4L1CA

Crystal structure of dimerized n-terminal domain of minc
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
98
structure length
98
Chain Sequence
b'TPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable septum site-determining protein MinC
publication title Crystal structure of the N-terminal domain of MinC dimerized via domain swapping.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 22
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.120 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4l1cA00
4L1CA 3GHFA
chains in the Genus database with same CATH superfamily
2KLNA 3MOGA 1BUZA 3AGDA 1N6EA 2AS0A 3LDFA 4GHNA 1WXWA 3GK7A 1K32A 3GHFA 3T6OA 3ZXNA 3GVKA 5EUSA 4AEJA 2KA5A 1T6RA 3V97A 4L1CA 4DGFA 1N6DA 3IHBA 4QTPA 3V8VA 3QDQA 1FC9A 1FC7A 1SBOA 3IHAA 3D3UA 3LKLA 3VSEA 2ZOAA 1J7XA 3AGEA 3D03A 3ZTBA 2B78A 2DXNA 2CWWA 2DXLA 4DGHA 1AUZA 1V0EA 4DMGA 1FCFA 4L8KA 4XS5A 3IH9A 3K50A 5EUZA 1V0FA 5EZBA 4HIZA 1TIDB 1BPLA 3NY7A 3GVLA 4JC0A 5EUWA 1N6FA 3GMFA 2OASA 5EUUA 3DJAA 3F43A 3C0KA 1THNB 3OIRA 5EUXA 1HF2A 2RRLA 2ZO9B 1TILB 3LLOA 3MGLA 1H4ZA 1VC1A 1TH8B 3IF5A 3IH8A 3OIZA 1H4XA 3DORA 3JU4A 1H4YA 1FC6A 4HYLA 4AE2A 3DUPA 2VY9A 1WXXA 3GVJA 3EH7A
chains in the Genus database with same CATH topology
1BPLA 1FC9A 4JC0A 3MOGA 1FC7A 1N6EA 1N6FA 1J7XA 2ZOAA 3GMFA 3D03A 4GHNA 3DJAA 3DORA 2DXNA 1K32A 3GHFA 4AEJA 2DXLA 1FC6A 4AE2A 1FCFA 3DUPA 4L8KA 3K50A 4L1CA 1N6DA 2RRLA 2ZO9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L1C A;  3GHF A; 
#chains in the Genus database with same CATH topology
 2KLN A;  3MOG A;  1BUZ A;  3AGD A;  1N6E A;  2AS0 A;  3LDF A;  4GHN A;  1WXW A;  3GK7 A;  1K32 A;  3GHF A;  3T6O A;  3ZXN A;  3GVK A;  5EUS A;  4AEJ A;  2KA5 A;  1T6R A;  3V97 A;  4L1C A;  4DGF A;  1N6D A;  3IHB A;  4QTP A;  3V8V A;  3QDQ A;  1FC9 A;  1FC7 A;  1SBO A;  3IHA A;  3D3U A;  3LKL A;  3VSE A;  2ZOA A;  1J7X A;  3AGE A;  3D03 A;  3ZTB A;  2B78 A;  2DXN A;  2CWW A;  2DXL A;  4DGH A;  1AUZ A;  1V0E A;  4DMG A;  1FCF A;  4L8K A;  4XS5 A;  3IH9 A;  3K50 A;  5EUZ A;  1V0F A;  5EZB A;  4HIZ A;  1TID B;  1BPL A;  3NY7 A;  3GVL A;  4JC0 A;  5EUW A;  1N6F A;  3GMF A;  2OAS A;  5EUU A;  3DJA A;  3F43 A;  3C0K A;  1THN B;  3OIR A;  5EUX A;  1HF2 A;  2RRL A;  2ZO9 B;  1TIL B;  3LLO A;  3MGL A;  1H4Z A;  1VC1 A;  1TH8 B;  3IF5 A;  3IH8 A;  3OIZ A;  1H4X A;  3DOR A;  3JU4 A;  1H4Y A;  1FC6 A;  4HYL A;  4AE2 A;  3DUP A;  2VY9 A;  1WXX A;  3GVJ A;  3EH7 A; 
#chains in the Genus database with same CATH homology
 1BPL A;  1FC9 A;  4JC0 A;  3MOG A;  1FC7 A;  1N6E A;  1N6F A;  1J7X A;  2ZOA A;  3GMF A;  3D03 A;  4GHN A;  3DJA A;  3DOR A;  2DXN A;  1K32 A;  3GHF A;  4AEJ A;  2DXL A;  1FC6 A;  4AE2 A;  1FCF A;  3DUP A;  4L8K A;  3K50 A;  4L1C A;  1N6D A;  2RRL A;  2ZO9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...