4L8KA

Crystal structure of a putative peptidase (parmer_02772) from parabacteroides merdae atcc 43184 at 2.26 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
SSPRDNFEALWRIMDENYCFFAFKDVDWDDVYDRYNLLVKDTMNQYELFDILGKMLAEVKDGHTNLISSFDMSRYWAWYEDYPANFYKEIQDNYLGTDYKIAGGMKYKRLADDQIGYVYYGSFSSGVGENNLDYMFAHFKECKGLIFDVRDNGGGSMLYSDRIASRFLEERILTGYTQYKKGNGHNDFTQPNPVYLSPSDRTRWLRPVIVLTNRHSYSATNDFVNVMRLLPQVTVMGDRTGGGSGLPFSSELPNGWSVRFSACPVLDVNKQHTEFGIDPDTAVAITGEDIMKGRDTIIEAAIGLLLAKGDSAISY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative peptidase
publication title Crystal structure of a putative peptidase (PARMER_02772) from Parabacteroides merdae ATCC 43184 at 2.26 A resolution
rcsb
source organism Parabacteroides merdae
molecule tags Hydrolase
total genus 101
structure length 315
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF14684 Tricorn_C1 Tricorn protease C1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4l8kA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4l8kA02
2GTRA 3GMAA 3SLLA 4ELSA 3M6MA 5E0SH 3HP0A 2VSUE 3H0JA 3P2LA 4HNKA 2QQ3A 1FC6A 4L8KA 4JYLA 3MOYA 1Q52A 4IZCA 2A7KA 1N6EA 4U0GH 3TLFA 4JJTA 5C90A 5INIA 4JVTA 1XNVA 5IKLB 3HRXA 2DEOA 4OLQA 4FNBA 5DTWA 3P5MA 4K2NA 2C8TA 3OMEA 4ZDFA 3K8XA 3IBBA 2ZL3A 3JU1A 2A7SA 2CE3A 2ZL4A 4FJWD 3HLN1 2F9IA 1NZYA 4U19A 3STAA 5DKPA 5KDRB 4OMRA 1EF8A 2Q34A 3DJAA 2A81A 4FNDA 3QXZA 3KTIA 4I52A 4EMMA 4FZWA 3TVWA 3LAOA 2Q2XA 4FN8A 3R9TA 3FF6A 4I4ZA 2HW5A 2UZFA 3R6HA 4Q1IA 3PZKA 3T89A 2FBMA 3L3SA 4ZDBA 3IB9A 2F6IA 2F6QA 3TV5A 1MJ3A 4MOUA 4DI1A 5FIFA 4KPKA 3R9SA 1UYTA 4JCRA 2F9IB 1NZYB 5INFA 2VSSE 1ON3A 1K32A 5DU4A 1EF9A 5E0SA 3T88A 1HZDA 1DUBA 3Q0JA 1UIYA 3Q0GA 5G1SA 4U1AA 4MXIA 1N6DA 1UYRA 2J5II 3T8AA 3OT6A 4G2RA 3U9SB 5FUSA 2PG8A 1N6FA 2FZSA 4NNQA 5DU6A 4B3HA 3I47A 1Q51A 4ZDDA 3ZWBA 2IEXA 2VREA 5G1QA 1UYVA 1OD2A 4FB8A 1YG6A 1WDMA 2J5IB 3TRRA 4JFCA 5DUCA 1J7XA 5KJPA 1RJMA 1JXZA 5JBWA 4GHNA 1TG6A 1HNOA 3WG5A 3HINA 3GF7A 1SZOA 1DCIA 1TYFA 2J5SA 3R0OA 3GF3A 2VSSA 2VSSF 2PBPA 1WZ8A 4JOTA 3PGQA 3RSIA 4K29A 3U9TB 3ISAA 3M6NA 4YLHA 2F9YA 3H0SA 3IAVA 3PEAA 2DUBA 1FC9A 2WTBA 3VIVA 1XX4A 5DL1A 3Q1TA 4WCZA 3KTHA 4F47A 4RYFH 2Q35A 4QIJA 3P85A 3QK8A 4U18A 4KD6A 4B3JA 2W3PA 3T3WA 2X24A 3MYBA 4U0HA 2VSUC 3KQFA 2NP9A 4EMPA 1W2XA 2ZQQA 4I42A 3OC7A 3LKEA 3R9QA 3KTKA 2D3TA 5MGBA 3GLMA 1ON9A 1HNUA 3MT6A 4Z0MA 4KNPA 3ZW9A 1VRGA 4LK5A 2ZQRA 4B3IA 1WDLA 3KTGA 1PIXA 3TVUA 3H0QA 4ELWA 3BF0A 1PJHA 1RJNA 4JWVA 4Q0GA 1K39A 5KDRA 4WYOB 2PPYA 1X0UA 3H81A 1YG8A 2X58A 3ZWAA 3DORA 2BZRA 1XNWA 5CTCA 3TZ3A 4JCSA 4IZDA 4RYFA 3PE8A 2EJ5A 3TT7A 3ST9A 4QFEA 1SG4A 1UYSA 3ZWCA 4IZBA 3TDCA 3QYRA 3U9RB 3KTJA 4ZDEA 5INGA 4ELXA 2J5GD 3MFMA 4JSBA 4EMLA 4FZWC 4HC8A 5E0NX 3QMJA 3QXIA 3Q7HA 2VX2A 3GKBA 3TT6A 4ASIA 4JCQA 1O8UA 2ZL0A 5CTBA 4MI2A 4FN7A 5DUFA 3V5EA 3V5IA 4WZ8B 3H0UA 4JCTA 3H02A 2ZL2A 4KWBA 4ZDCA 3K50A 5DZKA 5JBXA 3SWXA 3T8BA 1XNYA 4OG1A 5G1RA 4L6WA 4RCNA 2F9YB 2VSUA 3BPPA 1FCFA 1OD4A 2VSUF 2CBYA 5DTPA 3HE2A 3QREA 3QKAA 4ZU2A 5C9GA 3NJDA 3QWDA 3RSTA 3FDUA 2J5GA 1EY3A 3ZW8A 2J5IA 1Y7OA 4QIIA 3RRVA 1WDKA 3NJBA 4K3WA 1FC7A 3BEZA 5DU8A 5DZKH 3N6RB 4NEKA 4U0GA 1XO6A 4JYJA 2FW2A 4GM2A 3G64A
chains in the Genus database with same CATH superfamily
2GTRA 3GMAA 3SLLA 4ELSA 2CWWA 3M6MA 3ZTBA 5E0SH 3HP0A 2VSUE 3H0JA 3P2LA 3AGDA 4HNKA 2QQ3A 1FC6A 4L8KA 4JYLA 3MOYA 1Q52A 4IZCA 2A7KA 1N6EA 4U0GH 3TLFA 4JJTA 5C90A 5INIA 4JVTA 1XNVA 5IKLB 3HRXA 3IH8A 2DEOA 4OLQA 1BUZA 3GHFA 4FNBA 5DTWA 3P5MA 4K2NA 2C8TA 3OMEA 4ZDFA 3K8XA 3IBBA 2ZL3A 3JU1A 2A7SA 2CE3A 2ZL4A 4FJWD 3HLN1 2F9IA 1NZYA 4U19A 3STAA 5DKPA 5KDRB 4OMRA 1EF8A 1WXXA 2Q34A 3DJAA 3GVLA 3IH9A 2A81A 4FNDA 3QXZA 4AE2A 3KTIA 4I52A 4EMMA 4FZWA 3TVWA 3LAOA 2Q2XA 4FN8A 4NARA 3R9TA 1T6RA 3FF6A 1BPLA 4I4ZA 1TILB 2HW5A 2UZFA 3R6HA 4Q1IA 3PZKA 3T89A 2FBMA 3L3SA 4ZDBA 3IB9A 2F6IA 2F6QA 3TV5A 1MJ3A 4MOUA 4DI1A 5FIFA 4KPKA 3R9SA 2DXLA 4AEJA 1UYTA 4JCRA 2F9IB 1NZYB 5INFA 2VSSE 1ON3A 1K32A 5DU4A 1EF9A 5E0SA 3T88A 1HZDA 1DUBA 3Q0JA 5EUXA 5HUQA 1UIYA 3Q0GA 5G1SA 4U1AA 4MXIA 1N6DA 1UYRA 2J5II 1H4ZA 3T8AA 3OT6A 4G2RA 3U9SB 3QDQA 3LDFA 5FUSA 4L1CA 3MOGA 2PG8A 1N6FA 3GVKA 2FZSA 4NNQA 5DU6A 4B3HA 3V8VA 3I47A 1Q51A 4ZDDA 3ZWBA 2IEXA 2VREA 2YJGA 5G1QA 1UYVA 1V0FA 1OD2A 3C0KA 4FB8A 1TH8B 1H4XA 1YG6A 1WDMA 2J5IB 3TRRA 4JFCA 5DUCA 2OASA 1J7XA 5KJPA 1RJMA 1JXZA 5JBWA 4GHNA 1TG6A 1HNOA 3WG5A 3F43A 3HINA 3GF7A 1SZOA 1DCIA 1TYFA 2J5SA 3R0OA 3GF3A 2VSSA 2VSSF 4DMGA 2PBPA 5EUZA 1WZ8A 4JOTA 3PGQA 3RSIA 4K29A 3U9TB 3ISAA 2ZO9B 3M6NA 4YLHA 2F9YA 3H0SA 3IAVA 3LLOA 3IF5A 3PEAA 2DUBA 1FC9A 2WTBA 3OIZA 3VIVA 1AUZA 3LKLA 1XX4A 3JU4A 5DL1A 3Q1TA 4WCZA 3KTHA 2ZOAA 3DUPA 4F47A 4RYFH 3GVJA 5EZBA 2Q35A 4QTPA 4QIJA 3P85A 3QK8A 4U18A 4KD6A 4B3JA 2W3PA 3T3WA 2X24A 3MYBA 4U0HA 3GK7A 2VSUC 3KQFA 3T6OA 2NP9A 1H4YA 4EMPA 1W2XA 2ZQQA 4I42A 3OC7A 3LKEA 3R9QA 3KTKA 2D3TA 3D03A 5MGBA 3GLMA 1ON9A 1HNUA 3MT6A 4Z0MA 4KNPA 3IHBA 3ZW9A 1VRGA 4LK5A 2ZQRA 1VC1A 4B3IA 1WDLA 3KTGA 5EUUA 1HF2A 1PIXA 3TVUA 2VY9A 3H0QA 2DXNA 4ELWA 3BF0A 1PJHA 1RJNA 3IHAA 3D3UA 3MGLA 3GMFA 4DGFA 4JWVA 4Q0GA 1K39A 3NY7A 5KDRA 4WYOB 2PPYA 1X0UA 3H81A 1YG8A 1V0EA 2X58A 3OIRA 1TIDB 3ZWAA 3DORA 2BZRA 1XNWA 1SBOA 2B78A 5CTCA 2AS0A 3TZ3A 4JCSA 4IZDA 3EH7A 3PE8A 4RYFA 4J2UA 2EJ5A 2KA5A 3TT7A 1THNB 3ST9A 4QFEA 1SG4A 1UYSA 3ZWCA 4HDTA 4HIZA 4IZBA 3TDCA 3BPTA 3QYRA 3U9RB 3KTJA 4ZDEA 4HYLA 5INGA 4ELXA 2J5GD 3MFMA 3ZXNA 4JSBA 4EMLA 2RRLA 3V97A 4HC8A 4FZWC 5EUWA 3QMJA 4DGHA 4XS5A 5E0NX 3QXIA 3Q7HA 2VX2A 3GKBA 3TT6A 4ASIA 4JCQA 1O8UA 4JC0A 2ZL0A 5CTBA 4MI2A 2KLNA 4FN7A 5DUFA 3V5EA 3V5IA 4WZ8B 3H0UA 4JCTA 3H02A 2ZL2A 4KWBA 4ZDCA 3K50A 3AGEA 5DZKA 3VSEA 5JBXA 3SWXA 3T8BA 1XNYA 4OG1A 5G1RA 4L6WA 4RCNA 2F9YB 2VSUA 3BPPA 1FCFA 1OD4A 2VSUF 2CBYA 5DTPA 3HE2A 3QREA 3QKAA 4ZU2A 5C9GA 3NJDA 3QWDA 3RSTA 3FDUA 2J5GA 1EY3A 3ZW8A 2J5IA 1Y7OA 4QIIA 3RRVA 1WXWA 1WDKA 3NJBA 4K3WA 1FC7A 3BEZA 5DU8A 5DZKH 3N6RB 4NEKA 4U0GA 1XO6A 4JYJA 2FW2A 4GM2A 3G64A 5EUSA
chains in the Genus database with same CATH topology
2GTRA 3GMAA 3SLLA 4ELSA 3M6MA 5E0SH 3HP0A 2VSUE 3H0JA 3P2LA 4HNKA 2QQ3A 1FC6A 4L8KA 4JYLA 3MOYA 1Q52A 4IZCA 2A7KA 1N6EA 4U0GH 3TLFA 4JJTA 5C90A 5INIA 4JVTA 1XNVA 5IKLB 3HRXA 2DEOA 4OLQA 3GHFA 4FNBA 5DTWA 3P5MA 4K2NA 2C8TA 3OMEA 4ZDFA 3K8XA 3IBBA 2ZL3A 3JU1A 2A7SA 2CE3A 2ZL4A 4FJWD 3HLN1 2F9IA 1NZYA 4U19A 3STAA 5DKPA 5KDRB 4OMRA 1EF8A 2Q34A 3DJAA 2A81A 4FNDA 3QXZA 4AE2A 3KTIA 4I52A 4EMMA 4FZWA 3TVWA 3LAOA 2Q2XA 4FN8A 4NARA 3R9TA 3FF6A 1BPLA 4I4ZA 2HW5A 2UZFA 3R6HA 4Q1IA 3PZKA 3T89A 2FBMA 3L3SA 4ZDBA 3IB9A 2F6IA 2F6QA 3TV5A 1MJ3A 4MOUA 4DI1A 5FIFA 4KPKA 3R9SA 2DXLA 4AEJA 1UYTA 4JCRA 2F9IB 1NZYB 5INFA 2VSSE 1ON3A 1K32A 5DU4A 1EF9A 5E0SA 3T88A 1HZDA 1DUBA 3Q0JA 5HUQA 1UIYA 3Q0GA 5G1SA 4U1AA 4MXIA 1N6DA 1UYRA 2J5II 3T8AA 3OT6A 4G2RA 3U9SB 5FUSA 4L1CA 3MOGA 2PG8A 1N6FA 2FZSA 4NNQA 5DU6A 4B3HA 3I47A 1Q51A 4ZDDA 3ZWBA 2IEXA 2VREA 2YJGA 5G1QA 1UYVA 1OD2A 4FB8A 1YG6A 1WDMA 2J5IB 3TRRA 4JFCA 5DUCA 1J7XA 5KJPA 1RJMA 1JXZA 5JBWA 4GHNA 1TG6A 1HNOA 3WG5A 3HINA 3GF7A 1SZOA 1DCIA 1TYFA 2J5SA 3R0OA 3GF3A 2VSSA 2VSSF 2PBPA 1WZ8A 4JOTA 3PGQA 3RSIA 4K29A 3U9TB 3ISAA 2ZO9B 3M6NA 4YLHA 2F9YA 3H0SA 3IAVA 3PEAA 2DUBA 1FC9A 2WTBA 3VIVA 1XX4A 5DL1A 3Q1TA 4WCZA 3KTHA 2ZOAA 3DUPA 4F47A 4RYFH 2Q35A 4QIJA 3P85A 3QK8A 4U18A 4KD6A 4B3JA 2W3PA 3T3WA 2X24A 3MYBA 4U0HA 2VSUC 3KQFA 2NP9A 4EMPA 1W2XA 2ZQQA 4I42A 3OC7A 3LKEA 3R9QA 3KTKA 2D3TA 3D03A 5MGBA 3GLMA 1ON9A 1HNUA 3MT6A 4Z0MA 4KNPA 3ZW9A 1VRGA 4LK5A 2ZQRA 4B3IA 1WDLA 3KTGA 1PIXA 3TVUA 3H0QA 2DXNA 4ELWA 3BF0A 1PJHA 1RJNA 3GMFA 4JWVA 4Q0GA 1K39A 5KDRA 4WYOB 2PPYA 1X0UA 3H81A 1YG8A 2X58A 3ZWAA 3DORA 2BZRA 1XNWA 5CTCA 3TZ3A 4JCSA 4IZDA 4RYFA 3PE8A 4J2UA 2EJ5A 3TT7A 3ST9A 4QFEA 1SG4A 1UYSA 3ZWCA 4HDTA 4IZBA 3TDCA 3BPTA 3QYRA 3U9RB 3KTJA 4ZDEA 5INGA 4ELXA 2J5GD 3MFMA 4JSBA 4EMLA 2RRLA 4FZWC 4HC8A 5E0NX 3QMJA 3QXIA 3Q7HA 2VX2A 3GKBA 3TT6A 4ASIA 4JCQA 1O8UA 4JC0A 2ZL0A 5CTBA 4MI2A 4FN7A 5DUFA 3V5EA 3V5IA 4WZ8B 3H0UA 4JCTA 3H02A 2ZL2A 4KWBA 4ZDCA 3K50A 5DZKA 5JBXA 3SWXA 3T8BA 1XNYA 4OG1A 5G1RA 4L6WA 4RCNA 2F9YB 2VSUA 3BPPA 1FCFA 1OD4A 2VSUF 2CBYA 5DTPA 3HE2A 3QREA 3QKAA 4ZU2A 5C9GA 3NJDA 3QWDA 3RSTA 3FDUA 2J5GA 1EY3A 3ZW8A 2J5IA 1Y7OA 4QIIA 3RRVA 1WDKA 3NJBA 4K3WA 1FC7A 3BEZA 5DU8A 5DZKH 3N6RB 4NEKA 4U0GA 1XO6A 4JYJA 2FW2A 4GM2A 3G64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTR A;  3GMA A;  3SLL A;  4ELS A;  3M6M A;  5E0S H;  3HP0 A;  2VSU E;  3H0J A;  3P2L A;  4HNK A;  2QQ3 A;  1FC6 A;  4L8K A;  4JYL A;  3MOY A;  1Q52 A;  4IZC A;  2A7K A;  1N6E A;  4U0G H;  3TLF A;  4JJT A;  5C90 A;  5INI A;  4JVT A;  1XNV A;  5IKL B;  3HRX A;  2DEO A;  4OLQ A;  4FNB A;  5DTW A;  3P5M A;  4K2N A;  2C8T A;  3OME A;  4ZDF A;  3K8X A;  3IBB A;  2ZL3 A;  3JU1 A;  2A7S A;  2CE3 A;  2ZL4 A;  4FJW D;  3HLN 1;  2F9I A;  1NZY A;  4U19 A;  3STA A;  5DKP A;  5KDR B;  4OMR A;  1EF8 A;  2Q34 A;  3DJA A;  2A81 A;  4FND A;  3QXZ A;  3KTI A;  4I52 A;  4EMM A;  4FZW A;  3TVW A;  3LAO A;  2Q2X A;  4FN8 A;  3R9T A;  3FF6 A;  4I4Z A;  2HW5 A;  2UZF A;  3R6H A;  4Q1I A;  3PZK A;  3T89 A;  2FBM A;  3L3S A;  4ZDB A;  3IB9 A;  2F6I A;  2F6Q A;  3TV5 A;  1MJ3 A;  4MOU A;  4DI1 A;  5FIF A;  4KPK A;  3R9S A;  1UYT A;  4JCR A;  2F9I B;  1NZY B;  5INF A;  2VSS E;  1ON3 A;  1K32 A;  5DU4 A;  1EF9 A;  5E0S A;  3T88 A;  1HZD A;  1DUB A;  3Q0J A;  1UIY A;  3Q0G A;  5G1S A;  4U1A A;  4MXI A;  1N6D A;  1UYR A;  2J5I I;  3T8A A;  3OT6 A;  4G2R A;  3U9S B;  5FUS A;  2PG8 A;  1N6F A;  2FZS A;  4NNQ A;  5DU6 A;  4B3H A;  3I47 A;  1Q51 A;  4ZDD A;  3ZWB A;  2IEX A;  2VRE A;  5G1Q A;  1UYV A;  1OD2 A;  4FB8 A;  1YG6 A;  1WDM A;  2J5I B;  3TRR A;  4JFC A;  5DUC A;  1J7X A;  5KJP A;  1RJM A;  1JXZ A;  5JBW A;  4GHN A;  1TG6 A;  1HNO A;  3WG5 A;  3HIN A;  3GF7 A;  1SZO A;  1DCI A;  1TYF A;  2J5S A;  3R0O A;  3GF3 A;  2VSS A;  2VSS F;  2PBP A;  1WZ8 A;  4JOT A;  3PGQ A;  3RSI A;  4K29 A;  3U9T B;  3ISA A;  3M6N A;  4YLH A;  2F9Y A;  3H0S A;  3IAV A;  3PEA A;  2DUB A;  1FC9 A;  2WTB A;  3VIV A;  1XX4 A;  5DL1 A;  3Q1T A;  4WCZ A;  3KTH A;  4F47 A;  4RYF H;  2Q35 A;  4QIJ A;  3P85 A;  3QK8 A;  4U18 A;  4KD6 A;  4B3J A;  2W3P A;  3T3W A;  2X24 A;  3MYB A;  4U0H A;  2VSU C;  3KQF A;  2NP9 A;  4EMP A;  1W2X A;  2ZQQ A;  4I42 A;  3OC7 A;  3LKE A;  3R9Q A;  3KTK A;  2D3T A;  5MGB A;  3GLM A;  1ON9 A;  1HNU A;  3MT6 A;  4Z0M A;  4KNP A;  3ZW9 A;  1VRG A;  4LK5 A;  2ZQR A;  4B3I A;  1WDL A;  3KTG A;  1PIX A;  3TVU A;  3H0Q A;  4ELW A;  3BF0 A;  1PJH A;  1RJN A;  4JWV A;  4Q0G A;  1K39 A;  5KDR A;  4WYO B;  2PPY A;  1X0U A;  3H81 A;  1YG8 A;  2X58 A;  3ZWA A;  3DOR A;  2BZR A;  1XNW A;  5CTC A;  3TZ3 A;  4JCS A;  4IZD A;  4RYF A;  3PE8 A;  2EJ5 A;  3TT7 A;  3ST9 A;  4QFE A;  1SG4 A;  1UYS A;  3ZWC A;  4IZB A;  3TDC A;  3QYR A;  3U9R B;  3KTJ A;  4ZDE A;  5ING A;  4ELX A;  2J5G D;  3MFM A;  4JSB A;  4EML A;  4FZW C;  4HC8 A;  5E0N X;  3QMJ A;  3QXI A;  3Q7H A;  2VX2 A;  3GKB A;  3TT6 A;  4ASI A;  4JCQ A;  1O8U A;  2ZL0 A;  5CTB A;  4MI2 A;  4FN7 A;  5DUF A;  3V5E A;  3V5I A;  4WZ8 B;  3H0U A;  4JCT A;  3H02 A;  2ZL2 A;  4KWB A;  4ZDC A;  3K50 A;  5DZK A;  5JBX A;  3SWX A;  3T8B A;  1XNY A;  4OG1 A;  5G1R A;  4L6W A;  4RCN A;  2F9Y B;  2VSU A;  3BPP A;  1FCF A;  1OD4 A;  2VSU F;  2CBY A;  5DTP A;  3HE2 A;  3QRE A;  3QKA A;  4ZU2 A;  5C9G A;  3NJD A;  3QWD A;  3RST A;  3FDU A;  2J5G A;  1EY3 A;  3ZW8 A;  2J5I A;  1Y7O A;  4QII A;  3RRV A;  1WDK A;  3NJB A;  4K3W A;  1FC7 A;  3BEZ A;  5DU8 A;  5DZK H;  3N6R B;  4NEK A;  4U0G A;  1XO6 A;  4JYJ A;  2FW2 A;  4GM2 A;  3G64 A; 
#chains in the Genus database with same CATH topology
 2GTR A;  3GMA A;  3SLL A;  4ELS A;  2CWW A;  3M6M A;  3ZTB A;  5E0S H;  3HP0 A;  2VSU E;  3H0J A;  3P2L A;  3AGD A;  4HNK A;  2QQ3 A;  1FC6 A;  4L8K A;  4JYL A;  3MOY A;  1Q52 A;  4IZC A;  2A7K A;  1N6E A;  4U0G H;  3TLF A;  4JJT A;  5C90 A;  5INI A;  4JVT A;  1XNV A;  5IKL B;  3HRX A;  3IH8 A;  2DEO A;  4OLQ A;  1BUZ A;  3GHF A;  4FNB A;  5DTW A;  3P5M A;  4K2N A;  2C8T A;  3OME A;  4ZDF A;  3K8X A;  3IBB A;  2ZL3 A;  3JU1 A;  2A7S A;  2CE3 A;  2ZL4 A;  4FJW D;  3HLN 1;  2F9I A;  1NZY A;  4U19 A;  3STA A;  5DKP A;  5KDR B;  4OMR A;  1EF8 A;  1WXX A;  2Q34 A;  3DJA A;  3GVL A;  3IH9 A;  2A81 A;  4FND A;  3QXZ A;  4AE2 A;  3KTI A;  4I52 A;  4EMM A;  4FZW A;  3TVW A;  3LAO A;  2Q2X A;  4FN8 A;  4NAR A;  3R9T A;  1T6R A;  3FF6 A;  1BPL A;  4I4Z A;  1TIL B;  2HW5 A;  2UZF A;  3R6H A;  4Q1I A;  3PZK A;  3T89 A;  2FBM A;  3L3S A;  4ZDB A;  3IB9 A;  2F6I A;  2F6Q A;  3TV5 A;  1MJ3 A;  4MOU A;  4DI1 A;  5FIF A;  4KPK A;  3R9S A;  2DXL A;  4AEJ A;  1UYT A;  4JCR A;  2F9I B;  1NZY B;  5INF A;  2VSS E;  1ON3 A;  1K32 A;  5DU4 A;  1EF9 A;  5E0S A;  3T88 A;  1HZD A;  1DUB A;  3Q0J A;  5EUX A;  5HUQ A;  1UIY A;  3Q0G A;  5G1S A;  4U1A A;  4MXI A;  1N6D A;  1UYR A;  2J5I I;  1H4Z A;  3T8A A;  3OT6 A;  4G2R A;  3U9S B;  3QDQ A;  3LDF A;  5FUS A;  4L1C A;  3MOG A;  2PG8 A;  1N6F A;  3GVK A;  2FZS A;  4NNQ A;  5DU6 A;  4B3H A;  3V8V A;  3I47 A;  1Q51 A;  4ZDD A;  3ZWB A;  2IEX A;  2VRE A;  2YJG A;  5G1Q A;  1UYV A;  1V0F A;  1OD2 A;  3C0K A;  4FB8 A;  1TH8 B;  1H4X A;  1YG6 A;  1WDM A;  2J5I B;  3TRR A;  4JFC A;  5DUC A;  2OAS A;  1J7X A;  5KJP A;  1RJM A;  1JXZ A;  5JBW A;  4GHN A;  1TG6 A;  1HNO A;  3WG5 A;  3F43 A;  3HIN A;  3GF7 A;  1SZO A;  1DCI A;  1TYF A;  2J5S A;  3R0O A;  3GF3 A;  2VSS A;  2VSS F;  4DMG A;  2PBP A;  5EUZ A;  1WZ8 A;  4JOT A;  3PGQ A;  3RSI A;  4K29 A;  3U9T B;  3ISA A;  2ZO9 B;  3M6N A;  4YLH A;  2F9Y A;  3H0S A;  3IAV A;  3LLO A;  3IF5 A;  3PEA A;  2DUB A;  1FC9 A;  2WTB A;  3OIZ A;  3VIV A;  1AUZ A;  3LKL A;  1XX4 A;  3JU4 A;  5DL1 A;  3Q1T A;  4WCZ A;  3KTH A;  2ZOA A;  3DUP A;  4F47 A;  4RYF H;  3GVJ A;  5EZB A;  2Q35 A;  4QTP A;  4QIJ A;  3P85 A;  3QK8 A;  4U18 A;  4KD6 A;  4B3J A;  2W3P A;  3T3W A;  2X24 A;  3MYB A;  4U0H A;  3GK7 A;  2VSU C;  3KQF A;  3T6O A;  2NP9 A;  1H4Y A;  4EMP A;  1W2X A;  2ZQQ A;  4I42 A;  3OC7 A;  3LKE A;  3R9Q A;  3KTK A;  2D3T A;  3D03 A;  5MGB A;  3GLM A;  1ON9 A;  1HNU A;  3MT6 A;  4Z0M A;  4KNP A;  3IHB A;  3ZW9 A;  1VRG A;  4LK5 A;  2ZQR A;  1VC1 A;  4B3I A;  1WDL A;  3KTG A;  5EUU A;  1HF2 A;  1PIX A;  3TVU A;  2VY9 A;  3H0Q A;  2DXN A;  4ELW A;  3BF0 A;  1PJH A;  1RJN A;  3IHA A;  3D3U A;  3MGL A;  3GMF A;  4DGF A;  4JWV A;  4Q0G A;  1K39 A;  3NY7 A;  5KDR A;  4WYO B;  2PPY A;  1X0U A;  3H81 A;  1YG8 A;  1V0E A;  2X58 A;  3OIR A;  1TID B;  3ZWA A;  3DOR A;  2BZR A;  1XNW A;  1SBO A;  2B78 A;  5CTC A;  2AS0 A;  3TZ3 A;  4JCS A;  4IZD A;  3EH7 A;  3PE8 A;  4RYF A;  4J2U A;  2EJ5 A;  2KA5 A;  3TT7 A;  1THN B;  3ST9 A;  4QFE A;  1SG4 A;  1UYS A;  3ZWC A;  4HDT A;  4HIZ A;  4IZB A;  3TDC A;  3BPT A;  3QYR A;  3U9R B;  3KTJ A;  4ZDE A;  4HYL A;  5ING A;  4ELX A;  2J5G D;  3MFM A;  3ZXN A;  4JSB A;  4EML A;  2RRL A;  3V97 A;  4HC8 A;  4FZW C;  5EUW A;  3QMJ A;  4DGH A;  4XS5 A;  5E0N X;  3QXI A;  3Q7H A;  2VX2 A;  3GKB A;  3TT6 A;  4ASI A;  4JCQ A;  1O8U A;  4JC0 A;  2ZL0 A;  5CTB A;  4MI2 A;  2KLN A;  4FN7 A;  5DUF A;  3V5E A;  3V5I A;  4WZ8 B;  3H0U A;  4JCT A;  3H02 A;  2ZL2 A;  4KWB A;  4ZDC A;  3K50 A;  3AGE A;  5DZK A;  3VSE A;  5JBX A;  3SWX A;  3T8B A;  1XNY A;  4OG1 A;  5G1R A;  4L6W A;  4RCN A;  2F9Y B;  2VSU A;  3BPP A;  1FCF A;  1OD4 A;  2VSU F;  2CBY A;  5DTP A;  3HE2 A;  3QRE A;  3QKA A;  4ZU2 A;  5C9G A;  3NJD A;  3QWD A;  3RST A;  3FDU A;  2J5G A;  1EY3 A;  3ZW8 A;  2J5I A;  1Y7O A;  4QII A;  3RRV A;  1WXW A;  1WDK A;  3NJB A;  4K3W A;  1FC7 A;  3BEZ A;  5DU8 A;  5DZK H;  3N6R B;  4NEK A;  4U0G A;  1XO6 A;  4JYJ A;  2FW2 A;  4GM2 A;  3G64 A;  5EUS A; 
#chains in the Genus database with same CATH homology
 2GTR A;  3GMA A;  3SLL A;  4ELS A;  3M6M A;  5E0S H;  3HP0 A;  2VSU E;  3H0J A;  3P2L A;  4HNK A;  2QQ3 A;  1FC6 A;  4L8K A;  4JYL A;  3MOY A;  1Q52 A;  4IZC A;  2A7K A;  1N6E A;  4U0G H;  3TLF A;  4JJT A;  5C90 A;  5INI A;  4JVT A;  1XNV A;  5IKL B;  3HRX A;  2DEO A;  4OLQ A;  3GHF A;  4FNB A;  5DTW A;  3P5M A;  4K2N A;  2C8T A;  3OME A;  4ZDF A;  3K8X A;  3IBB A;  2ZL3 A;  3JU1 A;  2A7S A;  2CE3 A;  2ZL4 A;  4FJW D;  3HLN 1;  2F9I A;  1NZY A;  4U19 A;  3STA A;  5DKP A;  5KDR B;  4OMR A;  1EF8 A;  2Q34 A;  3DJA A;  2A81 A;  4FND A;  3QXZ A;  4AE2 A;  3KTI A;  4I52 A;  4EMM A;  4FZW A;  3TVW A;  3LAO A;  2Q2X A;  4FN8 A;  4NAR A;  3R9T A;  3FF6 A;  1BPL A;  4I4Z A;  2HW5 A;  2UZF A;  3R6H A;  4Q1I A;  3PZK A;  3T89 A;  2FBM A;  3L3S A;  4ZDB A;  3IB9 A;  2F6I A;  2F6Q A;  3TV5 A;  1MJ3 A;  4MOU A;  4DI1 A;  5FIF A;  4KPK A;  3R9S A;  2DXL A;  4AEJ A;  1UYT A;  4JCR A;  2F9I B;  1NZY B;  5INF A;  2VSS E;  1ON3 A;  1K32 A;  5DU4 A;  1EF9 A;  5E0S A;  3T88 A;  1HZD A;  1DUB A;  3Q0J A;  5HUQ A;  1UIY A;  3Q0G A;  5G1S A;  4U1A A;  4MXI A;  1N6D A;  1UYR A;  2J5I I;  3T8A A;  3OT6 A;  4G2R A;  3U9S B;  5FUS A;  4L1C A;  3MOG A;  2PG8 A;  1N6F A;  2FZS A;  4NNQ A;  5DU6 A;  4B3H A;  3I47 A;  1Q51 A;  4ZDD A;  3ZWB A;  2IEX A;  2VRE A;  2YJG A;  5G1Q A;  1UYV A;  1OD2 A;  4FB8 A;  1YG6 A;  1WDM A;  2J5I B;  3TRR A;  4JFC A;  5DUC A;  1J7X A;  5KJP A;  1RJM A;  1JXZ A;  5JBW A;  4GHN A;  1TG6 A;  1HNO A;  3WG5 A;  3HIN A;  3GF7 A;  1SZO A;  1DCI A;  1TYF A;  2J5S A;  3R0O A;  3GF3 A;  2VSS A;  2VSS F;  2PBP A;  1WZ8 A;  4JOT A;  3PGQ A;  3RSI A;  4K29 A;  3U9T B;  3ISA A;  2ZO9 B;  3M6N A;  4YLH A;  2F9Y A;  3H0S A;  3IAV A;  3PEA A;  2DUB A;  1FC9 A;  2WTB A;  3VIV A;  1XX4 A;  5DL1 A;  3Q1T A;  4WCZ A;  3KTH A;  2ZOA A;  3DUP A;  4F47 A;  4RYF H;  2Q35 A;  4QIJ A;  3P85 A;  3QK8 A;  4U18 A;  4KD6 A;  4B3J A;  2W3P A;  3T3W A;  2X24 A;  3MYB A;  4U0H A;  2VSU C;  3KQF A;  2NP9 A;  4EMP A;  1W2X A;  2ZQQ A;  4I42 A;  3OC7 A;  3LKE A;  3R9Q A;  3KTK A;  2D3T A;  3D03 A;  5MGB A;  3GLM A;  1ON9 A;  1HNU A;  3MT6 A;  4Z0M A;  4KNP A;  3ZW9 A;  1VRG A;  4LK5 A;  2ZQR A;  4B3I A;  1WDL A;  3KTG A;  1PIX A;  3TVU A;  3H0Q A;  2DXN A;  4ELW A;  3BF0 A;  1PJH A;  1RJN A;  3GMF A;  4JWV A;  4Q0G A;  1K39 A;  5KDR A;  4WYO B;  2PPY A;  1X0U A;  3H81 A;  1YG8 A;  2X58 A;  3ZWA A;  3DOR A;  2BZR A;  1XNW A;  5CTC A;  3TZ3 A;  4JCS A;  4IZD A;  4RYF A;  3PE8 A;  4J2U A;  2EJ5 A;  3TT7 A;  3ST9 A;  4QFE A;  1SG4 A;  1UYS A;  3ZWC A;  4HDT A;  4IZB A;  3TDC A;  3BPT A;  3QYR A;  3U9R B;  3KTJ A;  4ZDE A;  5ING A;  4ELX A;  2J5G D;  3MFM A;  4JSB A;  4EML A;  2RRL A;  4FZW C;  4HC8 A;  5E0N X;  3QMJ A;  3QXI A;  3Q7H A;  2VX2 A;  3GKB A;  3TT6 A;  4ASI A;  4JCQ A;  1O8U A;  4JC0 A;  2ZL0 A;  5CTB A;  4MI2 A;  4FN7 A;  5DUF A;  3V5E A;  3V5I A;  4WZ8 B;  3H0U A;  4JCT A;  3H02 A;  2ZL2 A;  4KWB A;  4ZDC A;  3K50 A;  5DZK A;  5JBX A;  3SWX A;  3T8B A;  1XNY A;  4OG1 A;  5G1R A;  4L6W A;  4RCN A;  2F9Y B;  2VSU A;  3BPP A;  1FCF A;  1OD4 A;  2VSU F;  2CBY A;  5DTP A;  3HE2 A;  3QRE A;  3QKA A;  4ZU2 A;  5C9G A;  3NJD A;  3QWD A;  3RST A;  3FDU A;  2J5G A;  1EY3 A;  3ZW8 A;  2J5I A;  1Y7O A;  4QII A;  3RRV A;  1WDK A;  3NJB A;  4K3W A;  1FC7 A;  3BEZ A;  5DU8 A;  5DZK H;  3N6R B;  4NEK A;  4U0G A;  1XO6 A;  4JYJ A;  2FW2 A;  4GM2 A;  3G64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...