4L8KA

Crystal structure of a putative peptidase (parmer_02772) from parabacteroides merdae atcc 43184 at 2.26 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
b'SSPRDNFEALWRIMDENYCFFAFKDVDWDDVYDRYNLLVKDTMNQYELFDILGKMLAEVKDGHTNLISSFDMSRYWAWYEDYPANFYKEIQDNYLGTDYKIAGGMKYKRLADDQIGYVYYGSFSSGVGENNLDYMFAHFKECKGLIFDVRDNGGGSMLYSDRIASRFLEERILTGYTQYKKGNGHNDFTQPNPVYLSPSDRTRWLRPVIVLTNRHSYSATNDFVNVMRLLPQVTVMGDRTGGGSGLPFSSELPNGWSVRFSACPVLDVNKQHTEFGIDPDTAVAITGEDIMKGRDTIIEAAIGLLLAKGDSAISY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative peptidase
publication title Crystal structure of a putative peptidase (PARMER_02772) from Parabacteroides merdae ATCC 43184 at 2.26 A resolution
rcsb
source organism Parabacteroides merdae
molecule tags Hydrolase
total genus 101
structure length 315
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF14684 Tricorn_C1 Tricorn protease C1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4l8kA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4l8kA02
3IB9A 3PEAA 4HC8A 4OLQA 5G1SA 1SZOA 3PE8A 3U9RB 4ZDFA 4JJTA 4B3IA 1WZ8A 3DORA 4RYFH 5DKPA 4QIIA 5E0SH 2F9YB 3H02A 4B3HA 1ON3A 2ZQQA 2ZL4A 3FF6A 4KD6A 3RSIA 3T8AA 1O8UA 3H0SA 4FNDA 2PPYA 4I52A 4OG1A 5KDRB 3LKEA 2VSUA 1J7XA 3PGQA 3SLLA 2ZL2A 3PZKA 3QREA 4JSBA 1WDLA 4ZDEA 4JOTA 5C90A 1DCIA 4Q1IA 5DZKH 4K2NA 2QQ3A 3H0QA 4FB8A 3V5EA 3QWDA 5MGBA 2F6QA 4IZDA 4ASIA 3KTJA 2A7SA 2Q35A 3TT7A 3ZWBA 3GF7A 5DUCA 3M6NA 3VIVA 3HRXA 1TYFA 1XNVA 4ELSA 4FZWA 2VSSF 3Q0GA 3H0UA 1XNYA 2Q34A 1VRGA 3GF3A 4FN7A 3HE2A 3BEZA 3TV5A 3U9TB 4JYJA 3M6MA 1NZYA 3IBBA 1K39A 2J5SA 3MT6A 2EJ5A 5DTWA 4LK5A 4FJWD 5CTBA 4U18A 2VSSE 5DL1A 2F9IA 1N6DA 4FNBA 4F47A 2NP9A 5IKLB 3NJDA 4IZBA 1UYSA 3GLMA 4U0GA 4I42A 2UZFA 1FC6A 2J5GA 3JU1A 3V5IA 3QKAA 4QIJA 1Q52A 3R9QA 4EMLA 1N6EA 4NNQA 5CTCA 5KJPA 1OD2A 3HLN1 3Q0JA 4G2RA 3KQFA 1HNOA 2HW5A 2A81A 4Z0MA 2GTRA 4L6WA 3P5MA 3BPPA 1HZDA 5JBXA 4ZDBA 4U19A 4MXIA 4DI1A 3ZW8A 1EF8A 1UYRA 3OC7A 4EMMA 4MOUA 5DUFA 1HNUA 2J5IA 1YG8A 2C8TA 4JCRA 2WTBA 1K32A 3T8BA 2VSUF 3L3SA 5DTPA 3BF0A 4FN8A 2J5II 3R9TA 1UYVA 3K8XA 3RSTA 3QXZA 4JYLA 3MFMA 4U0GH 3T3WA 2F9IB 3N6RB 4L8KA 1PJHA 5FIFA 5INFA 2VSUE 2A7KA 5KDRA 1OD4A 3KTHA 4JWVA 3QK8A 4JCSA 3QXIA 1EF9A 3Q1TA 3TVUA 3TRRA 4JCTA 4WZ8B 4ZDCA 4WYOB 1Q51A 5C9GA 1SG4A 1FCFA 3WG5A 2IEXA 4JVTA 4WCZA 2Q2XA 2PBPA 2FBMA 3TDCA 3SWXA 3OMEA 1Y7OA 2VX2A 1MJ3A 5G1QA 2J5IB 2DEOA 1XO6A 5E0NX 3TLFA 1JXZA 1WDMA 3U9SB 3ZWAA 3OT6A 3R6HA 2VSUC 4ZU2A 3P85A 2W3PA 4I4ZA 3K50A 4JFCA 4ELWA 3IAVA 3Q7HA 1UYTA 3DJAA 1PIXA 4U0HA 3MYBA 2ZQRA 3QMJA 5DU6A 2FZSA 4HNKA 4KWBA 3TZ3A 4IZCA 3TT6A 1W2XA 5INGA 1DUBA 3QYRA 3R9SA 4GM2A 2BZRA 1NZYB 4FZWC 4MI2A 1N6FA 4Q0GA 2F9YA 1YG6A 3ISAA 4YLHA 2CE3A 2ZL3A 5FUSA 2VREA 3NJBA 3ST9A 1FC7A 4RYFA 3STAA 3H0JA 4KPKA 5E0SA 4OMRA 1XNWA 2VSSA 2F6IA 1RJNA 3R0OA 2CBYA 3RRVA 3MOYA 1TG6A 4U1AA 3T89A 3P2LA 5DU4A 3ZWCA 1EY3A 3HINA 4ZDDA 2FW2A 4ELXA 3KTGA 2X58A 1RJMA 3ZW9A 1XX4A 4KNPA 3H81A 4K3WA 1ON9A 3GKBA 2PG8A 5JBWA 3GMAA 3HP0A 4JCQA 5DZKA 5INIA 3I47A 2DUBA 1FC9A 5DU8A 2X24A 2D3TA 5G1RA 3TVWA 4QFEA 2ZL0A 3T88A 1UIYA 4EMPA 1WDKA 1X0UA 4GHNA 3LAOA 2J5GD 4B3JA 3KTIA 4RCNA 3KTKA 3FDUA 4NEKA 4K29A 3G64A
chains in the Genus database with same CATH superfamily
3IB9A 3PEAA 4HC8A 4OLQA 5G1SA 1SZOA 3PE8A 3U9RB 4ZDFA 4JJTA 4B3IA 1WZ8A 3DORA 4RYFH 5DKPA 4QIIA 5E0SH 2F9YB 3H02A 4B3HA 1ON3A 2ZQQA 2ZL4A 3FF6A 4KD6A 3RSIA 2KA5A 3T8AA 1O8UA 3H0SA 4FNDA 2PPYA 4I52A 3GK7A 2VY9A 1V0FA 4OG1A 5KDRB 2AS0A 3LKEA 3T6OA 4AEJA 2VSUA 1J7XA 3PGQA 3SLLA 2ZL2A 3PZKA 3QREA 3GMFA 4JSBA 3V97A 3D03A 1WDLA 4ZDEA 3GVKA 4JOTA 5C90A 1DCIA 4Q1IA 5DZKH 4K2NA 4DGHA 2QQ3A 3H0QA 4FB8A 3V5EA 3QWDA 5MGBA 2F6QA 4IZDA 4ASIA 3KTJA 2A7SA 2Q35A 3TT7A 3ZWBA 2RRLA 3GF7A 3M6NA 5DUCA 3VIVA 3HRXA 1TYFA 1HF2A 3LLOA 3GVJA 1XNVA 4ELSA 4FZWA 1SBOA 2VSSF 3Q0GA 3H0UA 3C0KA 3MOGA 1XNYA 1TH8B 2Q34A 1VRGA 3GF3A 4FN7A 3HE2A 3BEZA 3TV5A 3U9TB 4JYJA 5EUSA 4JC0A 4DGFA 3M6MA 1NZYA 1TILB 5EUXA 1WXXA 3IBBA 1K39A 2J5SA 1H4ZA 3MT6A 2EJ5A 5DTWA 5EZBA 4LK5A 4FJWD 5CTBA 1H4YA 4U18A 2VSSE 5DL1A 2F9IA 1N6DA 4FNBA 4F47A 2NP9A 5IKLB 3NJDA 4IZBA 1UYSA 3GLMA 4U0GA 4I42A 2UZFA 1FC6A 2J5GA 3IF5A 3JU1A 3V5IA 3QKAA 4QIJA 1Q52A 3R9QA 4EMLA 1N6EA 4NNQA 5CTCA 5KJPA 3AGDA 1OD2A 3HLN1 3Q0JA 4G2RA 3KQFA 1HNOA 2HW5A 2A81A 4Z0MA 2GTRA 4L6WA 3P5MA 3ZXNA 3BPPA 1HZDA 3VSEA 3V8VA 1AUZA 5JBXA 4ZDBA 4U19A 4MXIA 4HIZA 4DI1A 3ZW8A 1EF8A 1UYRA 3OC7A 4EMMA 4MOUA 5DUFA 1HNUA 2J5IA 1YG8A 2C8TA 4DMGA 3NY7A 4JCRA 2WTBA 1K32A 3T8BA 2VSUF 3L3SA 5DTPA 3BF0A 4FN8A 2J5II 3R9TA 1UYVA 1THNB 2DXNA 3K8XA 3RSTA 3EH7A 1V0EA 3QXZA 3QDQA 4JYLA 3MFMA 1T6RA 4U0GH 3T3WA 2F9IB 3N6RB 4L8KA 1PJHA 5FIFA 5INFA 2VSUE 2A7KA 5KDRA 1OD4A 3D3UA 3LKLA 3KTHA 3GVLA 4JWVA 3QK8A 4JCSA 3QXIA 1EF9A 3Q1TA 3TVUA 3TRRA 4JCTA 2CWWA 4WZ8B 3DUPA 4ZDCA 4WYOB 1Q51A 4HYLA 5HUQA 5C9GA 1SG4A 1FCFA 3WG5A 2IEXA 4JVTA 4XS5A 4WCZA 2Q2XA 2PBPA 2FBMA 3TDCA 1WXWA 3SWXA 3LDFA 3OMEA 1BUZA 1Y7OA 5EUZA 2VX2A 1MJ3A 5G1QA 1TIDB 2J5IB 2DEOA 1XO6A 5E0NX 3TLFA 2YJGA 1JXZA 1WDMA 3U9SB 3ZWAA 3OT6A 3R6HA 2VSUC 2B78A 4AE2A 4ZU2A 3JU4A 3P85A 5EUWA 2W3PA 4I4ZA 4HDTA 3K50A 4JFCA 4ELWA 2DXLA 3IAVA 3Q7HA 1UYTA 3DJAA 1PIXA 5EUUA 4U0HA 1BPLA 4J2UA 3IH8A 3MYBA 2ZQRA 1VC1A 3QMJA 5DU6A 2FZSA 4HNKA 4KWBA 3TZ3A 4IZCA 3TT6A 1W2XA 5INGA 2ZOAA 1DUBA 3QYRA 3R9SA 3OIZA 4GM2A 2BZRA 1NZYB 4FZWC 3BPTA 4MI2A 1N6FA 4Q0GA 2F9YA 1YG6A 3ISAA 4YLHA 2CE3A 2ZL3A 5FUSA 3OIRA 2VREA 3NJBA 3ST9A 1FC7A 4RYFA 3STAA 3H0JA 4KPKA 5E0SA 4OMRA 1XNWA 2VSSA 2F6IA 1RJNA 3R0OA 2CBYA 3RRVA 3MOYA 1TG6A 3IHBA 4QTPA 4U1AA 3MGLA 3AGEA 3T89A 3P2LA 2OASA 3GHFA 5DU4A 3ZWCA 1EY3A 3HINA 4ZDDA 2FW2A 4ELXA 3KTGA 2X58A 1RJMA 3ZW9A 1XX4A 4KNPA 4NARA 3H81A 4K3WA 1ON9A 3GKBA 2PG8A 5JBWA 3GMAA 3HP0A 4JCQA 5DZKA 5INIA 3I47A 2DUBA 1FC9A 5DU8A 2X24A 2D3TA 5G1RA 3TVWA 4QFEA 2ZL0A 3T88A 1UIYA 4EMPA 1WDKA 1X0UA 3IH9A 4GHNA 3LAOA 3F43A 1H4XA 4L1CA 2J5GD 4B3JA 3KTIA 4RCNA 2KLNA 2ZO9B 3KTKA 3FDUA 3ZTBA 4NEKA 4K29A 3G64A 3IHAA
chains in the Genus database with same CATH topology
3IB9A 3PEAA 4HC8A 4OLQA 5G1SA 1SZOA 3PE8A 3U9RB 4ZDFA 4JJTA 4B3IA 1WZ8A 3DORA 4RYFH 5DKPA 4QIIA 5E0SH 2F9YB 3H02A 4B3HA 1ON3A 2ZQQA 2ZL4A 3FF6A 4KD6A 3RSIA 3T8AA 1O8UA 3H0SA 4FNDA 2PPYA 4I52A 4OG1A 5KDRB 3LKEA 4AEJA 2VSUA 1J7XA 3PGQA 3SLLA 2ZL2A 3PZKA 3QREA 3GMFA 4JSBA 3D03A 1WDLA 4ZDEA 4JOTA 5C90A 1DCIA 4Q1IA 5DZKH 4K2NA 2QQ3A 3H0QA 4FB8A 3V5EA 3QWDA 5MGBA 2F6QA 4IZDA 4ASIA 3KTJA 2A7SA 2Q35A 3TT7A 3ZWBA 2RRLA 5DUCA 3GF7A 3M6NA 3VIVA 3HRXA 1TYFA 1XNVA 4ELSA 4FZWA 2VSSF 3Q0GA 3H0UA 3MOGA 1XNYA 2Q34A 1VRGA 3GF3A 4FN7A 3HE2A 3BEZA 3TV5A 3U9TB 4JYJA 4JC0A 3M6MA 1NZYA 3IBBA 1K39A 2J5SA 3MT6A 2EJ5A 5DTWA 4LK5A 4FJWD 5CTBA 4U18A 2VSSE 5DL1A 2F9IA 1N6DA 4FNBA 4F47A 2NP9A 5IKLB 3NJDA 4IZBA 1UYSA 3GLMA 4U0GA 4I42A 2UZFA 1FC6A 2J5GA 3JU1A 3V5IA 3QKAA 4QIJA 1Q52A 3R9QA 4EMLA 1N6EA 4NNQA 5CTCA 5KJPA 1OD2A 3HLN1 3Q0JA 4G2RA 3KQFA 1HNOA 2HW5A 2A81A 4Z0MA 2GTRA 4L6WA 3P5MA 3BPPA 1HZDA 5JBXA 4ZDBA 4U19A 4MXIA 4DI1A 3ZW8A 1EF8A 1UYRA 3OC7A 4EMMA 4MOUA 5DUFA 1HNUA 2J5IA 1YG8A 2C8TA 4JCRA 2WTBA 1K32A 3T8BA 2VSUF 3L3SA 5DTPA 3BF0A 4FN8A 2J5II 3R9TA 1UYVA 3K8XA 2DXNA 3RSTA 3QXZA 4JYLA 3MFMA 4U0GH 3T3WA 2F9IB 3N6RB 4L8KA 1PJHA 5FIFA 5INFA 2VSUE 2A7KA 5KDRA 1OD4A 3KTHA 4JWVA 3QK8A 4JCSA 3QXIA 1EF9A 3Q1TA 3TVUA 3TRRA 4JCTA 4WZ8B 3DUPA 4ZDCA 4WYOB 1Q51A 5HUQA 5C9GA 1SG4A 1FCFA 3WG5A 2IEXA 4JVTA 4WCZA 2Q2XA 2PBPA 2FBMA 3TDCA 3SWXA 3OMEA 1Y7OA 2VX2A 1MJ3A 5G1QA 2J5IB 2DEOA 1XO6A 5E0NX 3TLFA 2YJGA 1JXZA 1WDMA 3U9SB 3ZWAA 3OT6A 3R6HA 2VSUC 4AE2A 4ZU2A 3P85A 2W3PA 4I4ZA 4HDTA 3K50A 4JFCA 4ELWA 2DXLA 3IAVA 3Q7HA 1UYTA 3DJAA 1PIXA 4U0HA 1BPLA 4J2UA 3MYBA 2ZQRA 3QMJA 5DU6A 2FZSA 4HNKA 4KWBA 3TZ3A 4IZCA 3TT6A 1W2XA 5INGA 2ZOAA 1DUBA 3QYRA 3R9SA 4GM2A 2BZRA 1NZYB 4FZWC 3BPTA 4MI2A 1N6FA 4Q0GA 2F9YA 1YG6A 3ISAA 4YLHA 2CE3A 2ZL3A 5FUSA 2VREA 3NJBA 3ST9A 1FC7A 4RYFA 3STAA 3H0JA 4KPKA 5E0SA 4OMRA 1XNWA 2VSSA 2F6IA 1RJNA 3R0OA 2CBYA 3RRVA 3MOYA 1TG6A 4U1AA 3T89A 3P2LA 3GHFA 5DU4A 3ZWCA 1EY3A 3HINA 4ZDDA 2FW2A 4ELXA 3KTGA 2X58A 1RJMA 3ZW9A 1XX4A 4KNPA 4NARA 3H81A 4K3WA 1ON9A 3GKBA 2PG8A 5JBWA 3GMAA 3HP0A 4JCQA 5DZKA 5INIA 3I47A 2DUBA 1FC9A 5DU8A 2X24A 2D3TA 5G1RA 3TVWA 4QFEA 2ZL0A 3T88A 1UIYA 4EMPA 1WDKA 1X0UA 4GHNA 3LAOA 4L1CA 2J5GD 4B3JA 3KTIA 4RCNA 2ZO9B 3KTKA 3FDUA 4NEKA 4K29A 3G64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IB9 A;  3PEA A;  4HC8 A;  4OLQ A;  5G1S A;  1SZO A;  3PE8 A;  3U9R B;  4ZDF A;  4JJT A;  4B3I A;  1WZ8 A;  3DOR A;  4RYF H;  5DKP A;  4QII A;  5E0S H;  2F9Y B;  3H02 A;  4B3H A;  1ON3 A;  2ZQQ A;  2ZL4 A;  3FF6 A;  4KD6 A;  3RSI A;  3T8A A;  1O8U A;  3H0S A;  4FND A;  2PPY A;  4I52 A;  4OG1 A;  5KDR B;  3LKE A;  2VSU A;  1J7X A;  3PGQ A;  3SLL A;  2ZL2 A;  3PZK A;  3QRE A;  4JSB A;  1WDL A;  4ZDE A;  4JOT A;  5C90 A;  1DCI A;  4Q1I A;  5DZK H;  4K2N A;  2QQ3 A;  3H0Q A;  4FB8 A;  3V5E A;  3QWD A;  5MGB A;  2F6Q A;  4IZD A;  4ASI A;  3KTJ A;  2A7S A;  2Q35 A;  3TT7 A;  3ZWB A;  3GF7 A;  5DUC A;  3M6N A;  3VIV A;  3HRX A;  1TYF A;  1XNV A;  4ELS A;  4FZW A;  2VSS F;  3Q0G A;  3H0U A;  1XNY A;  2Q34 A;  1VRG A;  3GF3 A;  4FN7 A;  3HE2 A;  3BEZ A;  3TV5 A;  3U9T B;  4JYJ A;  3M6M A;  1NZY A;  3IBB A;  1K39 A;  2J5S A;  3MT6 A;  2EJ5 A;  5DTW A;  4LK5 A;  4FJW D;  5CTB A;  4U18 A;  2VSS E;  5DL1 A;  2F9I A;  1N6D A;  4FNB A;  4F47 A;  2NP9 A;  5IKL B;  3NJD A;  4IZB A;  1UYS A;  3GLM A;  4U0G A;  4I42 A;  2UZF A;  1FC6 A;  2J5G A;  3JU1 A;  3V5I A;  3QKA A;  4QIJ A;  1Q52 A;  3R9Q A;  4EML A;  1N6E A;  4NNQ A;  5CTC A;  5KJP A;  1OD2 A;  3HLN 1;  3Q0J A;  4G2R A;  3KQF A;  1HNO A;  2HW5 A;  2A81 A;  4Z0M A;  2GTR A;  4L6W A;  3P5M A;  3BPP A;  1HZD A;  5JBX A;  4ZDB A;  4U19 A;  4MXI A;  4DI1 A;  3ZW8 A;  1EF8 A;  1UYR A;  3OC7 A;  4EMM A;  4MOU A;  5DUF A;  1HNU A;  2J5I A;  1YG8 A;  2C8T A;  4JCR A;  2WTB A;  1K32 A;  3T8B A;  2VSU F;  3L3S A;  5DTP A;  3BF0 A;  4FN8 A;  2J5I I;  3R9T A;  1UYV A;  3K8X A;  3RST A;  3QXZ A;  4JYL A;  3MFM A;  4U0G H;  3T3W A;  2F9I B;  3N6R B;  4L8K A;  1PJH A;  5FIF A;  5INF A;  2VSU E;  2A7K A;  5KDR A;  1OD4 A;  3KTH A;  4JWV A;  3QK8 A;  4JCS A;  3QXI A;  1EF9 A;  3Q1T A;  3TVU A;  3TRR A;  4JCT A;  4WZ8 B;  4ZDC A;  4WYO B;  1Q51 A;  5C9G A;  1SG4 A;  1FCF A;  3WG5 A;  2IEX A;  4JVT A;  4WCZ A;  2Q2X A;  2PBP A;  2FBM A;  3TDC A;  3SWX A;  3OME A;  1Y7O A;  2VX2 A;  1MJ3 A;  5G1Q A;  2J5I B;  2DEO A;  1XO6 A;  5E0N X;  3TLF A;  1JXZ A;  1WDM A;  3U9S B;  3ZWA A;  3OT6 A;  3R6H A;  2VSU C;  4ZU2 A;  3P85 A;  2W3P A;  4I4Z A;  3K50 A;  4JFC A;  4ELW A;  3IAV A;  3Q7H A;  1UYT A;  3DJA A;  1PIX A;  4U0H A;  3MYB A;  2ZQR A;  3QMJ A;  5DU6 A;  2FZS A;  4HNK A;  4KWB A;  3TZ3 A;  4IZC A;  3TT6 A;  1W2X A;  5ING A;  1DUB A;  3QYR A;  3R9S A;  4GM2 A;  2BZR A;  1NZY B;  4FZW C;  4MI2 A;  1N6F A;  4Q0G A;  2F9Y A;  1YG6 A;  3ISA A;  4YLH A;  2CE3 A;  2ZL3 A;  5FUS A;  2VRE A;  3NJB A;  3ST9 A;  1FC7 A;  4RYF A;  3STA A;  3H0J A;  4KPK A;  5E0S A;  4OMR A;  1XNW A;  2VSS A;  2F6I A;  1RJN A;  3R0O A;  2CBY A;  3RRV A;  3MOY A;  1TG6 A;  4U1A A;  3T89 A;  3P2L A;  5DU4 A;  3ZWC A;  1EY3 A;  3HIN A;  4ZDD A;  2FW2 A;  4ELX A;  3KTG A;  2X58 A;  1RJM A;  3ZW9 A;  1XX4 A;  4KNP A;  3H81 A;  4K3W A;  1ON9 A;  3GKB A;  2PG8 A;  5JBW A;  3GMA A;  3HP0 A;  4JCQ A;  5DZK A;  5INI A;  3I47 A;  2DUB A;  1FC9 A;  5DU8 A;  2X24 A;  2D3T A;  5G1R A;  3TVW A;  4QFE A;  2ZL0 A;  3T88 A;  1UIY A;  4EMP A;  1WDK A;  1X0U A;  4GHN A;  3LAO A;  2J5G D;  4B3J A;  3KTI A;  4RCN A;  3KTK A;  3FDU A;  4NEK A;  4K29 A;  3G64 A; 
#chains in the Genus database with same CATH topology
 3IB9 A;  3PEA A;  4HC8 A;  4OLQ A;  5G1S A;  1SZO A;  3PE8 A;  3U9R B;  4ZDF A;  4JJT A;  4B3I A;  1WZ8 A;  3DOR A;  4RYF H;  5DKP A;  4QII A;  5E0S H;  2F9Y B;  3H02 A;  4B3H A;  1ON3 A;  2ZQQ A;  2ZL4 A;  3FF6 A;  4KD6 A;  3RSI A;  2KA5 A;  3T8A A;  1O8U A;  3H0S A;  4FND A;  2PPY A;  4I52 A;  3GK7 A;  2VY9 A;  1V0F A;  4OG1 A;  5KDR B;  2AS0 A;  3LKE A;  3T6O A;  4AEJ A;  2VSU A;  1J7X A;  3PGQ A;  3SLL A;  2ZL2 A;  3PZK A;  3QRE A;  3GMF A;  4JSB A;  3V97 A;  3D03 A;  1WDL A;  4ZDE A;  3GVK A;  4JOT A;  5C90 A;  1DCI A;  4Q1I A;  5DZK H;  4K2N A;  4DGH A;  2QQ3 A;  3H0Q A;  4FB8 A;  3V5E A;  3QWD A;  5MGB A;  2F6Q A;  4IZD A;  4ASI A;  3KTJ A;  2A7S A;  2Q35 A;  3TT7 A;  3ZWB A;  2RRL A;  3GF7 A;  3M6N A;  5DUC A;  3VIV A;  3HRX A;  1TYF A;  1HF2 A;  3LLO A;  3GVJ A;  1XNV A;  4ELS A;  4FZW A;  1SBO A;  2VSS F;  3Q0G A;  3H0U A;  3C0K A;  3MOG A;  1XNY A;  1TH8 B;  2Q34 A;  1VRG A;  3GF3 A;  4FN7 A;  3HE2 A;  3BEZ A;  3TV5 A;  3U9T B;  4JYJ A;  5EUS A;  4JC0 A;  4DGF A;  3M6M A;  1NZY A;  1TIL B;  5EUX A;  1WXX A;  3IBB A;  1K39 A;  2J5S A;  1H4Z A;  3MT6 A;  2EJ5 A;  5DTW A;  5EZB A;  4LK5 A;  4FJW D;  5CTB A;  1H4Y A;  4U18 A;  2VSS E;  5DL1 A;  2F9I A;  1N6D A;  4FNB A;  4F47 A;  2NP9 A;  5IKL B;  3NJD A;  4IZB A;  1UYS A;  3GLM A;  4U0G A;  4I42 A;  2UZF A;  1FC6 A;  2J5G A;  3IF5 A;  3JU1 A;  3V5I A;  3QKA A;  4QIJ A;  1Q52 A;  3R9Q A;  4EML A;  1N6E A;  4NNQ A;  5CTC A;  5KJP A;  3AGD A;  1OD2 A;  3HLN 1;  3Q0J A;  4G2R A;  3KQF A;  1HNO A;  2HW5 A;  2A81 A;  4Z0M A;  2GTR A;  4L6W A;  3P5M A;  3ZXN A;  3BPP A;  1HZD A;  3VSE A;  3V8V A;  1AUZ A;  5JBX A;  4ZDB A;  4U19 A;  4MXI A;  4HIZ A;  4DI1 A;  3ZW8 A;  1EF8 A;  1UYR A;  3OC7 A;  4EMM A;  4MOU A;  5DUF A;  1HNU A;  2J5I A;  1YG8 A;  2C8T A;  4DMG A;  3NY7 A;  4JCR A;  2WTB A;  1K32 A;  3T8B A;  2VSU F;  3L3S A;  5DTP A;  3BF0 A;  4FN8 A;  2J5I I;  3R9T A;  1UYV A;  1THN B;  2DXN A;  3K8X A;  3RST A;  3EH7 A;  1V0E A;  3QXZ A;  3QDQ A;  4JYL A;  3MFM A;  1T6R A;  4U0G H;  3T3W A;  2F9I B;  3N6R B;  4L8K A;  1PJH A;  5FIF A;  5INF A;  2VSU E;  2A7K A;  5KDR A;  1OD4 A;  3D3U A;  3LKL A;  3KTH A;  3GVL A;  4JWV A;  3QK8 A;  4JCS A;  3QXI A;  1EF9 A;  3Q1T A;  3TVU A;  3TRR A;  4JCT A;  2CWW A;  4WZ8 B;  3DUP A;  4ZDC A;  4WYO B;  1Q51 A;  4HYL A;  5HUQ A;  5C9G A;  1SG4 A;  1FCF A;  3WG5 A;  2IEX A;  4JVT A;  4XS5 A;  4WCZ A;  2Q2X A;  2PBP A;  2FBM A;  3TDC A;  1WXW A;  3SWX A;  3LDF A;  3OME A;  1BUZ A;  1Y7O A;  5EUZ A;  2VX2 A;  1MJ3 A;  5G1Q A;  1TID B;  2J5I B;  2DEO A;  1XO6 A;  5E0N X;  3TLF A;  2YJG A;  1JXZ A;  1WDM A;  3U9S B;  3ZWA A;  3OT6 A;  3R6H A;  2VSU C;  2B78 A;  4AE2 A;  4ZU2 A;  3JU4 A;  3P85 A;  5EUW A;  2W3P A;  4I4Z A;  4HDT A;  3K50 A;  4JFC A;  4ELW A;  2DXL A;  3IAV A;  3Q7H A;  1UYT A;  3DJA A;  1PIX A;  5EUU A;  4U0H A;  1BPL A;  4J2U A;  3IH8 A;  3MYB A;  2ZQR A;  1VC1 A;  3QMJ A;  5DU6 A;  2FZS A;  4HNK A;  4KWB A;  3TZ3 A;  4IZC A;  3TT6 A;  1W2X A;  5ING A;  2ZOA A;  1DUB A;  3QYR A;  3R9S A;  3OIZ A;  4GM2 A;  2BZR A;  1NZY B;  4FZW C;  3BPT A;  4MI2 A;  1N6F A;  4Q0G A;  2F9Y A;  1YG6 A;  3ISA A;  4YLH A;  2CE3 A;  2ZL3 A;  5FUS A;  3OIR A;  2VRE A;  3NJB A;  3ST9 A;  1FC7 A;  4RYF A;  3STA A;  3H0J A;  4KPK A;  5E0S A;  4OMR A;  1XNW A;  2VSS A;  2F6I A;  1RJN A;  3R0O A;  2CBY A;  3RRV A;  3MOY A;  1TG6 A;  3IHB A;  4QTP A;  4U1A A;  3MGL A;  3AGE A;  3T89 A;  3P2L A;  2OAS A;  3GHF A;  5DU4 A;  3ZWC A;  1EY3 A;  3HIN A;  4ZDD A;  2FW2 A;  4ELX A;  3KTG A;  2X58 A;  1RJM A;  3ZW9 A;  1XX4 A;  4KNP A;  4NAR A;  3H81 A;  4K3W A;  1ON9 A;  3GKB A;  2PG8 A;  5JBW A;  3GMA A;  3HP0 A;  4JCQ A;  5DZK A;  5INI A;  3I47 A;  2DUB A;  1FC9 A;  5DU8 A;  2X24 A;  2D3T A;  5G1R A;  3TVW A;  4QFE A;  2ZL0 A;  3T88 A;  1UIY A;  4EMP A;  1WDK A;  1X0U A;  3IH9 A;  4GHN A;  3LAO A;  3F43 A;  1H4X A;  4L1C A;  2J5G D;  4B3J A;  3KTI A;  4RCN A;  2KLN A;  2ZO9 B;  3KTK A;  3FDU A;  3ZTB A;  4NEK A;  4K29 A;  3G64 A;  3IHA A; 
#chains in the Genus database with same CATH homology
 3IB9 A;  3PEA A;  4HC8 A;  4OLQ A;  5G1S A;  1SZO A;  3PE8 A;  3U9R B;  4ZDF A;  4JJT A;  4B3I A;  1WZ8 A;  3DOR A;  4RYF H;  5DKP A;  4QII A;  5E0S H;  2F9Y B;  3H02 A;  4B3H A;  1ON3 A;  2ZQQ A;  2ZL4 A;  3FF6 A;  4KD6 A;  3RSI A;  3T8A A;  1O8U A;  3H0S A;  4FND A;  2PPY A;  4I52 A;  4OG1 A;  5KDR B;  3LKE A;  4AEJ A;  2VSU A;  1J7X A;  3PGQ A;  3SLL A;  2ZL2 A;  3PZK A;  3QRE A;  3GMF A;  4JSB A;  3D03 A;  1WDL A;  4ZDE A;  4JOT A;  5C90 A;  1DCI A;  4Q1I A;  5DZK H;  4K2N A;  2QQ3 A;  3H0Q A;  4FB8 A;  3V5E A;  3QWD A;  5MGB A;  2F6Q A;  4IZD A;  4ASI A;  3KTJ A;  2A7S A;  2Q35 A;  3TT7 A;  3ZWB A;  2RRL A;  5DUC A;  3GF7 A;  3M6N A;  3VIV A;  3HRX A;  1TYF A;  1XNV A;  4ELS A;  4FZW A;  2VSS F;  3Q0G A;  3H0U A;  3MOG A;  1XNY A;  2Q34 A;  1VRG A;  3GF3 A;  4FN7 A;  3HE2 A;  3BEZ A;  3TV5 A;  3U9T B;  4JYJ A;  4JC0 A;  3M6M A;  1NZY A;  3IBB A;  1K39 A;  2J5S A;  3MT6 A;  2EJ5 A;  5DTW A;  4LK5 A;  4FJW D;  5CTB A;  4U18 A;  2VSS E;  5DL1 A;  2F9I A;  1N6D A;  4FNB A;  4F47 A;  2NP9 A;  5IKL B;  3NJD A;  4IZB A;  1UYS A;  3GLM A;  4U0G A;  4I42 A;  2UZF A;  1FC6 A;  2J5G A;  3JU1 A;  3V5I A;  3QKA A;  4QIJ A;  1Q52 A;  3R9Q A;  4EML A;  1N6E A;  4NNQ A;  5CTC A;  5KJP A;  1OD2 A;  3HLN 1;  3Q0J A;  4G2R A;  3KQF A;  1HNO A;  2HW5 A;  2A81 A;  4Z0M A;  2GTR A;  4L6W A;  3P5M A;  3BPP A;  1HZD A;  5JBX A;  4ZDB A;  4U19 A;  4MXI A;  4DI1 A;  3ZW8 A;  1EF8 A;  1UYR A;  3OC7 A;  4EMM A;  4MOU A;  5DUF A;  1HNU A;  2J5I A;  1YG8 A;  2C8T A;  4JCR A;  2WTB A;  1K32 A;  3T8B A;  2VSU F;  3L3S A;  5DTP A;  3BF0 A;  4FN8 A;  2J5I I;  3R9T A;  1UYV A;  3K8X A;  2DXN A;  3RST A;  3QXZ A;  4JYL A;  3MFM A;  4U0G H;  3T3W A;  2F9I B;  3N6R B;  4L8K A;  1PJH A;  5FIF A;  5INF A;  2VSU E;  2A7K A;  5KDR A;  1OD4 A;  3KTH A;  4JWV A;  3QK8 A;  4JCS A;  3QXI A;  1EF9 A;  3Q1T A;  3TVU A;  3TRR A;  4JCT A;  4WZ8 B;  3DUP A;  4ZDC A;  4WYO B;  1Q51 A;  5HUQ A;  5C9G A;  1SG4 A;  1FCF A;  3WG5 A;  2IEX A;  4JVT A;  4WCZ A;  2Q2X A;  2PBP A;  2FBM A;  3TDC A;  3SWX A;  3OME A;  1Y7O A;  2VX2 A;  1MJ3 A;  5G1Q A;  2J5I B;  2DEO A;  1XO6 A;  5E0N X;  3TLF A;  2YJG A;  1JXZ A;  1WDM A;  3U9S B;  3ZWA A;  3OT6 A;  3R6H A;  2VSU C;  4AE2 A;  4ZU2 A;  3P85 A;  2W3P A;  4I4Z A;  4HDT A;  3K50 A;  4JFC A;  4ELW A;  2DXL A;  3IAV A;  3Q7H A;  1UYT A;  3DJA A;  1PIX A;  4U0H A;  1BPL A;  4J2U A;  3MYB A;  2ZQR A;  3QMJ A;  5DU6 A;  2FZS A;  4HNK A;  4KWB A;  3TZ3 A;  4IZC A;  3TT6 A;  1W2X A;  5ING A;  2ZOA A;  1DUB A;  3QYR A;  3R9S A;  4GM2 A;  2BZR A;  1NZY B;  4FZW C;  3BPT A;  4MI2 A;  1N6F A;  4Q0G A;  2F9Y A;  1YG6 A;  3ISA A;  4YLH A;  2CE3 A;  2ZL3 A;  5FUS A;  2VRE A;  3NJB A;  3ST9 A;  1FC7 A;  4RYF A;  3STA A;  3H0J A;  4KPK A;  5E0S A;  4OMR A;  1XNW A;  2VSS A;  2F6I A;  1RJN A;  3R0O A;  2CBY A;  3RRV A;  3MOY A;  1TG6 A;  4U1A A;  3T89 A;  3P2L A;  3GHF A;  5DU4 A;  3ZWC A;  1EY3 A;  3HIN A;  4ZDD A;  2FW2 A;  4ELX A;  3KTG A;  2X58 A;  1RJM A;  3ZW9 A;  1XX4 A;  4KNP A;  4NAR A;  3H81 A;  4K3W A;  1ON9 A;  3GKB A;  2PG8 A;  5JBW A;  3GMA A;  3HP0 A;  4JCQ A;  5DZK A;  5INI A;  3I47 A;  2DUB A;  1FC9 A;  5DU8 A;  2X24 A;  2D3T A;  5G1R A;  3TVW A;  4QFE A;  2ZL0 A;  3T88 A;  1UIY A;  4EMP A;  1WDK A;  1X0U A;  4GHN A;  3LAO A;  4L1C A;  2J5G D;  4B3J A;  3KTI A;  4RCN A;  2ZO9 B;  3KTK A;  3FDU A;  4NEK A;  4K29 A;  3G64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...