4L8KA

Crystal structure of a putative peptidase (parmer_02772) from parabacteroides merdae atcc 43184 at 2.26 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
SSPRDNFEALWRIMDENYCFFAFKDVDWDDVYDRYNLLVKDTMNQYELFDILGKMLAEVKDGHTNLISSFDMSRYWAWYEDYPANFYKEIQDNYLGTDYKIAGGMKYKRLADDQIGYVYYGSFSSGVGENNLDYMFAHFKECKGLIFDVRDNGGGSMLYSDRIASRFLEERILTGYTQYKKGNGHNDFTQPNPVYLSPSDRTRWLRPVIVLTNRHSYSATNDFVNVMRLLPQVTVMGDRTGGGSGLPFSSELPNGWSVRFSACPVLDVNKQHTEFGIDPDTAVAITGEDIMKGRDTIIEAAIGLLLAKGDSAISY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords putative peptidase
publication title Crystal structure of a putative peptidase (PARMER_02772) from Parabacteroides merdae ATCC 43184 at 2.26 A resolution
rcsb
source organism Parabacteroides merdae
total genus 101
structure length 315
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF14684 Tricorn_C1 Tricorn protease C1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4l8kA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4l8kA02
4JOTA 3JU1A 1XNWA 4FZWA 3BPPA 3KTGA 4LK5A 3FDUA 5KDRA 4KD6A 5G1SA 3GMAA 3T8AA 3Q0GA 5JBWA 4FNBA 4KNPA 5JBXA 2WTBA 4K2NA 3K50A 1XX4A 2D3TA 3V5IA 1YG6A 3V5EA 3GLMA 2F6QA 4FN7A 3LKEA 2QQ3A 5FUSA 4EMLA 1K39A 3H02A 3QKAA 3RSIA 3TRRA 4U19A 1PIXA 1X0UA 3N6RB 2A7SA 2F9YA 3U9SB 4KPKA 4GHNA 3H0QA 3R9SA 2VSUC 4RCNA 5DUCA 2ZL2A 4L6WA 1WDMA 3VIVA 4EMPA 1EF9A 3TT6A 4EMMA 4JJTA 4U1AA 2VSUA 4ZDBA 2VSSA 4MOUA 4JYLA 1N6EA 2Q35A 4HNKA 4U18A 1RJMA 5IKLB 4ZDCA 3RSTA 3P85A 2W3PA 2FW2A 3Q1TA 1OD2A 4B3IA 1UYRA 4JFCA 4JCTA 2F9IA 1EF8A 4JVTA 3OC7A 1ON9A 3QWDA 2J5IA 3IAVA 4I52A 1FC7A 4I4ZA 1Q51A 4ZDFA 5E0SH 5KJPA 1HZDA 3GF3A 5KDRB 4JWVA 3HE2A 3M6MA 2ZL3A 4ZDDA 2BZRA 4JYJA 3PGQA 4G2RA 4WZ8B 3SWXA 3I47A 4QIIA 2CBYA 2HW5A 5CTCA 1DUBA 3Q7HA 1WDLA 2UZFA 3NJBA 4KWBA 2Q2XA 3ISAA 3R9TA 3QXZA 2F9YB 1J7XA 4JCSA 4Q1IA 4JSBA 4K29A 2A7KA 2CE3A 4U0GA 4JCQA 3ZW8A 1K32A 1UYTA 4OG1A 4U0GH 5DU6A 1OD4A 4B3JA 4I42A 1W2XA 1SZOA 5INFA 1SG4A 3MT6A 3MOYA 4RYFH 4FN8A 3ZWBA 2J5SA 4MI2A 4ASIA 2ZQRA 3IB9A 3ZW9A 4IZBA 3KTJA 4U0HA 3U9RB 3T3WA 1UYSA 3RRVA 1O8UA 3MFMA 5C9GA 4ELXA 3T88A 5DU4A 4ZU2A 2IEXA 3H81A 3ST9A 3TDCA 1XO6A 3HRXA 2FZSA 2F9IB 5G1QA 1WZ8A 4IZCA 4L8KA 5FIFA 2A81A 3SLLA 3Q0JA 2ZQQA 4QIJA 2ZL4A 1MJ3A 4OLQA 2ZL0A 2DEOA 2J5GD 3IBBA 5E0SA 2GTRA 3M6NA 3NJDA 2J5GA 3TVUA 2NP9A 2X58A 5DKPA 3T89A 3U9TB 4ZDEA 3ZWAA 3QK8A 4QFEA 4GM2A 3TLFA 3DORA 3H0UA 4WYOB 3H0JA 3T8BA 2VSSE 5DTPA 4B3HA 3KTHA 4YLHA 3QREA 5DZKA 2VX2A 1ON3A 5INIA 5DL1A 3PEAA 3OMEA 5MGBA 5DZKH 1RJNA 1XNYA 1VRGA 3TVWA 3QMJA 4JCRA 1NZYA 3ZWCA 3KQFA 5G1RA 2J5II 3GF7A 4K3WA 5E0NX 3H0SA 4FJWD 4RYFA 3KTIA 4ELWA 1TYFA 3BF0A 1UIYA 3TV5A 2PPYA 3OT6A 4HC8A 3R6HA 1FC9A 3R0OA 1XNVA 4WCZA 1FCFA 5C90A 2Q34A 1FC6A 3P5MA 1JXZA 3QYRA 4IZDA 5DTWA 2DUBA 3PZKA 4FB8A 3L3SA 4MXIA 1N6FA 1TG6A 4F47A 4OMRA 2X24A 1HNUA 3KTKA 1Q52A 3MYBA 2J5IB 4NEKA 3LAOA 2VREA 4NNQA 1PJHA 3HP0A 1N6DA 4ELSA 5DUFA 3HINA 3P2LA 3GKBA 2C8TA 3TT7A 4DI1A 2F6IA 3PE8A 3TZ3A 1WDKA 1EY3A 4Z0MA 4FNDA 5DU8A 1HNOA 2EJ5A 3K8XA 3BEZA 1DCIA 3FF6A 3WG5A 5INGA 3R9QA 2PG8A 2VSUF 2FBMA 3STAA 3HLN1 2VSUE 3DJAA 5CTBA 2VSSF 4FZWC 1UYVA 3G64A 1NZYB 1Y7OA 1YG8A 3QXIA 4Q0GA 2PBPA
chains in the Genus database with same CATH superfamily
4JOTA 3BPTA 3MOGA 3JU1A 1XNWA 4FZWA 3BPPA 3KTGA 4LK5A 3FDUA 5KDRA 4KD6A 5G1SA 3F43A 4JC0A 3GMAA 3T8AA 3Q0GA 3MGLA 5JBWA 4FNBA 4KNPA 5JBXA 2WTBA 4K2NA 3K50A 1XX4A 2D3TA 3V5IA 1YG6A 3QDQA 3V5EA 3GLMA 2F6QA 4FN7A 3LKEA 3LKLA 4DMGA 3DUPA 1BUZA 2QQ3A 2KLNA 5FUSA 4EMLA 1K39A 3H02A 3QKAA 3RSIA 3TRRA 4U19A 1PIXA 3GVJA 1X0UA 3N6RB 2A7SA 1THNB 2F9YA 3U9SB 2CWWA 4KPKA 4GHNA 3H0QA 3R9SA 2VSUC 4RCNA 5DUCA 2ZL2A 4L6WA 1WDMA 3VIVA 4EMPA 1EF9A 2DXLA 3TT6A 4XS5A 3IHBA 3T6OA 4EMMA 4JJTA 4U1AA 2VSUA 4ZDBA 3V8VA 2VSSA 4MOUA 4JYLA 1N6EA 2Q35A 1SBOA 4HNKA 4U18A 3ZXNA 1RJMA 4HYLA 5IKLB 4ZDCA 3RSTA 4DGHA 3D3UA 3GHFA 3P85A 2W3PA 2FW2A 3JU4A 5EUXA 3Q1TA 1OD2A 5EUZA 4B3IA 1UYRA 4JFCA 4JCTA 2F9IA 3IHAA 2ZOAA 1EF8A 1HF2A 4JVTA 3OC7A 3GVLA 1ON9A 3QWDA 1AUZA 2J5IA 3IAVA 4I52A 1FC7A 4I4ZA 1Q51A 4ZDFA 5E0SH 5KJPA 1TILB 3LDFA 1HZDA 3GF3A 5KDRB 4JWVA 3HE2A 3M6MA 4L1CA 4QTPA 2ZL3A 2B78A 4ZDDA 2BZRA 4JYJA 4AEJA 3PGQA 4G2RA 4WZ8B 3SWXA 1V0EA 3I47A 4QIIA 2CBYA 2HW5A 5CTCA 1DUBA 3Q7HA 1WDLA 2UZFA 3NJBA 4HIZA 4KWBA 3IF5A 3C0KA 2Q2XA 3ISAA 3R9TA 3QXZA 1TH8B 2F9YB 1J7XA 4JCSA 4Q1IA 4JSBA 4K29A 2RRLA 2A7KA 2CE3A 1H4YA 4U0GA 4JCQA 4NARA 3ZW8A 1K32A 1UYTA 4OG1A 4J2UA 4U0GH 5DU6A 5EUWA 4DGFA 1OD4A 4B3JA 3V97A 4I42A 3OIZA 1W2XA 1SZOA 5INFA 1SG4A 3MT6A 3OIRA 3MOYA 4RYFH 3GMFA 4FN8A 3ZWBA 5EUSA 2J5SA 4HDTA 4MI2A 4ASIA 3GK7A 2ZQRA 3IB9A 3ZW9A 4IZBA 3KTJA 4U0HA 5EUUA 3U9RB 3T3WA 1BPLA 1UYSA 3RRVA 2VY9A 1V0FA 1O8UA 3MFMA 5C9GA 4ELXA 3T88A 5DU4A 4ZU2A 2IEXA 3AGEA 3H81A 3ST9A 3TDCA 1XO6A 3HRXA 2FZSA 2F9IB 5G1QA 1WZ8A 4IZCA 3LLOA 4L8KA 3GVKA 5FIFA 2A81A 2OASA 3SLLA 3Q0JA 2ZQQA 2AS0A 4QIJA 2ZL4A 1MJ3A 4OLQA 2ZL0A 2DEOA 2J5GD 3IBBA 2YJGA 5E0SA 1H4XA 2GTRA 3M6NA 3NJDA 2J5GA 3TVUA 2NP9A 2X58A 5DKPA 3T89A 3AGDA 4ZDEA 3U9TB 3ZWAA 3QK8A 4QFEA 4GM2A 3NY7A 3DORA 3H0UA 3TLFA 4WYOB 1T6RA 3H0JA 3T8BA 2VSSE 5DTPA 4B3HA 3KTHA 4YLHA 3QREA 5DZKA 2VX2A 1ON3A 1H4ZA 5INIA 5DL1A 3PEAA 3OMEA 5MGBA 5DZKH 1RJNA 3EH7A 1XNYA 1VRGA 3TVWA 3QMJA 4JCRA 1NZYA 3ZWCA 3D03A 3KQFA 5G1RA 2J5II 3GF7A 4K3WA 5E0NX 3H0SA 2ZO9B 3VSEA 4FJWD 4RYFA 3KTIA 4ELWA 1TYFA 3BF0A 1UIYA 3TV5A 2PPYA 3OT6A 4HC8A 3R6HA 1FC9A 3R0OA 1XNVA 4WCZA 1FCFA 5C90A 1WXWA 1FC6A 2Q34A 3P5MA 1JXZA 3QYRA 3ZTBA 4IZDA 5DTWA 1VC1A 4AE2A 2DUBA 3IH8A 5EZBA 3PZKA 4FB8A 3L3SA 4MXIA 1N6FA 1TG6A 4F47A 4OMRA 2X24A 2DXNA 1HNUA 3KTKA 1Q52A 3MYBA 2J5IB 5HUQA 2KA5A 4NEKA 3LAOA 2VREA 4NNQA 1PJHA 3HP0A 1N6DA 4ELSA 5DUFA 3HINA 3P2LA 1WXXA 3GKBA 2C8TA 3TT7A 4DI1A 2F6IA 3PE8A 3TZ3A 1WDKA 1EY3A 4Z0MA 4FNDA 5DU8A 1HNOA 2EJ5A 3IH9A 3K8XA 3BEZA 1DCIA 3FF6A 1TIDB 3WG5A 5INGA 3R9QA 2PG8A 2VSUF 2FBMA 3STAA 3HLN1 3DJAA 2VSUE 5CTBA 2VSSF 4FZWC 1UYVA 3G64A 1NZYB 1Y7OA 1YG8A 3QXIA 4Q0GA 2PBPA
chains in the Genus database with same CATH topology
4JOTA 3BPTA 3MOGA 3JU1A 1XNWA 4FZWA 3BPPA 3KTGA 4LK5A 3FDUA 5KDRA 4KD6A 5G1SA 4JC0A 3GMAA 3T8AA 3Q0GA 5JBWA 4FNBA 4KNPA 5JBXA 2WTBA 4K2NA 3K50A 1XX4A 2D3TA 3V5IA 1YG6A 3V5EA 3GLMA 2F6QA 4FN7A 3LKEA 3DUPA 2QQ3A 5FUSA 4EMLA 1K39A 3H02A 3QKAA 3RSIA 3TRRA 4U19A 1PIXA 1X0UA 3N6RB 2A7SA 2F9YA 3U9SB 4KPKA 4GHNA 3H0QA 3R9SA 2VSUC 4RCNA 5DUCA 2ZL2A 4L6WA 1WDMA 3VIVA 4EMPA 1EF9A 2DXLA 3TT6A 4EMMA 4JJTA 4U1AA 2VSUA 4ZDBA 2VSSA 4MOUA 4JYLA 1N6EA 2Q35A 4HNKA 4U18A 1RJMA 5IKLB 4ZDCA 3RSTA 3GHFA 3P85A 2W3PA 2FW2A 3Q1TA 1OD2A 4B3IA 1UYRA 4JFCA 4JCTA 2F9IA 2ZOAA 1EF8A 4JVTA 3OC7A 1ON9A 3QWDA 2J5IA 3IAVA 4I52A 1FC7A 4I4ZA 1Q51A 4ZDFA 5E0SH 5KJPA 1HZDA 3GF3A 5KDRB 4JWVA 3HE2A 3M6MA 4L1CA 2ZL3A 4ZDDA 2BZRA 4JYJA 4AEJA 3PGQA 4G2RA 4WZ8B 3SWXA 3I47A 4QIIA 2CBYA 2HW5A 5CTCA 1DUBA 3Q7HA 1WDLA 2UZFA 3NJBA 4KWBA 2Q2XA 3ISAA 3R9TA 3QXZA 2F9YB 1J7XA 4JCSA 4Q1IA 4JSBA 4K29A 2RRLA 2A7KA 2CE3A 4U0GA 4JCQA 4NARA 3ZW8A 1K32A 1UYTA 4OG1A 4J2UA 4U0GH 5DU6A 1OD4A 4B3JA 4I42A 1W2XA 1SZOA 5INFA 1SG4A 3MT6A 3MOYA 4RYFH 3GMFA 4FN8A 3ZWBA 2J5SA 4HDTA 4MI2A 4ASIA 2ZQRA 3IB9A 3ZW9A 4IZBA 3KTJA 4U0HA 3U9RB 3T3WA 1BPLA 1UYSA 3RRVA 1O8UA 3MFMA 5C9GA 4ELXA 3T88A 5DU4A 4ZU2A 2IEXA 3H81A 3ST9A 3TDCA 1XO6A 3HRXA 2FZSA 2F9IB 5G1QA 1WZ8A 4IZCA 4L8KA 5FIFA 2A81A 3SLLA 3Q0JA 2ZQQA 4QIJA 2ZL4A 1MJ3A 4OLQA 2ZL0A 2DEOA 2J5GD 3IBBA 2YJGA 5E0SA 2GTRA 3M6NA 3NJDA 2J5GA 3TVUA 2NP9A 2X58A 5DKPA 3T89A 4ZDEA 3U9TB 3ZWAA 3QK8A 4QFEA 4GM2A 3TLFA 3DORA 3H0UA 4WYOB 3H0JA 3T8BA 2VSSE 5DTPA 4B3HA 3KTHA 4YLHA 3QREA 5DZKA 2VX2A 1ON3A 5INIA 5DL1A 3PEAA 3OMEA 5MGBA 5DZKH 1RJNA 1XNYA 1VRGA 3TVWA 3QMJA 4JCRA 1NZYA 3ZWCA 3D03A 3KQFA 5G1RA 2J5II 3GF7A 4K3WA 5E0NX 3H0SA 2ZO9B 4FJWD 4RYFA 3KTIA 4ELWA 1TYFA 3BF0A 1UIYA 3TV5A 2PPYA 3OT6A 4HC8A 3R6HA 1FC9A 3R0OA 1XNVA 4WCZA 1FCFA 5C90A 2Q34A 1FC6A 3P5MA 1JXZA 3QYRA 4IZDA 5DTWA 4AE2A 2DUBA 3PZKA 4FB8A 3L3SA 4MXIA 1N6FA 1TG6A 4F47A 4OMRA 2X24A 2DXNA 1HNUA 3KTKA 1Q52A 3MYBA 2J5IB 5HUQA 4NEKA 3LAOA 2VREA 4NNQA 1PJHA 3HP0A 1N6DA 4ELSA 5DUFA 3HINA 3P2LA 3GKBA 2C8TA 3TT7A 4DI1A 2F6IA 3PE8A 3TZ3A 1WDKA 1EY3A 4Z0MA 4FNDA 5DU8A 1HNOA 2EJ5A 3K8XA 3BEZA 1DCIA 3FF6A 3WG5A 5INGA 3R9QA 2PG8A 2VSUF 2FBMA 3STAA 3HLN1 3DJAA 2VSUE 5CTBA 2VSSF 4FZWC 1UYVA 3G64A 1NZYB 1Y7OA 1YG8A 3QXIA 4Q0GA 2PBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOT A;  3JU1 A;  1XNW A;  4FZW A;  3BPP A;  3KTG A;  4LK5 A;  3FDU A;  5KDR A;  4KD6 A;  5G1S A;  3GMA A;  3T8A A;  3Q0G A;  5JBW A;  4FNB A;  4KNP A;  5JBX A;  2WTB A;  4K2N A;  3K50 A;  1XX4 A;  2D3T A;  3V5I A;  1YG6 A;  3V5E A;  3GLM A;  2F6Q A;  4FN7 A;  3LKE A;  2QQ3 A;  5FUS A;  4EML A;  1K39 A;  3H02 A;  3QKA A;  3RSI A;  3TRR A;  4U19 A;  1PIX A;  1X0U A;  3N6R B;  2A7S A;  2F9Y A;  3U9S B;  4KPK A;  4GHN A;  3H0Q A;  3R9S A;  2VSU C;  4RCN A;  5DUC A;  2ZL2 A;  4L6W A;  1WDM A;  3VIV A;  4EMP A;  1EF9 A;  3TT6 A;  4EMM A;  4JJT A;  4U1A A;  2VSU A;  4ZDB A;  2VSS A;  4MOU A;  4JYL A;  1N6E A;  2Q35 A;  4HNK A;  4U18 A;  1RJM A;  5IKL B;  4ZDC A;  3RST A;  3P85 A;  2W3P A;  2FW2 A;  3Q1T A;  1OD2 A;  4B3I A;  1UYR A;  4JFC A;  4JCT A;  2F9I A;  1EF8 A;  4JVT A;  3OC7 A;  1ON9 A;  3QWD A;  2J5I A;  3IAV A;  4I52 A;  1FC7 A;  4I4Z A;  1Q51 A;  4ZDF A;  5E0S H;  5KJP A;  1HZD A;  3GF3 A;  5KDR B;  4JWV A;  3HE2 A;  3M6M A;  2ZL3 A;  4ZDD A;  2BZR A;  4JYJ A;  3PGQ A;  4G2R A;  4WZ8 B;  3SWX A;  3I47 A;  4QII A;  2CBY A;  2HW5 A;  5CTC A;  1DUB A;  3Q7H A;  1WDL A;  2UZF A;  3NJB A;  4KWB A;  2Q2X A;  3ISA A;  3R9T A;  3QXZ A;  2F9Y B;  1J7X A;  4JCS A;  4Q1I A;  4JSB A;  4K29 A;  2A7K A;  2CE3 A;  4U0G A;  4JCQ A;  3ZW8 A;  1K32 A;  1UYT A;  4OG1 A;  4U0G H;  5DU6 A;  1OD4 A;  4B3J A;  4I42 A;  1W2X A;  1SZO A;  5INF A;  1SG4 A;  3MT6 A;  3MOY A;  4RYF H;  4FN8 A;  3ZWB A;  2J5S A;  4MI2 A;  4ASI A;  2ZQR A;  3IB9 A;  3ZW9 A;  4IZB A;  3KTJ A;  4U0H A;  3U9R B;  3T3W A;  1UYS A;  3RRV A;  1O8U A;  3MFM A;  5C9G A;  4ELX A;  3T88 A;  5DU4 A;  4ZU2 A;  2IEX A;  3H81 A;  3ST9 A;  3TDC A;  1XO6 A;  3HRX A;  2FZS A;  2F9I B;  5G1Q A;  1WZ8 A;  4IZC A;  4L8K A;  5FIF A;  2A81 A;  3SLL A;  3Q0J A;  2ZQQ A;  4QIJ A;  2ZL4 A;  1MJ3 A;  4OLQ A;  2ZL0 A;  2DEO A;  2J5G D;  3IBB A;  5E0S A;  2GTR A;  3M6N A;  3NJD A;  2J5G A;  3TVU A;  2NP9 A;  2X58 A;  5DKP A;  3T89 A;  3U9T B;  4ZDE A;  3ZWA A;  3QK8 A;  4QFE A;  4GM2 A;  3TLF A;  3DOR A;  3H0U A;  4WYO B;  3H0J A;  3T8B A;  2VSS E;  5DTP A;  4B3H A;  3KTH A;  4YLH A;  3QRE A;  5DZK A;  2VX2 A;  1ON3 A;  5INI A;  5DL1 A;  3PEA A;  3OME A;  5MGB A;  5DZK H;  1RJN A;  1XNY A;  1VRG A;  3TVW A;  3QMJ A;  4JCR A;  1NZY A;  3ZWC A;  3KQF A;  5G1R A;  2J5I I;  3GF7 A;  4K3W A;  5E0N X;  3H0S A;  4FJW D;  4RYF A;  3KTI A;  4ELW A;  1TYF A;  3BF0 A;  1UIY A;  3TV5 A;  2PPY A;  3OT6 A;  4HC8 A;  3R6H A;  1FC9 A;  3R0O A;  1XNV A;  4WCZ A;  1FCF A;  5C90 A;  2Q34 A;  1FC6 A;  3P5M A;  1JXZ A;  3QYR A;  4IZD A;  5DTW A;  2DUB A;  3PZK A;  4FB8 A;  3L3S A;  4MXI A;  1N6F A;  1TG6 A;  4F47 A;  4OMR A;  2X24 A;  1HNU A;  3KTK A;  1Q52 A;  3MYB A;  2J5I B;  4NEK A;  3LAO A;  2VRE A;  4NNQ A;  1PJH A;  3HP0 A;  1N6D A;  4ELS A;  5DUF A;  3HIN A;  3P2L A;  3GKB A;  2C8T A;  3TT7 A;  4DI1 A;  2F6I A;  3PE8 A;  3TZ3 A;  1WDK A;  1EY3 A;  4Z0M A;  4FND A;  5DU8 A;  1HNO A;  2EJ5 A;  3K8X A;  3BEZ A;  1DCI A;  3FF6 A;  3WG5 A;  5ING A;  3R9Q A;  2PG8 A;  2VSU F;  2FBM A;  3STA A;  3HLN 1;  2VSU E;  3DJA A;  5CTB A;  2VSS F;  4FZW C;  1UYV A;  3G64 A;  1NZY B;  1Y7O A;  1YG8 A;  3QXI A;  4Q0G A;  2PBP A; 
#chains in the Genus database with same CATH topology
 4JOT A;  3BPT A;  3MOG A;  3JU1 A;  1XNW A;  4FZW A;  3BPP A;  3KTG A;  4LK5 A;  3FDU A;  5KDR A;  4KD6 A;  5G1S A;  3F43 A;  4JC0 A;  3GMA A;  3T8A A;  3Q0G A;  3MGL A;  5JBW A;  4FNB A;  4KNP A;  5JBX A;  2WTB A;  4K2N A;  3K50 A;  1XX4 A;  2D3T A;  3V5I A;  1YG6 A;  3QDQ A;  3V5E A;  3GLM A;  2F6Q A;  4FN7 A;  3LKE A;  3LKL A;  4DMG A;  3DUP A;  1BUZ A;  2QQ3 A;  2KLN A;  5FUS A;  4EML A;  1K39 A;  3H02 A;  3QKA A;  3RSI A;  3TRR A;  4U19 A;  1PIX A;  3GVJ A;  1X0U A;  3N6R B;  2A7S A;  1THN B;  2F9Y A;  3U9S B;  2CWW A;  4KPK A;  4GHN A;  3H0Q A;  3R9S A;  2VSU C;  4RCN A;  5DUC A;  2ZL2 A;  4L6W A;  1WDM A;  3VIV A;  4EMP A;  1EF9 A;  2DXL A;  3TT6 A;  4XS5 A;  3IHB A;  3T6O A;  4EMM A;  4JJT A;  4U1A A;  2VSU A;  4ZDB A;  3V8V A;  2VSS A;  4MOU A;  4JYL A;  1N6E A;  2Q35 A;  1SBO A;  4HNK A;  4U18 A;  3ZXN A;  1RJM A;  4HYL A;  5IKL B;  4ZDC A;  3RST A;  4DGH A;  3D3U A;  3GHF A;  3P85 A;  2W3P A;  2FW2 A;  3JU4 A;  5EUX A;  3Q1T A;  1OD2 A;  5EUZ A;  4B3I A;  1UYR A;  4JFC A;  4JCT A;  2F9I A;  3IHA A;  2ZOA A;  1EF8 A;  1HF2 A;  4JVT A;  3OC7 A;  3GVL A;  1ON9 A;  3QWD A;  1AUZ A;  2J5I A;  3IAV A;  4I52 A;  1FC7 A;  4I4Z A;  1Q51 A;  4ZDF A;  5E0S H;  5KJP A;  1TIL B;  3LDF A;  1HZD A;  3GF3 A;  5KDR B;  4JWV A;  3HE2 A;  3M6M A;  4L1C A;  4QTP A;  2ZL3 A;  2B78 A;  4ZDD A;  2BZR A;  4JYJ A;  4AEJ A;  3PGQ A;  4G2R A;  4WZ8 B;  3SWX A;  1V0E A;  3I47 A;  4QII A;  2CBY A;  2HW5 A;  5CTC A;  1DUB A;  3Q7H A;  1WDL A;  2UZF A;  3NJB A;  4HIZ A;  4KWB A;  3IF5 A;  3C0K A;  2Q2X A;  3ISA A;  3R9T A;  3QXZ A;  1TH8 B;  2F9Y B;  1J7X A;  4JCS A;  4Q1I A;  4JSB A;  4K29 A;  2RRL A;  2A7K A;  2CE3 A;  1H4Y A;  4U0G A;  4JCQ A;  4NAR A;  3ZW8 A;  1K32 A;  1UYT A;  4OG1 A;  4J2U A;  4U0G H;  5DU6 A;  5EUW A;  4DGF A;  1OD4 A;  4B3J A;  3V97 A;  4I42 A;  3OIZ A;  1W2X A;  1SZO A;  5INF A;  1SG4 A;  3MT6 A;  3OIR A;  3MOY A;  4RYF H;  3GMF A;  4FN8 A;  3ZWB A;  5EUS A;  2J5S A;  4HDT A;  4MI2 A;  4ASI A;  3GK7 A;  2ZQR A;  3IB9 A;  3ZW9 A;  4IZB A;  3KTJ A;  4U0H A;  5EUU A;  3U9R B;  3T3W A;  1BPL A;  1UYS A;  3RRV A;  2VY9 A;  1V0F A;  1O8U A;  3MFM A;  5C9G A;  4ELX A;  3T88 A;  5DU4 A;  4ZU2 A;  2IEX A;  3AGE A;  3H81 A;  3ST9 A;  3TDC A;  1XO6 A;  3HRX A;  2FZS A;  2F9I B;  5G1Q A;  1WZ8 A;  4IZC A;  3LLO A;  4L8K A;  3GVK A;  5FIF A;  2A81 A;  2OAS A;  3SLL A;  3Q0J A;  2ZQQ A;  2AS0 A;  4QIJ A;  2ZL4 A;  1MJ3 A;  4OLQ A;  2ZL0 A;  2DEO A;  2J5G D;  3IBB A;  2YJG A;  5E0S A;  1H4X A;  2GTR A;  3M6N A;  3NJD A;  2J5G A;  3TVU A;  2NP9 A;  2X58 A;  5DKP A;  3T89 A;  3AGD A;  4ZDE A;  3U9T B;  3ZWA A;  3QK8 A;  4QFE A;  4GM2 A;  3NY7 A;  3DOR A;  3H0U A;  3TLF A;  4WYO B;  1T6R A;  3H0J A;  3T8B A;  2VSS E;  5DTP A;  4B3H A;  3KTH A;  4YLH A;  3QRE A;  5DZK A;  2VX2 A;  1ON3 A;  1H4Z A;  5INI A;  5DL1 A;  3PEA A;  3OME A;  5MGB A;  5DZK H;  1RJN A;  3EH7 A;  1XNY A;  1VRG A;  3TVW A;  3QMJ A;  4JCR A;  1NZY A;  3ZWC A;  3D03 A;  3KQF A;  5G1R A;  2J5I I;  3GF7 A;  4K3W A;  5E0N X;  3H0S A;  2ZO9 B;  3VSE A;  4FJW D;  4RYF A;  3KTI A;  4ELW A;  1TYF A;  3BF0 A;  1UIY A;  3TV5 A;  2PPY A;  3OT6 A;  4HC8 A;  3R6H A;  1FC9 A;  3R0O A;  1XNV A;  4WCZ A;  1FCF A;  5C90 A;  1WXW A;  1FC6 A;  2Q34 A;  3P5M A;  1JXZ A;  3QYR A;  3ZTB A;  4IZD A;  5DTW A;  1VC1 A;  4AE2 A;  2DUB A;  3IH8 A;  5EZB A;  3PZK A;  4FB8 A;  3L3S A;  4MXI A;  1N6F A;  1TG6 A;  4F47 A;  4OMR A;  2X24 A;  2DXN A;  1HNU A;  3KTK A;  1Q52 A;  3MYB A;  2J5I B;  5HUQ A;  2KA5 A;  4NEK A;  3LAO A;  2VRE A;  4NNQ A;  1PJH A;  3HP0 A;  1N6D A;  4ELS A;  5DUF A;  3HIN A;  3P2L A;  1WXX A;  3GKB A;  2C8T A;  3TT7 A;  4DI1 A;  2F6I A;  3PE8 A;  3TZ3 A;  1WDK A;  1EY3 A;  4Z0M A;  4FND A;  5DU8 A;  1HNO A;  2EJ5 A;  3IH9 A;  3K8X A;  3BEZ A;  1DCI A;  3FF6 A;  1TID B;  3WG5 A;  5ING A;  3R9Q A;  2PG8 A;  2VSU F;  2FBM A;  3STA A;  3HLN 1;  3DJA A;  2VSU E;  5CTB A;  2VSS F;  4FZW C;  1UYV A;  3G64 A;  1NZY B;  1Y7O A;  1YG8 A;  3QXI A;  4Q0G A;  2PBP A; 
#chains in the Genus database with same CATH homology
 4JOT A;  3BPT A;  3MOG A;  3JU1 A;  1XNW A;  4FZW A;  3BPP A;  3KTG A;  4LK5 A;  3FDU A;  5KDR A;  4KD6 A;  5G1S A;  4JC0 A;  3GMA A;  3T8A A;  3Q0G A;  5JBW A;  4FNB A;  4KNP A;  5JBX A;  2WTB A;  4K2N A;  3K50 A;  1XX4 A;  2D3T A;  3V5I A;  1YG6 A;  3V5E A;  3GLM A;  2F6Q A;  4FN7 A;  3LKE A;  3DUP A;  2QQ3 A;  5FUS A;  4EML A;  1K39 A;  3H02 A;  3QKA A;  3RSI A;  3TRR A;  4U19 A;  1PIX A;  1X0U A;  3N6R B;  2A7S A;  2F9Y A;  3U9S B;  4KPK A;  4GHN A;  3H0Q A;  3R9S A;  2VSU C;  4RCN A;  5DUC A;  2ZL2 A;  4L6W A;  1WDM A;  3VIV A;  4EMP A;  1EF9 A;  2DXL A;  3TT6 A;  4EMM A;  4JJT A;  4U1A A;  2VSU A;  4ZDB A;  2VSS A;  4MOU A;  4JYL A;  1N6E A;  2Q35 A;  4HNK A;  4U18 A;  1RJM A;  5IKL B;  4ZDC A;  3RST A;  3GHF A;  3P85 A;  2W3P A;  2FW2 A;  3Q1T A;  1OD2 A;  4B3I A;  1UYR A;  4JFC A;  4JCT A;  2F9I A;  2ZOA A;  1EF8 A;  4JVT A;  3OC7 A;  1ON9 A;  3QWD A;  2J5I A;  3IAV A;  4I52 A;  1FC7 A;  4I4Z A;  1Q51 A;  4ZDF A;  5E0S H;  5KJP A;  1HZD A;  3GF3 A;  5KDR B;  4JWV A;  3HE2 A;  3M6M A;  4L1C A;  2ZL3 A;  4ZDD A;  2BZR A;  4JYJ A;  4AEJ A;  3PGQ A;  4G2R A;  4WZ8 B;  3SWX A;  3I47 A;  4QII A;  2CBY A;  2HW5 A;  5CTC A;  1DUB A;  3Q7H A;  1WDL A;  2UZF A;  3NJB A;  4KWB A;  2Q2X A;  3ISA A;  3R9T A;  3QXZ A;  2F9Y B;  1J7X A;  4JCS A;  4Q1I A;  4JSB A;  4K29 A;  2RRL A;  2A7K A;  2CE3 A;  4U0G A;  4JCQ A;  4NAR A;  3ZW8 A;  1K32 A;  1UYT A;  4OG1 A;  4J2U A;  4U0G H;  5DU6 A;  1OD4 A;  4B3J A;  4I42 A;  1W2X A;  1SZO A;  5INF A;  1SG4 A;  3MT6 A;  3MOY A;  4RYF H;  3GMF A;  4FN8 A;  3ZWB A;  2J5S A;  4HDT A;  4MI2 A;  4ASI A;  2ZQR A;  3IB9 A;  3ZW9 A;  4IZB A;  3KTJ A;  4U0H A;  3U9R B;  3T3W A;  1BPL A;  1UYS A;  3RRV A;  1O8U A;  3MFM A;  5C9G A;  4ELX A;  3T88 A;  5DU4 A;  4ZU2 A;  2IEX A;  3H81 A;  3ST9 A;  3TDC A;  1XO6 A;  3HRX A;  2FZS A;  2F9I B;  5G1Q A;  1WZ8 A;  4IZC A;  4L8K A;  5FIF A;  2A81 A;  3SLL A;  3Q0J A;  2ZQQ A;  4QIJ A;  2ZL4 A;  1MJ3 A;  4OLQ A;  2ZL0 A;  2DEO A;  2J5G D;  3IBB A;  2YJG A;  5E0S A;  2GTR A;  3M6N A;  3NJD A;  2J5G A;  3TVU A;  2NP9 A;  2X58 A;  5DKP A;  3T89 A;  4ZDE A;  3U9T B;  3ZWA A;  3QK8 A;  4QFE A;  4GM2 A;  3TLF A;  3DOR A;  3H0U A;  4WYO B;  3H0J A;  3T8B A;  2VSS E;  5DTP A;  4B3H A;  3KTH A;  4YLH A;  3QRE A;  5DZK A;  2VX2 A;  1ON3 A;  5INI A;  5DL1 A;  3PEA A;  3OME A;  5MGB A;  5DZK H;  1RJN A;  1XNY A;  1VRG A;  3TVW A;  3QMJ A;  4JCR A;  1NZY A;  3ZWC A;  3D03 A;  3KQF A;  5G1R A;  2J5I I;  3GF7 A;  4K3W A;  5E0N X;  3H0S A;  2ZO9 B;  4FJW D;  4RYF A;  3KTI A;  4ELW A;  1TYF A;  3BF0 A;  1UIY A;  3TV5 A;  2PPY A;  3OT6 A;  4HC8 A;  3R6H A;  1FC9 A;  3R0O A;  1XNV A;  4WCZ A;  1FCF A;  5C90 A;  2Q34 A;  1FC6 A;  3P5M A;  1JXZ A;  3QYR A;  4IZD A;  5DTW A;  4AE2 A;  2DUB A;  3PZK A;  4FB8 A;  3L3S A;  4MXI A;  1N6F A;  1TG6 A;  4F47 A;  4OMR A;  2X24 A;  2DXN A;  1HNU A;  3KTK A;  1Q52 A;  3MYB A;  2J5I B;  5HUQ A;  4NEK A;  3LAO A;  2VRE A;  4NNQ A;  1PJH A;  3HP0 A;  1N6D A;  4ELS A;  5DUF A;  3HIN A;  3P2L A;  3GKB A;  2C8T A;  3TT7 A;  4DI1 A;  2F6I A;  3PE8 A;  3TZ3 A;  1WDK A;  1EY3 A;  4Z0M A;  4FND A;  5DU8 A;  1HNO A;  2EJ5 A;  3K8X A;  3BEZ A;  1DCI A;  3FF6 A;  3WG5 A;  5ING A;  3R9Q A;  2PG8 A;  2VSU F;  2FBM A;  3STA A;  3HLN 1;  3DJA A;  2VSU E;  5CTB A;  2VSS F;  4FZW C;  1UYV A;  3G64 A;  1NZY B;  1Y7O A;  1YG8 A;  3QXI A;  4Q0G A;  2PBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...