8WA 4UT5A 3VD4A 1EAH2 1H30A 1H0BA 4P9WA 1AHSA 5FY9A 3JBG3 5FZEA 3F95A 4LBLA 3ZIXA 5IVEA 2E53A 1O59A 2UY8A 2W1UA 5LRSA 3LAGA 1V6MA 3MGLA 2XHNA 2OKXA 1ZRFA 3ZFFB 3OSDA 3VD3A 4AL9A 2VOTA 1MZ5A 3VDDC 4UFJA 1TG7A 2YC4A 1VRH1 4WM8A 4Q1RA 1BYHA 1CJDA 2BGOA 4JGYC 4QWNA 4XAAA 5EYXA 1WMXA 3POJA 3VKLA 5FPXA 1B35C 1MS0A 2R30A 3HBZA 3USUA 3P5BA 1RYYA 3J7HA 1XSRA 4XF0A 1RUI3 1J83A 1PVC2 1AYN3 1WGPA 1AZDA 2YBPA 4FPGA 3ZYBA 3U4XA 3U0ZA 4GB32 4TYSA 3I2KA 3WF2A 4CCOA 5GKAC 4Y24A 5BNPC 4ES8A 1AR71 3DXTA 3OBTA 3B69A 4G9SB 1N3PA 2B5HA 4AFDA 2ET1A 2GMPA 3O1SA 1GP5A 3I54A 2FDJA 4YVWB 5HCAA 2CNAA 1YEWA 2SBAA 1WD3A 5EHDA 1WBLA 4S2DA 5FZOA 1F8VA 5FYBA 4QX0A 4XMAA 3ZDVA 3ZX7A 1VBC3 1HX6A 4Q4X1 3TN93 4ITCA 1WLTA 3ZR5A 4BISA 4BQ1A 2VTXJ 4LBQA 1DIWA 4BQYA 4CU6A 2VZVA 3TBDA 2BJSA 3ACFA 4JDOA 4XF1A 4DRRA 2A6ZA 1OLQA 4R4ZA 5TSWA 1DQ2A 2F6BA 3DJAA 2EF6A 4RQPB 3MW4A 5LA2A 4Q2FA 3RRDA 4DOUA 3MFAA 4ATFA 3KLSA 2NP0A 3GJBA 1REEA 1BJQA 4FQ4A 1UZWA 1Y9QA 5A80A 3U37A 4LE3A 5GZGA 4ASMB 1AYM3 5FO8B 5DQ0A 1NZIA 1TZOA 2K46A 3WNOA 4L8KA 1GANA 2WL1A 1PGL1 1BMV2 1EAH3 1LOBA 1VBD1 2NMNA 2FZ2A 4COVA 2DVFA 4RHV2 2B42B 3BOWA 1JI6A 4JRAA 5FPVA 4C1WA 4BQ5A 3MIBA 2UU8A 3VKNA 3VUOA 5FP9A 5HBAA 2EA7A 1CPMA 4O9GA 2LALA 4UWDA 5CYYA 5D1IA 4CDXA 5ABJA 5C8CB 1ENRA 3K4DA 2KXLA 4Q4Y1 5A1AA 4FT8A 3HIFA 3VBUA 3VZKA 4AVSA 1GQPA 4FPOB 4Z1VA 2QTWB 5FZCA 4DMIA 2Y6FA 3WF1A 3OGGA 2VMFA 2X05A 1HN1A 3A0NA 2JIGA 3DYOA 3K4ZA 4XETA 1KEXA 5F5QA 1W05A 1PVC3 2DF7A 2QZ2A 3ETPA 4R9CA 5FPAA 3VBRB 2P3YA 1W9FA 4GB33 5LRRA 1QDOA 1ULEA 3JBG1 1PZ7A 2PELA 5BV6A 2W87A 5DAXA 3BYWA 3J8F2 5FZ8A 2KA3A 3LQCA 3OY8B 4A3XA 2A3WA 5JOWA 4HK8A 4UFLA 4EQVA 4FQZA 5FZ1A 1FCFA 4CDXC 1QKQA 1YFUA 4ZONA 1UZYA 1U5ZA 5IHRA 4P9IA 1HB2A 2QQNA 3FHIB 4I0WB 1LRHA 5FYSA 3LPFA 1U5IA 2IXLA 4EWEA 3B5LB 4BIFA 1Y9GA 2D98A 4FPEA 2UURA 4AF9A 4NAMA 4BE3A 4M0HA 4CCLA 2JE9A 3PUSA 1RUI1 4I0AA 1F4HA 1AYN1 2ZKLA 3IMMA 3PMEA 1H4XA 2XOMA 5FZIA 5CG8A 3PJQA 5H9QA 4WZCA 1NCRA 2JJ6A 3CLPA 2Y26A 5JDBA 1L3JA 3SEEA 1BQPA 1SQ4A 1KITA 1WA4A 3K77A 4IQPA 4YRDA 1GOHA 1MQTB 2LROA 2WO2A 4O9EA 3EQEA 3LB9A 3E6DA 4BQ4A 2E63A 1KFXL 2P3JA 3VDAA 5H9PA 5SV8A 2Q4SA 2ENRA 5FXXA 3I59A 5FZ9A 3ZFEB 1K45A 3APBA 4XUPA 1VBB3 4XBQA 3ZKYA 1G9CA 3ES1A 2R6QA 3MUY1 4LTAA 1GZ9A 1G9DA 2DXLA 1VBC1 3MV11 1ULFA 4DGHA 4JGZC 3TN91 3N7LA 3SISA 2VM9A 3M2MA 3D82A 3NAPB 2VZSA 5GZFA 1VBE2 5CB7A 2CU5A 2Q8EA 4QDSA 3QLQA 2Y34A 3M3EA 3FZ3A 3QH6A 3I2IA 4XABA 5EUUA 1X8MA 2ZX2A 2DTWA 4GAZA 1NCRC 5IAXA 2ZO9B 3C0KA 4D8MA 1US2A 4CPBA 3UKVA 4D7TA 3NV1A 4CDQA 2G9ZA 5BNNC 4XUQA 1COV3 4LBOA 1SBEA 3I3BA 2XBO2 5FY0A 5FZMA 3T4VA 4YARA 3T09A 5KR7A 3T30A 2XPJA 1QOSA 5FIXA 1SG3A 3POWA 1BEV2 1JS9A 2Q5TA 4LIVA 5IVVA 1AYM1 1POV0 1YLLA 2RDNA 5E16A 1JYCA 3X29B 1MS3A 5FJKA 2W2IA 4QX5A 2EIDA 5C5TA 1EAH1 3I2DA 1O4YA 3GGLA 4IESA 1W6OA 4LR4A 4CP9A 1STMA 4K7JA 4LBJA 5KHJA 3J8F3 2XJQA 4LO5B 5FYTA 2NM1A 3T2TA 4AGGA 1ODMA 1WW7A 3BU0A 3K50A 2VNGA 2IWGB 5EUSA 5C33A 4IEWA 3W5MA 1OA4A 1UCXA 2JECA 4OZXA 5C4WB 4FO9A 3MLKA 1Q8PA 1X7NA 2VVEA 3SH5A 5M0TA 1YCIA 1D4VB 4BZ4A 3WINE 4XVHA 4I01A 4MGQA 1WWYA 1GNZA 3VSEA 3GHMA 4LPLA 4MYEA 4YW4A 3WQBA 2VNRA 1FV2A 2R7EB 5DZEA 1PVC1 3BU7A 3WP3A 5KWRA 1Y9MA 5FZ7A 4GB31 3AZXA 5A7WA 1WMDA 4S2FA 4AEDB 2UWBA 3A21A 4KH9A 2XJPA 3V8VA 3ZSMA 4TSVA 2BRTA 3VBSB 1H8TB 4NHYA 4Y20B 5I8YA 2ET7A 4J6GA 3FWEA 2ZEWA 1NKGA 1OQEA 4FTEA 1QEXA 2GAUA 1C8NA 2GC3A 5FMCA 3AMMA 1W8UA 1RB8G 4LHKA 1YQ5A 3AP9A 4PLOA 5D8AA 2D5HA 5F32A 4RFRB 3HEIA 4S2HA 4RYDA 4QTPA 1UOFA 1W6PB 3AL6A 1V6OA 4WVMB 4CZSA 1DLLA 1OURA 1OFSA 3ZXLA 1XNKA 3FHAA 4EN8B 1DZQA 3PVNA 1X50A 2GC2A 3F43A 1QWRA 1UYPA 2VOWA 2Y6LA 1QXPA 1SPPA 4MXWB 1V6KA 1ZRIA 4LHLA 3VB9A 1UZVA 4MV2A 2JKBA 3O1RA 2XBO3 4R9BA 1O5UA 2VVFA 4K1ZA 1SCRA 5A32A 4NRQA 4LBMA 1EUUA 1VBB1 3TNPB 1NLRA 5LBFA 5A3UA 3KM5A 1XSQA 5D8AC 2BU9A 1BMV1 2VPVA 2WC2A 1UXZA 4N9IA 1WLWA 4NN0A 1CVNA 4D6SA 1PIV2 3N35A 2WZEA 2VNOA 4PT6A 4RGAA 1IGOA 2GZWA 3O1OA 4BOWA 3WF4A 4IV3A 4QGLA 2ADDA 1RVF2 3ZM8A 2B9UA 4UW3A 4Z82A 2HWF2 5EWSA 1GWMA 4W65A 3P1IA 2J1RA 2YZ4A 2CTVA 1JODA 4GJZA 5FY8A 4Q0UA 4PQ9A 1H6XA 1WMFA 4AHXA 4CCEA 4DO0A 5T5OA 3S57A 5H9RA 4YYOA 3D0SA 4YVSB 3DECA 1G9AA 4MX3A 3H7JA 4HN1A 4UXAA 2RS12 5JMOA 4KQ7A 2D6MA 5FZDA 3S7EA 2QQJA 1MEC2 2WAAA 4X8NA 3O1UA 5LA9A 2DTYA 3PUQA 1SMVA 4YW5A 1LECA 3DL3A 1ZM1A 1O4ZA 1X36A 3J8F1 4KG0A 1N3QA 4YG6A 3WNNA 1DFQA 4IEOA 1N3OA 5A7NA 5CFDA 1JUHA 3BIWE 5KC5A 3CZUA 3FE5A 3KD4A 3WUCA 1CQ9A 3N7KA 3POEA 3B7MA 3KZ4C 5DUUA 1HJFA 5FYZA 4NUBA 2GN3A 3VBFA 1DQ5A 4DQAA 4OHYA 3O1TA 5FCCA 4GH4A 1JH5A 5B4XA 3RI9A 3HPNA 2QCSB 1LOGA 3IDEA 1ZZ9A 5FP3A 5CU1A 2VW2A 2DDUA 1CD3G 4IEXA 1JZ7A 3OPZA 4RS5B 2BZDA 2WDBA 3J7LA 4NIGA 5K8SA 2W95A 1N1YA 1LHUA 3BPSA 4HBNA 4QQOA 3VHRA 1W3XA 1RJ8A 3T0BA 3MEPA 3RWKX 4E8DA 4NJ4A 2PHFA 2B8MA 1WA6X 4B7KA 2JICA 3LWCA 4NRMA 4D69A 3MLJA 5IVYA 1CAWB 3B94A 3H8RA 4L2NA 4OUMA 3VBFC 4ZXEA 3ZYGA 1BBT2 4DNYA 1VBE1 4GH4C 5JR7B 5FKCA 1UZZA 1PIV3 1OLMA 3QCWA 2JB4A 3ENRA 4NOTA 3VDBA 5LEJA 4AZZA 1J59A 4XW3A 4HPKA 1RVF3 2XLGA 4QQPA 4GALA 1OA3A 2HWF3 2WNOA 1GOFA 1OQDA 1RXGA 1WKYA 2VBBA 3H0OA 4GIQA 3SCGA 4AG4A 5F3GA 1I1EA 2X5IC 2XBO1 3AVRA 2Z2SB 2R0FA 4FFIA 4CDWA 4SLIA 5CBLA 4AHYA 3MUZ1 5LCWL 3WW2A 2ZHNA 1AL0G 3A23A 3VZLA 5F3IA 3PIJA 3KF3A 1H2KA 1ULGA 2D6OX 1MEC3 2BGPA 2FZ1A 1JN2P 4HIZA 1LGBA 1IPJA 1YQ2A 4FPJA 4XFBA 4QQHA 2XUEA 1TE1B 2P3IA 5LATA 2Y64A 1FPN3 3ZYHA 5JPNB 2FCTA 2Y6JA 2A6XA 3GBWA 3D8CA 3LD8A 4QPGA 3RPQA 1G9BA 1IS3A 4BA6A 2GH8A 1F31A 4FSJA 3SQOA 3U14A 1MS8A 2W9XA 1K5MA 1ZA4A 4P14A 3G6JB 4CDWC 4FPFA 1JZ2A 5J7MA 4B4PA 1GKBA 2NPIA 1GICA 4LMFA 2ZX4A 4AFBA 2HYXA 2W0XA 4OQ8A 1QNWA 4FI9A 4ET7A 1VBA3 1V6IA 3SCHA 4IE7A 5AC93 2Y8KA 4NE9A 3S5AA 2C6SA 2F17A 1AUZA 4RGKA 1SEFA 4BYYA 4NHKA 1S0JA 1AL22 1W3VA 5FYIA 1XU2A 2I45A 3BOPA 2GALA 3EB7A 5FRAA 4AK3A 3EH7A 1K5MC 1LOFC 1NCQC 5GALA 5GM0A 5IJRA 4C0BA 4JGYB 3V0BB 3BTXA 1BBT3 1PO12 5FK7A 5KXBA 1O3SA 1XE7A 1CN1A 2WJSA 4NIAA 1LEDA 1RUC2 1B35B 4E9KA 1Q8OA 2D40A 3Q8EA 2YU2A 4EZ4A 1W04A 4DEQA 3M3QA 1QJY2 2YXSA 4DS0A 2QQUA 2JG9C 3KF5A 3MBWA 1KD7A 2H0BA 2KM2A 2E32A 4A44A 5BNPB 4D3WA 4LO4B 2A6WA 2R042 3KSCA 3MO4A 4GKYA 1V0FA 1E57A 4DXTA 3I2FA 1ZRDA 1HRI2 2VUDA 4MOAA 4Y5Z0 2A73B 2XR4A 2YHJA 1EPZA 3WX5A 4DUXA 3B9CA 3POFA 4N43C 1ZRCA 3HNBM 4QX8A 1ND2B 5LASA 1Y3TA 4RR3B 1ND3B 5C6CA 1PIV1 3EXUA 2XHKA 3NV2A 1XRUA 4C90A 5FBJA 4QHZA 4QHOA 4XF4A 1UF2C 1RVF1 1QJEA 4Y1UA 1JW6A 1R082 2BEOA 2HWF1 3J7NA 3WNLA 1MS1A 3PHMA 1I5PA 2ZGQA 3RI8A 4JTNA 3ECQA 4MO3M 5BNQA 2PHTA 1POQA 3DUPA 4BLIA 2H6BA 5CKQA 3PVOA 4GZ9A 2HWB2 5FBZA 2RS32 2XQXA 2RS11 4QHBA 2JX9A 1LENA 4JCKA 1MEC1 4QU2A 4AI8A 1W2AX 4P9YA 4FFHA 3M3OA 2V72A 1JMUB 3BALA 2LW8A 1F15A 4LKSA 2AGSA 1GZWA 4AAXA 4AVAA 3AZWA 1FPN1 2GMEA 3VKOA 1UNBA 2BWCA 3JQWA 4D6RA 2XONA 1DQ1A 1XC6A 4Y3OA 5DDJ2 2WNVC 2OYZA 1NX9A 1AL23 1JBCA 1SBDA 2Y38A 5FYMA 4LIUA 3SC7X 3SMHA 1QJZA 1UXXX 4H2AA 4JX0A 4PHZA 5HCHA 5CG9A 2ERFA 3FLRA 1UY0A 4JC1A 2IVJA 2VUJA 3GALA 1SLTA 1R1ZA 5DG2A 4JKMA 3JU9A 1OF3A 3OYWB 2AEYA 1RUC3 1VBA1 5FR3A 4D7SA 2EIGA 5C3QA 1AJOA 1XNAA 5AC91 4AFMA 1HN0A 4YW1A 2W92A 5FK8A 1BZWA 2YBSA 4XS5A 5LZ6A 2BUKA 1QJY3 4YGBA 5EUXA 3IDCB 3NNFA 4NPRA 3NNGA 5AVPA 5FPBA 5E8AA 1ZZCA 5HXVA 3TAYA 2R043 3OBRA 4C8DA 1HV0A 1KDMA 3LGRA 4XIKA 3PU3A 1WW4A 4Q27A 1HRI3 2D6LX 4Y22A 1QHDA 1H4HA 2DV9A 1YI9A 5FZHA 3D03A 1NA1C 4PIXA 1BBT1 2PQQA 4XZPA 4M3CE 4UW6A 2IXJA 1DYKA 3NNJA 1PGL2 3RFRA 1UKRA 2A71A 1HJGA 3P3NA 4BK4A 1UIKA 2ZEXA 1LU2A 2TNFA 2VXRA 1C57A 3Q9OA 3GVJA 3AX4A 2VMEA 3O0WA 1R083 2V5YA 4ZPIA 4QXHA 5EP9A 3WSOA 4K1YA 4L97A 3FHQA 3GCXA 4HSJA 3AKPA 4XEZA 2FDKA 1US3A 2ADEA 3VZOA 1Q43A 2MEV2 5T54A 4XDOA 3AXEA 4BMBA 4W6WA 4CEWA 1W0NA 3B02A 3ON7A 2HWB3 1CAXB 4XCAA 2RS52 2CHHA 2RS33 3ME2A 4BU2A 5T5JA 1W8OA 4UI9L 3V64A 1H6YA 1W6QA 3QH7A 1NXMA 1N47A 2DVGA 3LEGA 4O65A 2QQWA 4ISRA 5A6QA 1M06G 2D44A 4Y5TA 3IHBA 4LBNA 3CEWA 4JGZB 5JI9A 1AR93 3LKLA 1QH6A 1QJU3 3VBHA 4IV1A 4Q5OA 5FLHA 1LKNA 2ZGKA 1RINA 1UX7A 1ULPA 5DDJ3 2WRAA 1QMJA 2P4EA 2HBUA 4LLFA 3GZUC 2NYYA 3V0AB 2LM3A 5K4LA 2P1BA 5BNNB 2ILMA 4KGGA 4OMCA 2RJLA 5CZKA 3VDCA 4A6SA 4CEWC 2FDIA 2WO3A 2QNKA 4HKLA 3WQ1A 1YJKA 1JZ8A 3KHCA 2CL2A 4LBQD 1W6MB 2WYFA 4IE4A 4M3CF 3RZHA 2XJVA 1N1TA 4BM8A 4BXFA 1LTEA 2OVUA 2Y33A 1DGLA 4PLNA 4LT5A 2WBKA 3GM8A 4UYBA 3URFA 2Z5WA 4XJ9A 3MIHA 4IV1C 3GBGA 4H3WA 3ZOIA 1FATA 4IEPA 4DPNA 1AL21 2YU1A 4HL0A 1HB3A 1HQNA 2VR4A 4QM9A 2KLNA 2J42A 4CDUA 2OS2A 3HAGA 1J3PA 2VZTA 4LA2A 5IK4A 3TNQA 2E6VA 4UF0A 4AGRA 1S2BA 1O3TA 2GSYA 1JYIA 3MYXA 4YPJA 1RUC1 4NIIA 3RS6A 3TN92 1FNZA 3ZPYA 2NQYA 2PHLA 3U1XA 1OKQA 3ST7A 1VJ2A 4MGZE 4FPYA 1LR5A 2BV4A 3FFQA 1QJY1 2A5ZA 4DXSA 4AVCA 1H1AA 3KGLA 4LBKA 1DBNA 1HB1A 3AMQA 4QX7A 2OQ7A 3WQ7A 2MEV3 3L2HA 2R041 1W6NB 1W9YA 2ZGLA 2FDFA 4LNVA 3MF9A 1WCUA 5JCTA 3H3LA 2D7FA 2VG9A 4Q4W2 1HRI1 3THTA 4QPIC 2RS53 5AFEA 3FJSA 5FY5A 5L73A 4CEYA 5EZBA 1KDKA 1UOJA 1Z78A 2VUAA 4IW3A 2VZRA 1U5XA 2CGOA 2IXCA 3AMHA 4YNIA 3N9MA 3AYDA 1YHFA 2ZACA 5KXEA 5A33A 1R081 1W39A 2HLEA 3AVSA 4QDQA 2VJXA 1XYNA 3PDQA 3MDPA 2XJSA 4N53A 4WBBA 4YFWA 2VU9A 3WW4A 1GLHA 4CU7A 1GBGA 1GP6A 5FKBA 1AR82 2HWB1 1XNTA 2GNMA 1W0OA 2RS31 1NQJA 2VC9A 3FX3A 1J58A 5I8SA 5A6XA 1BUZA 4Q8LA 3PNAA 3NJYA 3SKVA 2A6YA 3IHAA 1B09A 4J1WA 1CR7A 4CCMA 1AR91 2WA4A 3RVHA 2P3KA 4I2OA 5K7PA 4TLGA 4A45A 1FXZA 3BVCA 3KCXA 1DG6A 1W99A 4PQQA 4L9BA 3HT1A 1Z7S2 2VAUA 2YC2A 5DDJ1 3IH8A 3A0KA 1DQ6A 1QJX2 2QVSB 4I02A 3T1LA 1DLCA 4HANA 2VMGA 4BDVB 4WM8C 2XUMA 2FDHA 3ZFGB 5LBEA 1J84A 2AREA 2WZR3 5CFCB 5KHKA 1V0EA 4H7MA 4RD7A 3JD72 4KBBA 1Y4WA 4YZ4A 3B00A
chains in the Genus database with same CATH topology
3UJOA 2AR6A 2RR12 5J48A 5BYNA 3EBRA 1OOPB 3HD8B 4X6RB 3VN4A 3WR0A 4CTEA 1MZ6A 4IEVA 1ULDA 2B7YA 3ZYPA 4KU7A 1O3RA 1URXA 1O91A 3IPVA 4XTPA 1UPSA 1RUG2 3C3VA 1IS6A 1LEMA 4COUA 1DGRN 3JB8A 3PLQA 1YO8A 3POYA 4Q4W3 1UU6A 1H8VA 1HKDA 4OHVA 1VBB2 2BBVA 1ZVFA 4XFHA 4XILA 3AJYA 2C5DA 4HK9A 1RMU3 3ZXGA 3VLBB 2PHUA 5FQ0B 4COYA 5CNAA 1ZZBA 2ZMNA 5A3MA 2WNEA 2XL9A 2Y0OA 4NHLA 2MEV1 1XQNA 1EYBA 3RJRA 3TYJA 3GF6A 1FX5A 3RYKA 2DU1A 1COV2 1YFXA 3WG2A 1AR83 4M3CB 1O7FA 2RS51 2DUQA 2B46X 4IERA 3O0XA 4BHPA 1GSLA 2RM23 2ZHMA 4XBLA 3I4IA 1WLDA 2ZGUA 1AX1A 3VBOA 3AYEA 3DGTA 4XPVA 4XJWA 1Z7S3 1EP0A 4XF3A 3RNSA 5ABJC 4XFAA 3FUOA 1QJX3 2WFF2 1VB4A 3VBUC 1YNAA 1V6NA 2X5IB 3O0VA 4L11A 1NQDA 2AH2A 4ZKTB 3JD73 1LHVA 3CNAA 2RR13 3H3ZA 1MS5A 1OLRA 3O14A 5KHHA 2TBVA 4GMP3 1CGPA 1IKPA 1FT9A 2BVBA 3GMFA 2PTMA 3SNMA 2XB6C 3MF6A 1I9RA 1RUG3 1IS4A 2A3XA 2R32A 3HQXA 1I5ZA 2R1BA 4XIOA 2B39A 1R1A2 1LHOA 2HEWF 4H7LA 4N9HA 3WDWA 3ZYRA 1ZYBA 3ZN6B 4YFZA 2IFWA 2YGMA 3IDBB 3AKRA 3FBYA 2AENA 4N7IA 4ZXKA 3SITA 1IHMA 1YJLA 3V65A 2ZAHA 1DYPA 1SLIA 4PDWA 2GC0A 3AK0A 5F6KA 4AYUA 2DFCA 3DORA 1DZTA 1FMD2 2WNUA 1F5FA 1PVXA 4B8EA 3CJIB 2ZPXA 3E97A 4E2GA 1LOCA 4I30A 2XH6A 1AXYA 1EV12 1D0HA 2DUPA 4Q4W1 5CADA 2EXJA 2X29A 1C5IA 2ZMLA 1NXD1 2PHXA 4Q0PA 4UBHA 3VV1A 1A3KA 1LOEA 3NV3A 5CVRA 2ZGTA 3AP7A 1NCQB 1ZZ6A 1RMU1 2XJUA 1K32A 4HVOA 3NL1A 4KGQA 4DXZA 5JLVA 2JG8B 3BCWA 3KGZA 2PAKA 1J1LA 5JZGB 3DUIA 2EALA 3T1MA 2WFF3 4CDQC 2WLQA 2JG9B 5KC6A 1AR81 1CAUB 2VY0A 3WDVA 1N1SA 4OHWA 4WM7A 3AKTA 5K0UA 2GNTA 2RM21 2C0ZA 4UW5A 3HT2A 4N43B 2QZ3A 4MVTA 1HLCA 3NVCA 4UW4A 4W6XA 2XLAA 2MPFA 3RMXA 1Z7S1 1RTVA 1QJX1 1R1A3 2CAVA 5C8WA 3RDIA 3E5UA 2W68A 3R4UA 3ZIWA 4K8FA 3JD71 2XJRA 3VHPA 1CAVB 3MIDA 2RR11 4XXAA 3ZFFA 3K51A 1Y43B 2K9ZA 5K0UC 2HYKA 2D97A 4GMP1 3ACLA 4E2SA 1FMD3 5BNOB 4BH9A 3N4MA 1LB2A 1RUG1 5EJ3A 3WDXA 1EV13 2P37A 2IFRA 4Y4YA 4FTBA 1QQP3 3DPRB 2I07B 3HR9A 3OD0A 4OFGA 4XMIA 4H55A 3WZ1A 2WNVB 1KRIA 4YGEA 5JAXA 5DG1A 1YFYA 2AZ5A 2GC1A 4XTMA 5DXDA 1GNHA 2UWCA 3WV6A 1ZREA 4HKWA 1NLSA 3M1HA 2ZX1A 1MVEA 5L7OA 4DRVA 1DGWX 3M8LA 5FAXA 4YVWA 4ES9A 4XJUA 4KWLA 1ZBA2 4COZA 2R49A 4QGMA 1AF9A 2JD4A 4YGCA 4F7ZA 3OD4A 1LGNA 1COV1 2YPJA 4Q4V2 3G7DA 3E5XA 1J3RA 4FPLA 3KQRA 3SHRA 1RUF3 3WCRA 3AP5A 4PCRA 4YG3A 1R092 1PGW2 3GZTB 4FOYA 4AW7A 3GNEA 4RQPA 1NA1B 4EROA 2YY1A 4K21A 1VR3A 1N1VA 2B45X 2NLRA 5L7OC 1FPN2 4YVWC 4IV3C 2VOVA 1ZRRA 2VQAA 4TWTA 1WBFA 2VMHA 4IXLA 2ZOEB 2DXNA 4CP1A 2WFF1 5IK5A 4Q26A 2VH9A 5J36A 1J1TA 1NY72 1RUD2 2P2KA 1WUVA 3D5OA 3CO2A 4XFIA 4GQ7A 5C8CA 5T3NA 2XJTA 2ATFA 1VBA2 4PIYA 3WHUA 5AC92 3WDYA 4R9AA 1Q8SA 4I09A 1V6LA 1VIWB 2WKKA 3WNXA 2VULA 5CFDC 3WDUA 2PN5A 5J37A 3JUUA 1G7YA 1R1A1 1A8MA 3VBRA 5A3LA 4CP0A 2XLFA 1BKZA 5JOYA 1UX6A 2A70A 3OY8A 1HW5A 1QXRA 1N6FA 3VHOA 4CEWB 4N7UA 1N6EA 3EJKA 3PTYA 3ZMOA 5C8CC 1XU1A 1A6CA 1VALA 5FOJB 3M70A 1CPNA 1PM7A 1Z0HA 2BNOA 1FMD1 1ZBA3 3MZHA 1YWKA 2PAEA 4R9DA 4URTA 1EV11 3AM2A 4Q4V3 3VZMA 1PGSA 1QQP1 4QD2A 3VBRC 5L19A 2OPKA 1FOD2 4JC0A 1R093 4P9GA 4L99A 3M3IA 1CJPA 1MQTA 1TNFA 1GV9A 4YZ2A 4LUMA 2WS92 1G6NA 4FP2A 2RRLA 3NV4A 2C9AA 4OVEA 3WQ0A 3ZFEA 4INDA 3LA3A 1AXZA 1ZZ8A 1KS4A 4B4RA 3AJZA 1UU5A 2VW0A 3NAPA 1T6GC 2ARBA 1SLBA 1S0EA 4AFAA 1RUD3 1PK6B 1RUF1 4QPIB 3LSEA 5L36A 3KMHA 2R062 5C9AB 1LODA 2YV8A 2ZGSA 2E9QA 2JE7A 4QPGC 4XXPA 4KL1A 1FAYA 1YIFA 2AYHA 3NKGA 5JMCA 1ALYA 1HRV2 3VDDB 4JVAA 3ZSEA 2X8KA 2D6PA 3VKFC 5KXDA 2P34A 5C4WA 2O8OA 4YZ3A 1IOAA 1S2KA 3B9IA 3ILNA 5GLWA 2JEMA 1OPMA 1SACA 2ZA9A 4XJAA 2EXKA 1FYUA 3IWZA 1REDA 3WCSA 2BVVA 2BQPA 3R0RA 3UL2A 3LA7A 4AEDA 1FOD3 2UYBA 1G86A 4WM8B 2ZGNA 2VGDA 3VBSA 1OPOA 1H8TA 4Y20A 1S0FA 3L2YA 5CIRA 2PYTA 5T52A 1JOJA 2CAUA 2WS93 2BTVC 3USUB 3SH4A 3TOJA 3NO8A 5C4WC 1ZBA1 3GZAA 2BW8A 4RSUA 4OLLA 3WG3A 4KG8A 2WINB 3RWNA 3QD6A 4Q4V1 1FC9A 3WT3A 2R16A 1W6PA 3S6PA 4WVMA 2G9FA 1OFNA 1UD1A 2QJVA 1VAKA 3TB0A 4LUKA 2DCZA 4FAHA 5IUQA 3WG4A 2ZBJA 3U11A 1R091 1PGW1 1LHWA 4MXWA 2WFPA 3FMGA 3WUDA 5FREA 2R063 3VBSC 1H8TC 3ALQA 3J9SA 2OIIA 4GWMA 1WD4A 1AR92 1QJU2 1ZBE3 4MXVA 4IETA 4Y1YA 2D6NA 3MIFA 4LBQB 4R8HA 1UW8A 5FLIA 4AVVA 1F9KA 3THPA 3H1MA 1UU4A 1HRV3 1VP6A 1NY71 1RUD1 4DINB 4RL7A 1ZNPA 1C28A 5BY5A 4N90A 2QKDA 1ASJ3 5FTTC 2OZ6A 1XE8A 1V9U2 1S55A 2Q8OA 3UKTA 4YVSA 2O0OA 2D3SA 3ZXFA 3L9JT 2IZWA 1YRZA 4FPKA 2D3RA 1S0GA 4R52A 1X8EA 2UY9A 3FUQA 3E5QA 1TNRA 4CDXB 5ABJB 1MR5A 3OGJA 3VBUB 3KT7A 5LK5A 1J7XA 4BWOA 3ZSLA 4AEKA 2NMOA 2VVDA 4JDNA 4EN7B 1OD5A 4HKOA 3UKNA 3KT4A 1GQHA 4SBVA 4P5HA 4OHXA 3P3PA 3ZXJA 1RJ7A 1WMEA 4PF5A 1AX2A 3KCYA 1SLAA 2YGLA 2ZGPA 3B01A 3H7YA 4RS5A 5GLVA 2CGNA 1FOD1 1WCSA 4G3YC 1C5HA 4LO7A 2PHDA 5F9TA 2WT0A 5IK8A 3PMSA 5GLTA 3RZZA 1QNYA 2WS91 4L92A 4FOVA 4Q0QA 1YXWA 5JSOA 1CAWA 2PAMA 1GYKA 4YM0A 1EPWA 1NCRB 3AZZA 3WG1A 4OI4A 2DCKA 4GULA 3EO6A 4P9XA 3UK9A 2ZTNA 3ES4A 2YC0A 1C8M2 1GFF2 1Y7BA 4RS5C 4ZU7A 4Y1XA 1AUYA 4YSFA 5B2GB 2R061 3I59B 4JTOA 2EXHA 2DCTA 3GHFA 1V9U3 1GR3A 3S0MA 4L1CA 4XQ4A 1F5JA 4TLFA 3VBHC 1G9FA 3HN1A 2G9GA 4I3PA 4Y1VA 3H50A 4AGVA 4AI1A 1HRV1 3I7DA 5T5PA 5LEKA 4GXLA 1DQ4A 4CDQB 2WZR2 4BLJA 1MACA 1VB2A 1AXKA 2C1FA 4XDQA 3AMPA 2FMDA 1ASJ1 4V1PA 1S0DA 4Z07A 1KQRA 4EWDA 1W6OB 4K20A 5FOBB 3EHKA 2DCYA 1TME2 4OHZA 1DZRA 4QT6A 4QGNA 5BUVA 1Q8QA 3JB4C 4CDUC 4AQSA 4P9LA 3H1WA 1J3QA 2XVKA 4AEMA 3ZXDA 2I74A 2IC1A 2ZKNA 3GYDA 1O4TA 1RMU2 4AHZA 5JOXA 4BCUA 5GLUA 3RYRA 1HXS2 1WCDJ 4BPZA 3GBFA 2CY6A 5I0SA 4JGYA 3V0BA 4A7ZA 3WVJA 4K9SA 4EV0A 3RQ0A 1B35A 1H9PA 2R072 1C8M3 4MZUA 4B29A 1XXNA 3ZN4A 4CEYC 3U07A 4E4ZA 5AFBA 2RM22 5BNPA 2XKPA 4KWJA 2ZGRA 1RITA 1WCKA 2Z69A 5D8AB 1QJU1 5GZDA 4AI3A 1ZX5A 4WV8A 4HLTA 4HVQA 4PBPA 4DB5A 4BIOA 1LJ7A 1ND2A 1NG0A 4RR3A 1ND3A 4N53C 1D0GA 2V09A 4NHMA 2MHFA 4XOGA 3WP6A 2ZHLA 1S0IA 2BNNA 2EAAA 4QQ2A 1MZEA 2YYOA 5A32B 3SCFA 3RYPA 2F4PA 3N7MA 2ZGOA 1V9U1 5JI7A 4L8QA 4FOWA 2E7AA 4K3UA 4YM3A 1HQLA 5KXCA 1PZ9A 1TME3 5L7OB 4QM8A 1CIWA 4IV3B 5I8TA 1ND2C 2VMIA 1VAMA 4M00A 4RR3C 1ND3C 2DVDA 1H2LA 3M3CA 4JAAA 3JQXA 5FLJA 3VL8A 2MNGA 1VAVA 1RGSA 1YUDA 2XL7A 4HETA 1XYPA 3CF6E 2CWMA 2RHPA 3IT8A 1HXS3 3O7OA 3ZMNA 3WW1A 4XF9A 3M4FA 2JDZA 1V70A 4AEJA 1H4GA 1S0BA 2JXAA 1RUH2 1ZZ7A 4AE2A 4B4QA 3MFCA 3OF1A 4EWAA 4E4SA 2HEYF 3H9AA 3NSTA 3OYWA 2Q1MA 5CFDB 1NZCA 2R073 3NW4A 2RE9A 3KT1A 4YLZA 2GH2A 1LOAA 3FFZA 4EN0A 2WSVA 1HDKA 4LE4A 3UV9A 3VHNA 1DDLA 3B93A 4WVWA 3VBFB 1UN1A 2XGXA 2WLPA 4EJRA 4GH4B 4HN0A 2QDNA 2BPA2 1C1FA 1X33A 3VL9A 2PHWA 4FBFA 4RFT0 4F8AA 3LZZA 5GLZA 4YG0A 1C8M1 1SDWA 1D4M2 2ARXA 4PBOA 1RUJ2 4I0BA 5EV7A 1ENXA 2H6CA 1JHNA 4LULA 5J98B 1OA2A 1OHFA 4X6QB 2BWAA 2YMZA 1RUOA 3ILRA 3MPPG 1G8WA 3VBOC 2HWD2 2D43A 2ZABA 5I91A 1CAXA 2FBEA 2FMYA 4AQ6A 3LCPA 1IZ3A 2DVAA 5T5LA 5K9YA 4HPKB 1VLNA 3ZSJA 5GJ6A 4JGZA 2WZR1 4GKXA 4GMP0 5HI0A 1U5YA 2VW1A 1C1LA 4QXKA 1CESA 1X82A 4CDWB 3E6CC 2ETEA 1BCXA 1UPIA 5FMOL 4C91A 3ELNA 4LEJA 3V0AA 5DUWA 4A7YA 5BNNA 5JVVA 1CONA 3WP4A 4CP2A 2XVLA 1RUH3 4FP3A 1TME1 4XFFA 4MLOA 4MGKE 4LO6B 2ZHKA 1W6MA 1QQP2 4PJYA 3IIAA 4QPGB 4DMIA 3R4SA 1GQGA 2GMMA 3ILFA 4Q1PA 1BPLA 2FHRA 1TEIA 2UWAA 2TEPA 1H9WA 2X53S 5LK7B 2BYVE 1K5MB 4RHV3 5I0UA 2OUJA 1FC6A 1POV3 1BK1A 2D6KA 2YDEA 3S7IA 3VZNA 1RUNA 1HXS1 4PDWC 5GZEA 4CYDA 2WNUC 5DUXA 1LULA 5FO9B 2R071 1QXJA 3R6SA 5IK7A 1D4M3 1RIRA 1RUJ3 1V6JA 1U0AA 3ZVXA 1RUF2 1PO22 3AFGA 1QDCA 5JPMB 4S2GA 2D5FA 1JTZX 4YM1A 1AJKA 1F2NA 1W6NA 2A6VA 2HWD3 3FLTA 4LLOA 4XHBA 1DGWA 1OSGA 2DFBA 4JDMA 1UIJA 1MZFA 4IEQA 3MI8A 4ZU5A 4KU8A 4C1XA 1SFYA 1XNCA 3U10A 2VOKA 4D7YA 2XVGA 3PVBB 3MOGA 4B7EA 3UJQA 2WT1A 2WIIB 3W59A 1D2SA 2ZZJA 1RHI2 3DF0A 3POSA 4WM7C 2WA3A 1PZ8A 1PMIA 2UYAA 3LOIA 4Z92B 4X8PA 1NYWA 3INAA 4LHNA 1O5LA 2FQPA 3QOPA 4PIZA 4FTSA 2N7GA 1XYOA 3AFKA 4DY3A 1TQ5A 1GZCA 4J1XA 4U2AA 1SCSA 2EXIA 1VBE3 2Q0AA 3AMNA 2BFUL 1XNBA 2ZS6B 4EN6B 3R05A 3IKWA 3ZFFC 4Q8KA 3AZYA 1WLCA 3FLPA 3ZFGA 1KJRA 1QF3A 1RUH1 4JQRA 5CFCA 4HVRA 1GZWB 1C3HA 1AR62 3AB0A 4ZU4A 1BEV3 1OOPA 2QFEA 1H1MA 3JZVA 5E89A 1RL3A 2AUYA 1PO23 1LHNA 5JIAA 1UKGA 1NE4A 4DZGA 4G4FA 2ZX0A 2DUOA 2A7AA 2CV6A 4BMEA 1HIXA 4IEYA 3ZSKA 4RHV1 3NKTA 4HSLA 1UMZA 1EY2A 4W6YA 1POV1 2A3YA 5H9SA 3ZYIB 3W9AA 5CAZA 4M01A 1WW5A 2OUHA 5KHGA 2Q30A 2HWC2 3ZFGC 2QE3A 2OW4A 3N7JA 5CFCC 3MIEA 1CX4A 1HQWA 2DURA 4UBGA 1D4M1 1V00A 3H3UA 1RUJ1 3M7AA 1TMF2 1OOPC 5FQ0A 1IKQA 5T50A 5J96B 5JOZA 5JSPA 1LCLA 5JWPA 2ZOAA 1RHI3 2D93A 3C2UA 3D0JA 4Y22B 5SV5A 3O12A 4RQPC 2E7QA 4C0HA 2HKXA 2HWD1 3VGIA 2SLIA 3OTFA 2PLV2 5FDBA 4M3CA 3ATGA 4YZ1A 3MPBA 4AQTA 1Q3EA 2VOXA 3MW2A 4XFGA 4QMAA 3CU7A 3S30A 1D2QA 3ZN5A 3LOBA 5ACA2 4AWDA 2K2SA 2WQZC 2E51A 2P17A 3WD5A 2CGPA 1ENQA 1PNGA 2GN7A 2YUEA 5EFUA 4FPCA 3ZXKA 2LUWA 1W6QB 3D4KA 1AX0A 1YI7A 2X5IA 4JV4A 2WWSA 4ONUA 3AP4A 1AR63 1FC7A 3DKWA 3MIGA 3VBHB 4IV1B 1JUIA 2HEVF 4F3JA 3USSA 3J26N 4OI2A 2R1DA 2ZX3A 1JXNA 2G4IA 4FXKB 5E1RA 1UL9A 1RUE2 2WZPP 3CJXA 4GHNA 3WW3A 3MW3A 2DVBA 1ULCA 4XJZA 4YW2A 5JIUA 2HWC3 1A78A 3ZN6A 1NE6A 1FI2A 3WHTA 1QOTA 1BEV1 4E2QA 3QACA 4OI1A 2O8QA 1IQAA 1TMF3 1PO21 1SFNA 2RS13 1DQ0A 4HMZA 4PLMA 3MLLA 3K48A 2WQ4A 4CDUB 3CJIA 4META 4U36A 1MQTC 1U12A 4WVVA 1ONAA 2PLV3 5BXXA 1S0CA 1ZBE2 2K0GA 5BPXA 2OZJA 2Q1ZB 1XNDA 3ZFEC 1YFWA 2QUOA 4F83A 2HWE2 1LOFA 1NCQA 4IEUA 3NAPC 4D94A 5ACA3 5EXOA 5KBFA 1REFA 1SLLA 2JG8A 4WZFA 1QGLA 3OJBA 3WY6A 1RHI1 2D3PA 5JZGA 4OULA 2R0HA 3CJIC 4CEYB 1A8DA 1Q8VA 1ASJ2 2JG9A 2DWRA 5I0RA 4OI0A 2QDRA 4Z8BA 1CAUA 2A75A 2DU0A 2GDFA 4TZDA 3VZJA 3MGUA 2RMU2 1KJLA 5A33B 1DHKB 3AXDA 3PJYA 3WDTA 3H8UA 4LO8A 4N43A 4M0NA 3PVEA 2OA2A 3WP5A 4AVBA 4IL7A 1H2NA 5FMOS 4N53B 3ZXAC 2CWSA 2ZZQA 2Y0IA 1W2UA 3IBMA 2JENA 1MS9A 2JG8C 4HZFA 3BPZA 3RG0A 1RUE3 5JZGC 2Z42A 3ZXEA 5T55A 2XWBB 3WLUA 1AR61 3E6BA 1I3HA 1MS4A 5DZFA 1CAVA 1AVBA 4XJ8A 4YGDA 3AZVA 3D6EA 3HMYA 5EYYA 5J3UA 3R4DB 4AI2A 3AYCA 4FOQA 1QOOA 2TUNA 2DYCA 4AEDC 4I3GA 4ATEA 5BNOA 5J09A 3AP6A 2WSUA 5JSRA 3ZDSA 4FPHA 1Q5OA 4GWNA 4NR1A 2LTNA 3DPRA 5F6LB 4R4XA 2WNVA 1DGRA 2IXIA 2BGCA 5DUVA 2HWC1 4Q0VA 4EN9B 2HWE3 3BB6A 1VRH2 4FXGB 3IPVB 1O3QA 1BVP1 1TMF1 2GU9A 3FBMA 5EZWA 3I8TA 2O1QA 2XG3A 3HWJA 4NO4A 2XWJB 1QH7A 3LA2A 5FPZA 1MVQA 1W0PA 1DU3D 1PNFA 4A7KA 2PFWA 4RA0A 5BNOC 4AXOA 2YROA 4E4DX 3JCIA 2W39A 2PLV1 4AHWA 2RJKA 1AR72 2NN8A 4AFCA 5IT6A 2ZGMA 4XE9A 3ZYJB 3DPRC 4QQLA 4AVTA 3KS7A 4AI0A 2RMU3 1OQ1A 1OI6A 1NA1A 2IXKA 5ACA1 1LGCA 2ZAAA 3LKJA 1PO13 1SLCA 2ZCWA 5KHIA 3DN7A 4Q4X2 3H1YA 4Y26A 4A2UA 3N36A 4XBNA 3ZO0B 1YYNA 1C4RA 4NWVA 4FVVA 2PA7A 1QY4A 3VBOB 3KCCA 4YVSC 2QQPA 2GNDA 5HCFA 3ROUA 2W52A 3O5SA 2EVXA 4YZ5A 1LESA 2BFUS 3BTAA 3A4UA 1FNYA 4NWWA 4XQWA 3DV8A 3IMNA 3SH3A 3MICA 3NJZA 4Q29A 1RUE1 1VBD2 1QU0A 4ISQA 4WVZA 4CRQA 4MGYE 2HJIA 2NZ9A 2DCJA 4COWA 1N6DA 3WOGA 1APNA 1SBFA 2IXHA 4Q4Y2 2V73A 4Z2WA 1VRH3 3ASIA 4H14A 2I2SA 3J4UH 2ZMKA 4MH0E 1S1AA 4DFSA 4DY5A 4HFSA 3LSDA 5CA6A 2PHRA 3GHNA 1ENSA 3QBQA 4K40A 2H0VA 3JBG2 3AKQA 3ETQA 4IEZA 4K6BA 4MGIE 2Z79A 4XFCA 1AR73 3BODA 4FCAA 3OCPA 3SXWA 1ZBE1 4P9JA 3IN9A 1WW6A 1KFUL 2XKOA 4MSVA 4YM2A 4PDWB 2HWE1 3IM0A 5DZGA 2WNUB 2E7TA 2ZJCA 5AVAA 3W58A 2ES3A 1PHMA 3AKSA 4JRLA 4Q4X3 5FO7B 1RUI2 3RSJA 2W08A 1AYN2 2WT2A 4B3NA 1M4WA 5HCBA 2VQ0A 1IPKA 5FFOC 3WXPA 4NVPA 2GNBA 2CYFA 4AQ2A 4YW3A 3V56A 1PK6A 4XHXA 1H2MA 1KXGA 2RMU1 4OUSA 1NOVA 3CL1A 3FC0A 4MUVA 4ORFA 4QPIA 1LU1A 1IS5A 1YIPA 2BNMA 2EAKA 3N3HA 5C9AA 1PO11 3AYAA 1DF0A 1VBC2 4XYXA 4KWKA 4QPYA 5GZCA 5I93A 5E88A 1I6XA 1VBD3 3SLIA 1KS5A 1RC6A 4Q0SA 3KB5A 4KNCA 4E27A 1BVVA 4GA9A 3NWKA 4XQDA 1H1IA 2VECA 3RMYA 1BXHA 1UAIA 4WM7B 3VKMA 5F1RA 1HV1A 3VDDA 5K0UB 1OMIA 4Q4Y3 4LA3A 3RJ2X 4RGGA 1PK6C 3TRSB 4HT1T 1FV3A 3TWIA 4ASLA 4FAGA 1Q56A 4Y1ZA 1AYM2 3B3QE 5I0TA 5C9AC 1EAH2 1H30A 1H0BA 4P9WA 1AHSA 5JDBA 3JBG3 3ZIXA 4LBLA 2E53A 2UY8A 5LRSA 3LAGA 1V6MA 1ZRFA 3ZFFB 1MZ5A 3VDDC 4WM8A 1VRH1 4Q1RA 1BYHA 1CJDA 4JGYC 5EYXA 3VKLA 5FPXA 1B35C 1MS0A 2R30A 3HBZA 3USUA 4XF0A 1RUI3 1PVC2 4FPGA 1AYN3 1AZDA 1WGPA 3U4XA 3U0ZA 4GB32 4TYSA 5GKAC 4Y24A 5BNPC 4ES8A 1AR71 3OBTA 3B69A 4G9SB 1N3PA 2B5HA 4AFDA 2ET1A 2GMPA 3I54A 4YVWB 5HCAA 2CNAA 2SBAA 1WD3A 1WBLA 4S2DA 1F8VA 4XMAA 3ZX7A 1VBC3 1HX6A 4Q4X1 3TN93 4ITCA 1WLTA 4BQ1A 4LBQA 1DIWA 3TBDA 4JDOA 4XF1A 4DRRA 2A6ZA 1OLQA 4R4ZA 5TSWA 1DQ2A 2F6BA 3DJAA 2EF6A 4RQPB 3MW4A 3RRDA 4Q2FA 4DOUA 3MFAA 4ATFA 3KLSA 2NP0A 1REEA 1BJQA 4FQ4A 1Y9QA 4LE3A 5GZGA 4ASMB 1AYM3 5FO8B 4L8KA 1GANA 2WL1A 1PGL1 1BMV2 1EAH3 1LOBA 1VBD1 2NMNA 2FZ2A 4COVA 2DVFA 4RHV2 2B42B 3BOWA 4JRAA 4C1WA 3MIBA 2UU8A 3VKNA 3VUOA 5HBAA 2EA7A 1CPMA 4O9GA 2LALA 5D1IA 4CDXA 5ABJA 5C8CB 1ENRA 2KXLA 4Q4Y1 4FT8A 3HIFA 3VBUA 3VZKA 4AVSA 4FPOB 4Z1VA 3OGGA 3A0NA 4XETA 5F5QA 4R9CA 1PVC3 2DF7A 2QZ2A 3VBRB 4GB33 5LRRA 1QDOA 1ULEA 3JBG1 1PZ7A 2PELA 5BV6A 3J8F2 2KA3A 3OY8B 4A3XA 2A3WA 5JOWA 4HK8A 4FQZA 1FCFA 4CDXC 1QKQA 1YFUA 1UZYA 1U5ZA 4P9IA 3FHIB 4I0WB 1LRHA 1U5IA 2IXLA 4EWEA 3B5LB 4BIFA 2D98A 4FPEA 2UURA 4AF9A 4BE3A 4M0HA 2JE9A 1RUI1 4I0AA 1AYN1 2ZKLA 3PMEA 5CG8A 3PJQA 5H9QA 4WZCA 1NCRA 2JJ6A 3CLPA 2Y26A 1L3JA 1BQPA 1SQ4A 1KITA 1WA4A 4IQPA 4YRDA 1MQTB 4O9EA 3EQEA 3LB9A 3E6DA 2E63A 1KFXL 2P3JA 5H9PA 5SV8A 2Q4SA 2ENRA 3I59A 3ZFEB 3APBA 1VBB3 4XBQA 2DXLA 1G9CA 3ES1A 2R6QA 4LTAA 1G9DA 1GZ9A 1VBC1 1ULFA 4JGZC 3TN91 3N7LA 3SISA 5CB7A 3M2MA 3D82A 3NAPB 5GZFA 1VBE2 3QLQA 3M3EA 3FZ3A 3QH6A 1X8MA 2ZX2A 2DTWA 2ZO9B 1NCRC 4D7TA