4L1CA

Crystal structure of dimerized n-terminal domain of minc
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
TPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable septum site-determining protein MinC
publication title Crystal structure of the N-terminal domain of MinC dimerized via domain swapping.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 22
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.120 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4l1cA00
4L1CA 3GHFA
chains in the Genus database with same CATH superfamily
1SBOA 5EUWA 4JC0A 1VC1A 3F43A 3V97A 1WXWA 1J7XA 1N6FA 3K50A 1K32A 4GHNA 4AE2A 3AGEA 2DXLA 3QDQA 4HYLA 1N6EA 3GVLA 4DGHA 1TILB 3EH7A 3GVKA 2CWWA 4AEJA 4DMGA 1HF2A 3C0KA 2ZOAA 3IHBA 1THNB 3GK7A 3GVJA 1T6RA 3JU4A 2AS0A 4L1CA 3D03A 4DGFA 5EUZA 3NY7A 3VSEA 2DXNA 1H4ZA 2RRLA 5EUSA 1H4XA 3DJAA 3GHFA 3V8VA 1N6DA 2VY9A 3IH8A 3MOGA 4QTPA 3AGDA 3GMFA 5EUXA 1V0FA 5EZBA 3LDFA 3D3UA 1WXXA 3MGLA 3IF5A 3ZTBA 4L8KA 3OIRA 2KA5A 2ZO9B 3DORA 1BUZA 1H4YA 3OIZA 4XS5A 1FC9A 3T6OA 1AUZA 1TIDB 2OASA 1FC7A 3DUPA 2B78A 3IHAA 3LLOA 3LKLA 1TH8B 1BPLA 3IH9A 1FCFA 5EUUA 4HIZA 2KLNA 3ZXNA 1FC6A 1V0EA
chains in the Genus database with same CATH topology
3DJAA 2ZO9B 3DORA 2ZOAA 3GHFA 4JC0A 1FC9A 1FC7A 1N6DA 3DUPA 1J7XA 1N6FA 3MOGA 3K50A 1K32A 4GHNA 3D03A 4L1CA 4AE2A 3GMFA 1BPLA 2DXLA 1FCFA 2DXNA 1N6EA 2RRLA 1FC6A 4AEJA 4L8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L1C A;  3GHF A; 
#chains in the Genus database with same CATH topology
 1SBO A;  5EUW A;  4JC0 A;  1VC1 A;  3F43 A;  3V97 A;  1WXW A;  1J7X A;  1N6F A;  3K50 A;  1K32 A;  4GHN A;  4AE2 A;  3AGE A;  2DXL A;  3QDQ A;  4HYL A;  1N6E A;  3GVL A;  4DGH A;  1TIL B;  3EH7 A;  3GVK A;  2CWW A;  4AEJ A;  4DMG A;  1HF2 A;  3C0K A;  2ZOA A;  3IHB A;  1THN B;  3GK7 A;  3GVJ A;  1T6R A;  3JU4 A;  2AS0 A;  4L1C A;  3D03 A;  4DGF A;  5EUZ A;  3NY7 A;  3VSE A;  2DXN A;  1H4Z A;  2RRL A;  5EUS A;  1H4X A;  3DJA A;  3GHF A;  3V8V A;  1N6D A;  2VY9 A;  3IH8 A;  3MOG A;  4QTP A;  3AGD A;  3GMF A;  5EUX A;  1V0F A;  5EZB A;  3LDF A;  3D3U A;  1WXX A;  3MGL A;  3IF5 A;  3ZTB A;  4L8K A;  3OIR A;  2KA5 A;  2ZO9 B;  3DOR A;  1BUZ A;  1H4Y A;  3OIZ A;  4XS5 A;  1FC9 A;  3T6O A;  1AUZ A;  1TID B;  2OAS A;  1FC7 A;  3DUP A;  2B78 A;  3IHA A;  3LLO A;  3LKL A;  1TH8 B;  1BPL A;  3IH9 A;  1FCF A;  5EUU A;  4HIZ A;  2KLN A;  3ZXN A;  1FC6 A;  1V0E A; 
#chains in the Genus database with same CATH homology
 3DJA A;  2ZO9 B;  3DOR A;  2ZOA A;  3GHF A;  4JC0 A;  1FC9 A;  1FC7 A;  1N6D A;  3DUP A;  1J7X A;  1N6F A;  3MOG A;  3K50 A;  1K32 A;  4GHN A;  3D03 A;  4L1C A;  4AE2 A;  3GMF A;  1BPL A;  2DXL A;  1FCF A;  2DXN A;  1N6E A;  2RRL A;  1FC6 A;  4AEJ A;  4L8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...