4L8KA

Crystal structure of a putative peptidase (parmer_02772) from parabacteroides merdae atcc 43184 at 2.26 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
SSPRDNFEALWRIMDENYCFFAFKDVDWDDVYDRYNLLVKDTMNQYELFDILGKMLAEVKDGHTNLISSFDMSRYWAWYEDYPANFYKEIQDNYLGTDYKIAGGMKYKRLADDQIGYVYYGSFSSGVGENNLDYMFAHFKECKGLIFDVRDNGGGSMLYSDRIASRFLEERILTGYTQYKKGNGHNDFTQPNPVYLSPSDRTRWLRPVIVLTNRHSYSATNDFVNVMRLLPQVTVMGDRTGGGSGLPFSSELPNGWSVRFSACPVLDVNKQHTEFGIDPDTAVAITGEDIMKGRDTIIEAAIGLLLAKGDSAISY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative peptidase (PARMER_02772) from Parabacteroides merdae ATCC 43184 at 2.26 A resolution
rcsb
source organism Parabacteroides merdae
molecule tags Hydrolase
molecule keywords putative peptidase
total genus 101
structure length 315
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF14684 Tricorn_C1 Tricorn protease C1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4l8kA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4l8kA02
3GMAA 3QYRA 4B3HA 3V5IA 3QKAA 2F9IA 5DZKA 5CTBA 2VSUA 3IBBA 4OLQA 1SG4A 3JU1A 3MYBA 3N6RB 1TG6A 4K2NA 3K8XA 2Q2XA 4FNDA 4YLHA 4RYFH 2ZL3A 3TV5A 2UZFA 3BF0A 4Q1IA 1OD4A 3OC7A 4FJWD 3ISAA 2VSSF 1W2XA 2ZQQA 2F6QA 4ZDEA 4LK5A 1EF8A 3L3SA 4RYFA 4FN8A 2ZL0A 4I42A 3ZWCA 1RJMA 3Q0GA 1K39A 3QXZA 3U9SB 3Q1TA 1FC6A 3MT6A 4ASIA 1FC9A 2J5IB 2EJ5A 2GTRA 3WG5A 3M6MA 3KQFA 1MJ3A 5DUFA 1Y7OA 4U0HA 2DUBA 1UYTA 4GM2A 3V5EA 1X0UA 3R0OA 3QXIA 3FDUA 3FF6A 2CBYA 5KDRB 3PE8A 1XNWA 5INFA 4WCZA 5DKPA 2FBMA 4JYJA 4JOTA 2F6IA 3H02A 2J5GD 3HP0A 1PJHA 3KTKA 4GHNA 1DUBA 4JCQA 4KPKA 2VSUF 5E0NX 3OMEA 2W3PA 4IZDA 5G1QA 3ZW9A 4JWVA 1JXZA 4QIJA 2C8TA 3ZW8A 1Q51A 3GF7A 4F47A 3SWXA 2J5SA 3MOYA 1WZ8A 3R9QA 4ELXA 3P5MA 4OMRA 1VRGA 5G1SA 2WTBA 4EMPA 2J5GA 3T8AA 3NJDA 3ZWAA 3G64A 1FCFA 1XNYA 1DCIA 4QFEA 2VSSA 2Q34A 4EMLA 3KTHA 3RSTA 2VSUC 3HRXA 5JBWA 3H0JA 5DTWA 2A7SA 4L6WA 2PPYA 3TZ3A 1UIYA 2BZRA 3GF3A 4ELSA 1UYVA 1N6EA 3PZKA 2IEXA 4QIIA 1XO6A 4WYOB 4ZU2A 1FC7A 4EMMA 4FZWA 2DEOA 4HNKA 4KD6A 5E0SA 2PBPA 3K50A 5G1RA 3Q0JA 5KDRA 3Q7HA 4MI2A 2CE3A 5INGA 5E0SH 1N6FA 5KJPA 1OD2A 3BPPA 4U1AA 3TRRA 3QREA 3H0UA 3ZWBA 5MGBA 2ZL4A 3LAOA 3HLN1 4L8KA 4Z0MA 2F9IB 2F9YA 3DJAA 1UYRA 4JSBA 1HNUA 3STAA 4HC8A 4NNQA 4ZDCA 4U18A 2HW5A 5JBXA 5DU8A 4FNBA 2FZSA 1NZYB 1WDLA 4JCRA 1TYFA 1XX4A 1RJNA 1WDKA 2ZQRA 4KWBA 3GLMA 5INIA 1NZYA 4WZ8B 3RSIA 5C9GA 1YG8A 3TVUA 3IB9A 5FIFA 3IAVA 1XNVA 3TT7A 2X24A 3MFMA 3R9TA 4IZCA 1K32A 3P85A 4G2RA 2NP9A 2QQ3A 4FN7A 3DORA 1ON3A 3PGQA 1ON9A 4JYLA 3H81A 4MXIA 3HINA 4U0GA 4ELWA 3T3WA 4ZDFA 3U9RB 3PEAA 5DZKH 3KTIA 1UYSA 4JVTA 1O8UA 4K3WA 3KTGA 5FUSA 5DL1A 1WDMA 4DI1A 3H0QA 1EY3A 4NEKA 3I47A 2F9YB 3QK8A 4U19A 3HE2A 5IKLB 2X58A 2VREA 4JCTA 4I4ZA 1N6DA 4I52A 3T8BA 3ST9A 4JJTA 4K29A 3TDCA 1YG6A 5DUCA 4IZBA 3R9SA 4KNPA 1EF9A 3QWDA 3TT6A 2Q35A 3RRVA 3R6HA 3NJBA 4Q0GA 1HNOA 5CTCA 3TVWA 3M6NA 2VSUE 3OT6A 1J7XA 2PG8A 3T88A 4B3JA 4MOUA 4U0GH 2VSSE 4ZDBA 3U9TB 3GKBA 4RCNA 2D3TA 4OG1A 4FZWC 5C90A 4B3IA 2A7KA 2ZL2A 3P2LA 3LKEA 3QMJA 2VX2A 1PIXA 3TLFA 1SZOA 1HZDA 2A81A 5DTPA 4JCSA 5DU6A 3T89A 3VIVA 4FB8A 3H0SA 4ZDDA 5DU4A 3SLLA 4JFCA 2J5II 3BEZA 1Q52A 2FW2A 2J5IA 3KTJA
chains in the Genus database with same CATH superfamily
3GMAA 3QYRA 4B3HA 4JC0A 3V5IA 3QKAA 2KA5A 2F9IA 5DZKA 5CTBA 2VSUA 3IBBA 4OLQA 1SG4A 3JU1A 3MYBA 3N6RB 1TG6A 4K2NA 4DGFA 3K8XA 2Q2XA 4FNDA 4YLHA 4RYFH 4QTPA 2ZL3A 3TV5A 2UZFA 3BF0A 4Q1IA 3GVKA 1OD4A 1SBOA 3D03A 3OC7A 4FJWD 3ISAA 2VSSF 3GVJA 1W2XA 2ZQQA 3IF5A 2F6QA 4ZDEA 1BUZA 4LK5A 1EF8A 3L3SA 4RYFA 4AE2A 4L1CA 2OASA 4FN8A 1H4ZA 5HUQA 2ZL0A 4I42A 3LKLA 3ZWCA 2VY9A 1RJMA 3Q0GA 1K39A 3QXZA 3U9SB 3Q1TA 1FC6A 3T6OA 3MT6A 4ASIA 1FC9A 2J5IB 3IH9A 2EJ5A 2GTRA 3WG5A 3M6MA 3KQFA 1MJ3A 5DUFA 4U0HA 1Y7OA 2DUBA 3IHAA 1UYTA 2DXLA 4GM2A 3V5EA 1X0UA 1AUZA 5EUUA 3R0OA 3ZXNA 3QXIA 3FDUA 3FF6A 2CBYA 5KDRB 3PE8A 1XNWA 5INFA 1WXXA 4WCZA 5DKPA 2FBMA 4JYJA 4JOTA 2F6IA 3H02A 2J5GD 3HP0A 1PJHA 3KTKA 4GHNA 1DUBA 4JCQA 4KPKA 2VSUF 5E0NX 3OMEA 2W3PA 4IZDA 5G1QA 3ZW9A 4JWVA 1JXZA 1VC1A 2B78A 4NARA 2DXNA 4QIJA 2C8TA 3ZW8A 1Q51A 3GF7A 4F47A 3SWXA 2J5SA 3MOYA 1HF2A 1WZ8A 1THNB 2CWWA 3R9QA 4ELXA 3P5MA 4OMRA 1VRGA 5G1SA 2WTBA 4EMPA 2J5GA 4HDTA 3T8AA 3NJDA 3ZWAA 3G64A 2KLNA 1FCFA 1XNYA 1DCIA 1TH8B 4QFEA 5EUWA 3BPTA 2VSSA 2Q34A 4EMLA 3KTHA 3RSTA 2VSUC 3HRXA 5JBWA 4AEJA 3H0JA 4J2UA 3NY7A 5DTWA 2A7SA 4L6WA 2PPYA 3TZ3A 1UIYA 2BZRA 3GF3A 4ELSA 1UYVA 1N6EA 3PZKA 2IEXA 4QIIA 4XS5A 1XO6A 4WYOB 4ZU2A 1FC7A 4EMMA 5EUXA 4FZWA 2DEOA 4HNKA 1TILB 1WXWA 1V0FA 3GK7A 4KD6A 5E0SA 2PBPA 3K50A 5G1RA 3Q0JA 5KDRA 3Q7HA 2YJGA 4DGHA 4MI2A 2CE3A 4HYLA 5INGA 5E0SH 1N6FA 5KJPA 1OD2A 3BPPA 4U1AA 3TRRA 3QREA 3H0UA 3ZWBA 2AS0A 5MGBA 2ZL4A 3LAOA 3HLN1 4L8KA 4Z0MA 1T6RA 2F9IB 2F9YA 3DJAA 1UYRA 4JSBA 1HNUA 3STAA 4HC8A 3C0KA 1H4YA 4NNQA 4ZDCA 1BPLA 4U18A 3AGDA 2HW5A 5JBXA 5DU8A 4FNBA 2FZSA 1NZYB 1WDLA 4JCRA 3VSEA 1TYFA 1XX4A 3ZTBA 1RJNA 1WDKA 2ZQRA 4KWBA 3GLMA 5INIA 1NZYA 4WZ8B 3V8VA 3RSIA 5C9GA 1YG8A 3TVUA 3IB9A 5FIFA 3IAVA 1XNVA 3TT7A 3MOGA 2X24A 3MFMA 3MGLA 3R9TA 3GMFA 4IZCA 1K32A 3D3UA 3P85A 4G2RA 2NP9A 3V97A 2QQ3A 4FN7A 3DORA 3LLOA 1ON3A 3PGQA 1ON9A 4JYLA 3H81A 4MXIA 3HINA 4U0GA 3T3WA 4ELWA 4ZDFA 3U9RB 3PEAA 5DZKH 3EH7A 3KTIA 1UYSA 2RRLA 4JVTA 4DMGA 1O8UA 4K3WA 2ZO9B 3KTGA 5FUSA 5DL1A 1WDMA 3LDFA 5EZBA 5EUZA 3IHBA 4DI1A 3H0QA 1EY3A 4NEKA 1H4XA 3I47A 2F9YB 3QK8A 3DUPA 4U19A 3HE2A 5IKLB 2X58A 2VREA 4JCTA 4I4ZA 1N6DA 4I52A 3T8BA 3ST9A 3GHFA 4JJTA 4K29A 3TDCA 1YG6A 5EUSA 5DUCA 4IZBA 3R9SA 4KNPA 1EF9A 3QWDA 3TT6A 4HIZA 2Q35A 3RRVA 3R6HA 3AGEA 3NJBA 4Q0GA 3QDQA 1HNOA 5CTCA 3TVWA 3M6NA 2VSUE 1TIDB 3OT6A 2ZOAA 1J7XA 2PG8A 3T88A 4B3JA 4MOUA 4U0GH 2VSSE 4ZDBA 3U9TB 3GKBA 4RCNA 2D3TA 4OG1A 4FZWC 5C90A 4B3IA 2A7KA 3OIRA 2ZL2A 3F43A 3P2LA 3LKEA 3QMJA 2VX2A 3OIZA 1PIXA 3TLFA 1SZOA 1HZDA 2A81A 5DTPA 4JCSA 5DU6A 3T89A 3JU4A 1V0EA 3VIVA 3IH8A 4FB8A 3H0SA 4ZDDA 5DU4A 3SLLA 3GVLA 4JFCA 2J5II 3BEZA 1Q52A 2FW2A 2J5IA 3KTJA
chains in the Genus database with same CATH topology
3GMAA 3QYRA 4B3HA 4JC0A 3V5IA 3QKAA 2F9IA 5DZKA 5CTBA 2VSUA 3IBBA 4OLQA 1SG4A 3JU1A 3MYBA 3N6RB 1TG6A 4K2NA 3K8XA 2Q2XA 4FNDA 4YLHA 4RYFH 2ZL3A 3TV5A 2UZFA 3BF0A 4Q1IA 1OD4A 3D03A 3OC7A 4FJWD 3ISAA 2VSSF 1W2XA 2ZQQA 2F6QA 4ZDEA 4LK5A 1EF8A 3L3SA 4RYFA 4AE2A 4L1CA 4FN8A 5HUQA 2ZL0A 4I42A 3ZWCA 1RJMA 3Q0GA 1K39A 3QXZA 3U9SB 3Q1TA 1FC6A 3MT6A 4ASIA 1FC9A 2J5IB 2EJ5A 2GTRA 3WG5A 3M6MA 3KQFA 1MJ3A 5DUFA 1Y7OA 4U0HA 2DUBA 1UYTA 2DXLA 4GM2A 3V5EA 1X0UA 3R0OA 3QXIA 3FDUA 3FF6A 2CBYA 5KDRB 3PE8A 1XNWA 5INFA 4WCZA 5DKPA 2FBMA 4JYJA 4JOTA 2F6IA 3H02A 2J5GD 3HP0A 1PJHA 3KTKA 4GHNA 1DUBA 4JCQA 4KPKA 2VSUF 5E0NX 3OMEA 2W3PA 4IZDA 5G1QA 3ZW9A 4JWVA 1JXZA 4NARA 2DXNA 4QIJA 2C8TA 3ZW8A 1Q51A 3GF7A 4F47A 3SWXA 2J5SA 3MOYA 1WZ8A 3R9QA 4ELXA 3P5MA 4OMRA 1VRGA 5G1SA 2WTBA 4EMPA 2J5GA 4HDTA 3T8AA 3NJDA 3ZWAA 3G64A 1FCFA 1XNYA 1DCIA 4QFEA 3BPTA 2VSSA 2Q34A 4EMLA 3KTHA 3RSTA 2VSUC 3HRXA 5JBWA 4AEJA 3H0JA 4J2UA 5DTWA 2A7SA 4L6WA 2PPYA 3TZ3A 1UIYA 2BZRA 3GF3A 4ELSA 1UYVA 1N6EA 3PZKA 2IEXA 4QIIA 1XO6A 4WYOB 4ZU2A 1FC7A 4EMMA 4FZWA 2DEOA 4HNKA 4KD6A 5E0SA 2PBPA 3K50A 5G1RA 3Q0JA 5KDRA 3Q7HA 2YJGA 4MI2A 2CE3A 5INGA 5E0SH 1N6FA 5KJPA 1OD2A 3BPPA 4U1AA 3TRRA 3QREA 3H0UA 3ZWBA 5MGBA 2ZL4A 3LAOA 3HLN1 4L8KA 4Z0MA 2F9IB 2F9YA 3DJAA 1UYRA 4JSBA 1HNUA 3STAA 4HC8A 4NNQA 4ZDCA 1BPLA 4U18A 2HW5A 5JBXA 5DU8A 4FNBA 2FZSA 1NZYB 1WDLA 4JCRA 1TYFA 1XX4A 1RJNA 1WDKA 2ZQRA 4KWBA 3GLMA 5INIA 1NZYA 4WZ8B 3RSIA 5C9GA 1YG8A 3TVUA 3IB9A 5FIFA 3IAVA 1XNVA 3TT7A 3MOGA 2X24A 3MFMA 3R9TA 3GMFA 4IZCA 1K32A 3P85A 4G2RA 2NP9A 2QQ3A 4FN7A 3DORA 1ON3A 3PGQA 1ON9A 4JYLA 3H81A 4MXIA 3HINA 4U0GA 3T3WA 4ELWA 4ZDFA 3U9RB 3PEAA 5DZKH 3KTIA 1UYSA 2RRLA 4JVTA 1O8UA 4K3WA 2ZO9B 3KTGA 5FUSA 5DL1A 1WDMA 4DI1A 3H0QA 1EY3A 4NEKA 3I47A 2F9YB 3QK8A 3DUPA 4U19A 3HE2A 5IKLB 2X58A 2VREA 4JCTA 4I4ZA 1N6DA 4I52A 3T8BA 3ST9A 3GHFA 4JJTA 4K29A 3TDCA 1YG6A 5DUCA 4IZBA 3R9SA 4KNPA 1EF9A 3QWDA 3TT6A 2Q35A 3RRVA 3R6HA 3NJBA 4Q0GA 1HNOA 5CTCA 3TVWA 3M6NA 2VSUE 3OT6A 2ZOAA 1J7XA 2PG8A 3T88A 4B3JA 4MOUA 4U0GH 2VSSE 4ZDBA 3U9TB 3GKBA 4RCNA 2D3TA 4OG1A 4FZWC 5C90A 4B3IA 2A7KA 2ZL2A 3P2LA 3LKEA 3QMJA 2VX2A 1PIXA 3TLFA 1SZOA 1HZDA 2A81A 5DTPA 4JCSA 5DU6A 3T89A 3VIVA 4FB8A 3H0SA 4ZDDA 5DU4A 3SLLA 4JFCA 2J5II 3BEZA 1Q52A 2FW2A 2J5IA 3KTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMA A;  3QYR A;  4B3H A;  3V5I A;  3QKA A;  2F9I A;  5DZK A;  5CTB A;  2VSU A;  3IBB A;  4OLQ A;  1SG4 A;  3JU1 A;  3MYB A;  3N6R B;  1TG6 A;  4K2N A;  3K8X A;  2Q2X A;  4FND A;  4YLH A;  4RYF H;  2ZL3 A;  3TV5 A;  2UZF A;  3BF0 A;  4Q1I A;  1OD4 A;  3OC7 A;  4FJW D;  3ISA A;  2VSS F;  1W2X A;  2ZQQ A;  2F6Q A;  4ZDE A;  4LK5 A;  1EF8 A;  3L3S A;  4RYF A;  4FN8 A;  2ZL0 A;  4I42 A;  3ZWC A;  1RJM A;  3Q0G A;  1K39 A;  3QXZ A;  3U9S B;  3Q1T A;  1FC6 A;  3MT6 A;  4ASI A;  1FC9 A;  2J5I B;  2EJ5 A;  2GTR A;  3WG5 A;  3M6M A;  3KQF A;  1MJ3 A;  5DUF A;  1Y7O A;  4U0H A;  2DUB A;  1UYT A;  4GM2 A;  3V5E A;  1X0U A;  3R0O A;  3QXI A;  3FDU A;  3FF6 A;  2CBY A;  5KDR B;  3PE8 A;  1XNW A;  5INF A;  4WCZ A;  5DKP A;  2FBM A;  4JYJ A;  4JOT A;  2F6I A;  3H02 A;  2J5G D;  3HP0 A;  1PJH A;  3KTK A;  4GHN A;  1DUB A;  4JCQ A;  4KPK A;  2VSU F;  5E0N X;  3OME A;  2W3P A;  4IZD A;  5G1Q A;  3ZW9 A;  4JWV A;  1JXZ A;  4QIJ A;  2C8T A;  3ZW8 A;  1Q51 A;  3GF7 A;  4F47 A;  3SWX A;  2J5S A;  3MOY A;  1WZ8 A;  3R9Q A;  4ELX A;  3P5M A;  4OMR A;  1VRG A;  5G1S A;  2WTB A;  4EMP A;  2J5G A;  3T8A A;  3NJD A;  3ZWA A;  3G64 A;  1FCF A;  1XNY A;  1DCI A;  4QFE A;  2VSS A;  2Q34 A;  4EML A;  3KTH A;  3RST A;  2VSU C;  3HRX A;  5JBW A;  3H0J A;  5DTW A;  2A7S A;  4L6W A;  2PPY A;  3TZ3 A;  1UIY A;  2BZR A;  3GF3 A;  4ELS A;  1UYV A;  1N6E A;  3PZK A;  2IEX A;  4QII A;  1XO6 A;  4WYO B;  4ZU2 A;  1FC7 A;  4EMM A;  4FZW A;  2DEO A;  4HNK A;  4KD6 A;  5E0S A;  2PBP A;  3K50 A;  5G1R A;  3Q0J A;  5KDR A;  3Q7H A;  4MI2 A;  2CE3 A;  5ING A;  5E0S H;  1N6F A;  5KJP A;  1OD2 A;  3BPP A;  4U1A A;  3TRR A;  3QRE A;  3H0U A;  3ZWB A;  5MGB A;  2ZL4 A;  3LAO A;  3HLN 1;  4L8K A;  4Z0M A;  2F9I B;  2F9Y A;  3DJA A;  1UYR A;  4JSB A;  1HNU A;  3STA A;  4HC8 A;  4NNQ A;  4ZDC A;  4U18 A;  2HW5 A;  5JBX A;  5DU8 A;  4FNB A;  2FZS A;  1NZY B;  1WDL A;  4JCR A;  1TYF A;  1XX4 A;  1RJN A;  1WDK A;  2ZQR A;  4KWB A;  3GLM A;  5INI A;  1NZY A;  4WZ8 B;  3RSI A;  5C9G A;  1YG8 A;  3TVU A;  3IB9 A;  5FIF A;  3IAV A;  1XNV A;  3TT7 A;  2X24 A;  3MFM A;  3R9T A;  4IZC A;  1K32 A;  3P85 A;  4G2R A;  2NP9 A;  2QQ3 A;  4FN7 A;  3DOR A;  1ON3 A;  3PGQ A;  1ON9 A;  4JYL A;  3H81 A;  4MXI A;  3HIN A;  4U0G A;  4ELW A;  3T3W A;  4ZDF A;  3U9R B;  3PEA A;  5DZK H;  3KTI A;  1UYS A;  4JVT A;  1O8U A;  4K3W A;  3KTG A;  5FUS A;  5DL1 A;  1WDM A;  4DI1 A;  3H0Q A;  1EY3 A;  4NEK A;  3I47 A;  2F9Y B;  3QK8 A;  4U19 A;  3HE2 A;  5IKL B;  2X58 A;  2VRE A;  4JCT A;  4I4Z A;  1N6D A;  4I52 A;  3T8B A;  3ST9 A;  4JJT A;  4K29 A;  3TDC A;  1YG6 A;  5DUC A;  4IZB A;  3R9S A;  4KNP A;  1EF9 A;  3QWD A;  3TT6 A;  2Q35 A;  3RRV A;  3R6H A;  3NJB A;  4Q0G A;  1HNO A;  5CTC A;  3TVW A;  3M6N A;  2VSU E;  3OT6 A;  1J7X A;  2PG8 A;  3T88 A;  4B3J A;  4MOU A;  4U0G H;  2VSS E;  4ZDB A;  3U9T B;  3GKB A;  4RCN A;  2D3T A;  4OG1 A;  4FZW C;  5C90 A;  4B3I A;  2A7K A;  2ZL2 A;  3P2L A;  3LKE A;  3QMJ A;  2VX2 A;  1PIX A;  3TLF A;  1SZO A;  1HZD A;  2A81 A;  5DTP A;  4JCS A;  5DU6 A;  3T89 A;  3VIV A;  4FB8 A;  3H0S A;  4ZDD A;  5DU4 A;  3SLL A;  4JFC A;  2J5I I;  3BEZ A;  1Q52 A;  2FW2 A;  2J5I A;  3KTJ A; 
#chains in the Genus database with same CATH topology
 3GMA A;  3QYR A;  4B3H A;  4JC0 A;  3V5I A;  3QKA A;  2KA5 A;  2F9I A;  5DZK A;  5CTB A;  2VSU A;  3IBB A;  4OLQ A;  1SG4 A;  3JU1 A;  3MYB A;  3N6R B;  1TG6 A;  4K2N A;  4DGF A;  3K8X A;  2Q2X A;  4FND A;  4YLH A;  4RYF H;  4QTP A;  2ZL3 A;  3TV5 A;  2UZF A;  3BF0 A;  4Q1I A;  3GVK A;  1OD4 A;  1SBO A;  3D03 A;  3OC7 A;  4FJW D;  3ISA A;  2VSS F;  3GVJ A;  1W2X A;  2ZQQ A;  3IF5 A;  2F6Q A;  4ZDE A;  1BUZ A;  4LK5 A;  1EF8 A;  3L3S A;  4RYF A;  4AE2 A;  4L1C A;  2OAS A;  4FN8 A;  1H4Z A;  5HUQ A;  2ZL0 A;  4I42 A;  3LKL A;  3ZWC A;  2VY9 A;  1RJM A;  3Q0G A;  1K39 A;  3QXZ A;  3U9S B;  3Q1T A;  1FC6 A;  3T6O A;  3MT6 A;  4ASI A;  1FC9 A;  2J5I B;  3IH9 A;  2EJ5 A;  2GTR A;  3WG5 A;  3M6M A;  3KQF A;  1MJ3 A;  5DUF A;  4U0H A;  1Y7O A;  2DUB A;  3IHA A;  1UYT A;  2DXL A;  4GM2 A;  3V5E A;  1X0U A;  1AUZ A;  5EUU A;  3R0O A;  3ZXN A;  3QXI A;  3FDU A;  3FF6 A;  2CBY A;  5KDR B;  3PE8 A;  1XNW A;  5INF A;  1WXX A;  4WCZ A;  5DKP A;  2FBM A;  4JYJ A;  4JOT A;  2F6I A;  3H02 A;  2J5G D;  3HP0 A;  1PJH A;  3KTK A;  4GHN A;  1DUB A;  4JCQ A;  4KPK A;  2VSU F;  5E0N X;  3OME A;  2W3P A;  4IZD A;  5G1Q A;  3ZW9 A;  4JWV A;  1JXZ A;  1VC1 A;  2B78 A;  4NAR A;  2DXN A;  4QIJ A;  2C8T A;  3ZW8 A;  1Q51 A;  3GF7 A;  4F47 A;  3SWX A;  2J5S A;  3MOY A;  1HF2 A;  1WZ8 A;  1THN B;  2CWW A;  3R9Q A;  4ELX A;  3P5M A;  4OMR A;  1VRG A;  5G1S A;  2WTB A;  4EMP A;  2J5G A;  4HDT A;  3T8A A;  3NJD A;  3ZWA A;  3G64 A;  2KLN A;  1FCF A;  1XNY A;  1DCI A;  1TH8 B;  4QFE A;  5EUW A;  3BPT A;  2VSS A;  2Q34 A;  4EML A;  3KTH A;  3RST A;  2VSU C;  3HRX A;  5JBW A;  4AEJ A;  3H0J A;  4J2U A;  3NY7 A;  5DTW A;  2A7S A;  4L6W A;  2PPY A;  3TZ3 A;  1UIY A;  2BZR A;  3GF3 A;  4ELS A;  1UYV A;  1N6E A;  3PZK A;  2IEX A;  4QII A;  4XS5 A;  1XO6 A;  4WYO B;  4ZU2 A;  1FC7 A;  4EMM A;  5EUX A;  4FZW A;  2DEO A;  4HNK A;  1TIL B;  1WXW A;  1V0F A;  3GK7 A;  4KD6 A;  5E0S A;  2PBP A;  3K50 A;  5G1R A;  3Q0J A;  5KDR A;  3Q7H A;  2YJG A;  4DGH A;  4MI2 A;  2CE3 A;  4HYL A;  5ING A;  5E0S H;  1N6F A;  5KJP A;  1OD2 A;  3BPP A;  4U1A A;  3TRR A;  3QRE A;  3H0U A;  3ZWB A;  2AS0 A;  5MGB A;  2ZL4 A;  3LAO A;  3HLN 1;  4L8K A;  4Z0M A;  1T6R A;  2F9I B;  2F9Y A;  3DJA A;  1UYR A;  4JSB A;  1HNU A;  3STA A;  4HC8 A;  3C0K A;  1H4Y A;  4NNQ A;  4ZDC A;  1BPL A;  4U18 A;  3AGD A;  2HW5 A;  5JBX A;  5DU8 A;  4FNB A;  2FZS A;  1NZY B;  1WDL A;  4JCR A;  3VSE A;  1TYF A;  1XX4 A;  3ZTB A;  1RJN A;  1WDK A;  2ZQR A;  4KWB A;  3GLM A;  5INI A;  1NZY A;  4WZ8 B;  3V8V A;  3RSI A;  5C9G A;  1YG8 A;  3TVU A;  3IB9 A;  5FIF A;  3IAV A;  1XNV A;  3TT7 A;  3MOG A;  2X24 A;  3MFM A;  3MGL A;  3R9T A;  3GMF A;  4IZC A;  1K32 A;  3D3U A;  3P85 A;  4G2R A;  2NP9 A;  3V97 A;  2QQ3 A;  4FN7 A;  3DOR A;  3LLO A;  1ON3 A;  3PGQ A;  1ON9 A;  4JYL A;  3H81 A;  4MXI A;  3HIN A;  4U0G A;  3T3W A;  4ELW A;  4ZDF A;  3U9R B;  3PEA A;  5DZK H;  3EH7 A;  3KTI A;  1UYS A;  2RRL A;  4JVT A;  4DMG A;  1O8U A;  4K3W A;  2ZO9 B;  3KTG A;  5FUS A;  5DL1 A;  1WDM A;  3LDF A;  5EZB A;  5EUZ A;  3IHB A;  4DI1 A;  3H0Q A;  1EY3 A;  4NEK A;  1H4X A;  3I47 A;  2F9Y B;  3QK8 A;  3DUP A;  4U19 A;  3HE2 A;  5IKL B;  2X58 A;  2VRE A;  4JCT A;  4I4Z A;  1N6D A;  4I52 A;  3T8B A;  3ST9 A;  3GHF A;  4JJT A;  4K29 A;  3TDC A;  1YG6 A;  5EUS A;  5DUC A;  4IZB A;  3R9S A;  4KNP A;  1EF9 A;  3QWD A;  3TT6 A;  4HIZ A;  2Q35 A;  3RRV A;  3R6H A;  3AGE A;  3NJB A;  4Q0G A;  3QDQ A;  1HNO A;  5CTC A;  3TVW A;  3M6N A;  2VSU E;  1TID B;  3OT6 A;  2ZOA A;  1J7X A;  2PG8 A;  3T88 A;  4B3J A;  4MOU A;  4U0G H;  2VSS E;  4ZDB A;  3U9T B;  3GKB A;  4RCN A;  2D3T A;  4OG1 A;  4FZW C;  5C90 A;  4B3I A;  2A7K A;  3OIR A;  2ZL2 A;  3F43 A;  3P2L A;  3LKE A;  3QMJ A;  2VX2 A;  3OIZ A;  1PIX A;  3TLF A;  1SZO A;  1HZD A;  2A81 A;  5DTP A;  4JCS A;  5DU6 A;  3T89 A;  3JU4 A;  1V0E A;  3VIV A;  3IH8 A;  4FB8 A;  3H0S A;  4ZDD A;  5DU4 A;  3SLL A;  3GVL A;  4JFC A;  2J5I I;  3BEZ A;  1Q52 A;  2FW2 A;  2J5I A;  3KTJ A; 
#chains in the Genus database with same CATH homology
 3GMA A;  3QYR A;  4B3H A;  4JC0 A;  3V5I A;  3QKA A;  2F9I A;  5DZK A;  5CTB A;  2VSU A;  3IBB A;  4OLQ A;  1SG4 A;  3JU1 A;  3MYB A;  3N6R B;  1TG6 A;  4K2N A;  3K8X A;  2Q2X A;  4FND A;  4YLH A;  4RYF H;  2ZL3 A;  3TV5 A;  2UZF A;  3BF0 A;  4Q1I A;  1OD4 A;  3D03 A;  3OC7 A;  4FJW D;  3ISA A;  2VSS F;  1W2X A;  2ZQQ A;  2F6Q A;  4ZDE A;  4LK5 A;  1EF8 A;  3L3S A;  4RYF A;  4AE2 A;  4L1C A;  4FN8 A;  5HUQ A;  2ZL0 A;  4I42 A;  3ZWC A;  1RJM A;  3Q0G A;  1K39 A;  3QXZ A;  3U9S B;  3Q1T A;  1FC6 A;  3MT6 A;  4ASI A;  1FC9 A;  2J5I B;  2EJ5 A;  2GTR A;  3WG5 A;  3M6M A;  3KQF A;  1MJ3 A;  5DUF A;  1Y7O A;  4U0H A;  2DUB A;  1UYT A;  2DXL A;  4GM2 A;  3V5E A;  1X0U A;  3R0O A;  3QXI A;  3FDU A;  3FF6 A;  2CBY A;  5KDR B;  3PE8 A;  1XNW A;  5INF A;  4WCZ A;  5DKP A;  2FBM A;  4JYJ A;  4JOT A;  2F6I A;  3H02 A;  2J5G D;  3HP0 A;  1PJH A;  3KTK A;  4GHN A;  1DUB A;  4JCQ A;  4KPK A;  2VSU F;  5E0N X;  3OME A;  2W3P A;  4IZD A;  5G1Q A;  3ZW9 A;  4JWV A;  1JXZ A;  4NAR A;  2DXN A;  4QIJ A;  2C8T A;  3ZW8 A;  1Q51 A;  3GF7 A;  4F47 A;  3SWX A;  2J5S A;  3MOY A;  1WZ8 A;  3R9Q A;  4ELX A;  3P5M A;  4OMR A;  1VRG A;  5G1S A;  2WTB A;  4EMP A;  2J5G A;  4HDT A;  3T8A A;  3NJD A;  3ZWA A;  3G64 A;  1FCF A;  1XNY A;  1DCI A;  4QFE A;  3BPT A;  2VSS A;  2Q34 A;  4EML A;  3KTH A;  3RST A;  2VSU C;  3HRX A;  5JBW A;  4AEJ A;  3H0J A;  4J2U A;  5DTW A;  2A7S A;  4L6W A;  2PPY A;  3TZ3 A;  1UIY A;  2BZR A;  3GF3 A;  4ELS A;  1UYV A;  1N6E A;  3PZK A;  2IEX A;  4QII A;  1XO6 A;  4WYO B;  4ZU2 A;  1FC7 A;  4EMM A;  4FZW A;  2DEO A;  4HNK A;  4KD6 A;  5E0S A;  2PBP A;  3K50 A;  5G1R A;  3Q0J A;  5KDR A;  3Q7H A;  2YJG A;  4MI2 A;  2CE3 A;  5ING A;  5E0S H;  1N6F A;  5KJP A;  1OD2 A;  3BPP A;  4U1A A;  3TRR A;  3QRE A;  3H0U A;  3ZWB A;  5MGB A;  2ZL4 A;  3LAO A;  3HLN 1;  4L8K A;  4Z0M A;  2F9I B;  2F9Y A;  3DJA A;  1UYR A;  4JSB A;  1HNU A;  3STA A;  4HC8 A;  4NNQ A;  4ZDC A;  1BPL A;  4U18 A;  2HW5 A;  5JBX A;  5DU8 A;  4FNB A;  2FZS A;  1NZY B;  1WDL A;  4JCR A;  1TYF A;  1XX4 A;  1RJN A;  1WDK A;  2ZQR A;  4KWB A;  3GLM A;  5INI A;  1NZY A;  4WZ8 B;  3RSI A;  5C9G A;  1YG8 A;  3TVU A;  3IB9 A;  5FIF A;  3IAV A;  1XNV A;  3TT7 A;  3MOG A;  2X24 A;  3MFM A;  3R9T A;  3GMF A;  4IZC A;  1K32 A;  3P85 A;  4G2R A;  2NP9 A;  2QQ3 A;  4FN7 A;  3DOR A;  1ON3 A;  3PGQ A;  1ON9 A;  4JYL A;  3H81 A;  4MXI A;  3HIN A;  4U0G A;  3T3W A;  4ELW A;  4ZDF A;  3U9R B;  3PEA A;  5DZK H;  3KTI A;  1UYS A;  2RRL A;  4JVT A;  1O8U A;  4K3W A;  2ZO9 B;  3KTG A;  5FUS A;  5DL1 A;  1WDM A;  4DI1 A;  3H0Q A;  1EY3 A;  4NEK A;  3I47 A;  2F9Y B;  3QK8 A;  3DUP A;  4U19 A;  3HE2 A;  5IKL B;  2X58 A;  2VRE A;  4JCT A;  4I4Z A;  1N6D A;  4I52 A;  3T8B A;  3ST9 A;  3GHF A;  4JJT A;  4K29 A;  3TDC A;  1YG6 A;  5DUC A;  4IZB A;  3R9S A;  4KNP A;  1EF9 A;  3QWD A;  3TT6 A;  2Q35 A;  3RRV A;  3R6H A;  3NJB A;  4Q0G A;  1HNO A;  5CTC A;  3TVW A;  3M6N A;  2VSU E;  3OT6 A;  2ZOA A;  1J7X A;  2PG8 A;  3T88 A;  4B3J A;  4MOU A;  4U0G H;  2VSS E;  4ZDB A;  3U9T B;  3GKB A;  4RCN A;  2D3T A;  4OG1 A;  4FZW C;  5C90 A;  4B3I A;  2A7K A;  2ZL2 A;  3P2L A;  3LKE A;  3QMJ A;  2VX2 A;  1PIX A;  3TLF A;  1SZO A;  1HZD A;  2A81 A;  5DTP A;  4JCS A;  5DU6 A;  3T89 A;  3VIV A;  4FB8 A;  3H0S A;  4ZDD A;  5DU4 A;  3SLL A;  4JFC A;  2J5I I;  3BEZ A;  1Q52 A;  2FW2 A;  2J5I A;  3KTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...