4L8KA

Crystal structure of a putative peptidase (parmer_02772) from parabacteroides merdae atcc 43184 at 2.26 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
SSPRDNFEALWRIMDENYCFFAFKDVDWDDVYDRYNLLVKDTMNQYELFDILGKMLAEVKDGHTNLISSFDMSRYWAWYEDYPANFYKEIQDNYLGTDYKIAGGMKYKRLADDQIGYVYYGSFSSGVGENNLDYMFAHFKECKGLIFDVRDNGGGSMLYSDRIASRFLEERILTGYTQYKKGNGHNDFTQPNPVYLSPSDRTRWLRPVIVLTNRHSYSATNDFVNVMRLLPQVTVMGDRTGGGSGLPFSSELPNGWSVRFSACPVLDVNKQHTEFGIDPDTAVAITGEDIMKGRDTIIEAAIGLLLAKGDSAISY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative peptidase (PARMER_02772) from Parabacteroides merdae ATCC 43184 at 2.26 A resolution
rcsb
source organism Parabacteroides merdae
molecule tags Hydrolase
molecule keywords putative peptidase
total genus 101
structure length 315
sequence length 315
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03572 Peptidase_S41 Peptidase family S41
A PF14684 Tricorn_C1 Tricorn protease C1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.44 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4l8kA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4l8kA02
4U0HA 3KTGA 2VSSF 3GKBA 5DUFA 3T8AA 3K8XA 4JCQA 2VREA 2F9IA 1FC9A 2F6QA 2F9YB 4FJWD 4NEKA 4MI2A 5KDRB 4ELWA 4U0GA 2ZQRA 2X24A 5CTBA 3BF0A 3FF6A 3KTKA 3N6RB 3QMJA 4JFCA 3HP0A 2ZL4A 3TDCA 3LKEA 4FZWC 5IKLB 4JJTA 5E0SA 3HLN1 4JSBA 4Q1IA 2UZFA 2HW5A 1JXZA 1VRGA 3BPPA 3T88A 3KTHA 3R9QA 4L8KA 3QYRA 5G1QA 3TT6A 3P5MA 1UIYA 4JYLA 1ON3A 1SZOA 5INGA 3PEAA 4WZ8B 2X58A 4MOUA 4NNQA 4EMPA 3R0OA 3GF7A 5DU6A 5DTPA 3H0QA 1X0UA 5E0SH 1MJ3A 2DUBA 3RRVA 2CE3A 3H0SA 1RJNA 3PZKA 4KPKA 3I47A 2VSUA 1XX4A 3V5IA 3DJAA 5KJPA 2ZL3A 4U18A 4IZCA 4FZWA 2W3PA 3ZW9A 4JYJA 5FUSA 1UYVA 1NZYB 3HRXA 4L6WA 2PBPA 4RYFH 3ZWAA 3SLLA 3H81A 2FW2A 4B3IA 3M6NA 3P2LA 1N6FA 3U9TB 2F9IB 4ZU2A 4KD6A 3ISAA 4RYFA 1XO6A 4GHNA 5DL1A 4DI1A 3H0JA 4I52A 4HC8A 5DZKA 3OC7A 4G2RA 2Q2XA 2PPYA 2VSUF 3L3SA 3KQFA 2NP9A 2F9YA 3MOYA 4B3JA 4B3HA 1RJMA 2J5IA 5DU4A 3NJBA 4EMLA 4Z0MA 4YLHA 3ZWBA 3MT6A 2BZRA 1UYTA 4ZDEA 1K32A 3Q1TA 2VX2A 3TRRA 4WCZA 4FB8A 2J5GD 4JVTA 4Q0GA 4FN8A 3OT6A 4IZDA 2Q35A 1OD2A 3P85A 3MFMA 5INIA 1UYSA 4KNPA 2QQ3A 1K39A 1XNYA 4EMMA 4FNDA 3T8BA 1EF9A 4OLQA 4ELSA 4ZDBA 2VSSA 3GLMA 1TG6A 4JCRA 4JCSA 4OMRA 5JBXA 3GMAA 3T89A 4K2NA 4WYOB 4FNBA 4K3WA 1FCFA 3M6MA 1FC6A 5FIFA 3WG5A 4U19A 5C90A 5E0NX 2CBYA 3TVUA 1XNWA 1WDKA 5DU8A 5MGBA 3PGQA 2A7SA 3Q0JA 2Q34A 2D3TA 4ZDDA 1HNOA 4ELXA 1EY3A 1ON9A 3RSTA 2A81A 3LAOA 3IBBA 4I4ZA 3STAA 3QXIA 3GF3A 4ZDFA 4JOTA 4IZBA 2VSUE 3QKAA 3HE2A 3G64A 3QK8A 4I42A 5DKPA 3QXZA 3KTIA 4ASIA 5CTCA 3FDUA 3Q0GA 3QREA 3TVWA 2FBMA 3ZW8A 1EF8A 4ZDCA 4LK5A 4OG1A 1SG4A 2ZL0A 3TT7A 1WZ8A 2J5GA 1W2XA 3DORA 3Q7HA 3K50A 3SWXA 3MYBA 2PG8A 2WTBA 4JCTA 3R9SA 2J5IB 3R9TA 1WDLA 2C8TA 5DTWA 1WDMA 3NJDA 1YG8A 1J7XA 4U0GH 2ZL2A 3QWDA 4QIIA 4U1AA 1Y7OA 3TV5A 3TLFA 3U9RB 3V5EA 1TYFA 1HZDA 3RSIA 5INFA 2IEXA 4QIJA 5G1SA 2FZSA 1N6EA 5C9GA 3T3WA 2VSSE 1DCIA 1N6DA 2GTRA 3TZ3A 5DZKH 3H02A 1XNVA 3U9SB 1NZYA 4KWBA 4QFEA 1FC7A 3PE8A 4MXIA 2A7KA 3ZWCA 3JU1A 4GM2A 2VSUC 3VIVA 1Q51A 1PJHA 4K29A 1Q52A 3OMEA 5KDRA 4RCNA 4FN7A 5JBWA 3IAVA 2ZQQA 1HNUA 4JWVA 3R6HA 1PIXA 2J5SA 2F6IA 2EJ5A 3HINA 3KTJA 3H0UA 3ST9A 2DEOA 4HNKA 3IB9A 3BEZA 1O8UA 1OD4A 2J5II 1UYRA 5DUCA 1DUBA 5G1RA 1YG6A 4F47A
chains in the Genus database with same CATH superfamily
2ZOAA 4U0HA 3KTGA 1TIDB 2VSSF 3GKBA 5DUFA 3T8AA 3K8XA 4JCQA 2VREA 2F9IA 1FC9A 3LKLA 2F6QA 2F9YB 4FJWD 4NEKA 4MI2A 5KDRB 4ELWA 4U0GA 2ZQRA 2X24A 5CTBA 3BF0A 3FF6A 3KTKA 3N6RB 3QMJA 4JFCA 3HP0A 1WXXA 2ZL4A 3TDCA 3LKEA 4FZWC 5IKLB 4JJTA 5E0SA 3HLN1 4JSBA 4Q1IA 3MOGA 3GVKA 2HW5A 2UZFA 1JXZA 2ZO9B 1VRGA 3BPPA 1BUZA 3T88A 3KTHA 5G1QA 4L8KA 3QYRA 3R9QA 3D03A 3TT6A 3V97A 3P5MA 1UIYA 4JYLA 5EUWA 1ON3A 1SZOA 5INGA 3PEAA 4WZ8B 2X58A 1TILB 4MOUA 4NNQA 4EMPA 2AS0A 3R0OA 3GF7A 5DU6A 5DTPA 5EUSA 2VY9A 3H0QA 1X0UA 4HYLA 5E0SH 1MJ3A 2DUBA 3RRVA 2CE3A 3H0SA 1RJNA 3PZKA 4KPKA 3I47A 2VSUA 1H4YA 1XX4A 3V5IA 3DJAA 5KJPA 2ZL3A 4L1CA 4U18A 4HDTA 4IZCA 4FZWA 1VC1A 2RRLA 3IHBA 5EUZA 2W3PA 3ZW9A 4JYJA 5FUSA 1UYVA 1NZYB 3HRXA 4L6WA 2PBPA 4RYFH 3ZWAA 3SLLA 3H81A 2FW2A 1TH8B 3AGDA 4B3IA 3M6NA 3P2LA 1V0EA 1N6FA 3U9TB 2F9IB 4ZU2A 4KD6A 3ISAA 4RYFA 1XO6A 4GHNA 4AE2A 5DL1A 3IF5A 4DI1A 3H0JA 3IHAA 3NY7A 4I52A 4HC8A 4XS5A 5DZKA 3OC7A 4G2RA 2Q2XA 2KA5A 2PPYA 2VSUF 3L3SA 3KQFA 2NP9A 2F9YA 3MOYA 4B3JA 4B3HA 3V8VA 4AEJA 1RJMA 2J5IA 5DU4A 1T6RA 3MGLA 3NJBA 4EMLA 3ZXNA 4Z0MA 4YLHA 3ZWBA 3MT6A 2BZRA 1UYTA 4ZDEA 1K32A 3Q1TA 2VX2A 3TRRA 4WCZA 4FB8A 3JU4A 2J5GD 3LDFA 2KLNA 4JVTA 4Q0GA 4FN8A 3OT6A 3IH9A 1H4XA 4IZDA 2Q35A 1OD2A 3VSEA 3P85A 3MFMA 5INIA 1UYSA 4KNPA 3OIZA 2QQ3A 1K39A 1XNYA 4EMMA 4FNDA 2CWWA 3T8BA 1THNB 1EF9A 4OLQA 3T6OA 3F43A 3GVLA 4ELSA 4ZDBA 2VSSA 5HUQA 5EZBA 3GLMA 1TG6A 4JCRA 3OIRA 4JCSA 4OMRA 5JBXA 3GMAA 3AGEA 3T89A 4K2NA 4WYOB 4FNBA 4K3WA 1FCFA 3M6MA 1FC6A 5FIFA 3WG5A 5EUUA 4DMGA 4U19A 5C90A 5E0NX 2CBYA 3LLOA 3TVUA 1XNWA 1WDKA 5DU8A 4DGHA 5MGBA 3PGQA 2A7SA 3Q0JA 2Q34A 3BPTA 2D3TA 4ZDDA 1HNOA 4ELXA 1EY3A 1ON9A 3RSTA 2A81A 3LAOA 3IBBA 3GVJA 4I4ZA 3STAA 3QXIA 3GF3A 4ZDFA 2YJGA 4JOTA 4DGFA 3QDQA 4IZBA 2VSUE 3QKAA 3HE2A 3GMFA 3G64A 3QK8A 4I42A 5DKPA 3QXZA 3KTIA 4ASIA 5CTCA 1WXWA 3FDUA 3Q0GA 3QREA 3DUPA 3TVWA 2FBMA 3ZW8A 1EF8A 4ZDCA 4LK5A 4OG1A 1V0FA 1SG4A 2ZL0A 3TT7A 3ZTBA 3EH7A 1WZ8A 2J5GA 1W2XA 3DORA 3Q7HA 3K50A 3SWXA 3MYBA 1AUZA 2PG8A 2WTBA 4JCTA 1SBOA 3R9SA 2J5IB 3R9TA 1WDLA 2C8TA 5DTWA 1WDMA 3NJDA 1YG8A 1J7XA 4U0GH 2ZL2A 3QWDA 4QIIA 4U1AA 1Y7OA 4J2UA 3TV5A 3TLFA 4HIZA 1BPLA 4QTPA 3U9RB 3V5EA 1TYFA 1HZDA 3RSIA 3D3UA 5INFA 2IEXA 4QIJA 5G1SA 2FZSA 1N6EA 5EUXA 5C9GA 3C0KA 2B78A 3T3WA 2VSSE 1DCIA 1H4ZA 2OASA 1N6DA 2GTRA 4NARA 1HF2A 3TZ3A 5DZKH 3H02A 1XNVA 3U9SB 1NZYA 4KWBA 4QFEA 1FC7A 3PE8A 4MXIA 2A7KA 4JC0A 2DXNA 3GHFA 3ZWCA 3JU1A 4GM2A 2VSUC 3VIVA 1Q51A 1PJHA 4K29A 1Q52A 3OMEA 3IH8A 5KDRA 4RCNA 4FN7A 2DXLA 5JBWA 3IAVA 2ZQQA 1HNUA 4JWVA 3R6HA 1PIXA 2J5SA 2F6IA 2EJ5A 3HINA 3KTJA 3H0UA 3ST9A 2DEOA 4HNKA 3IB9A 3BEZA 1O8UA 1OD4A 3GK7A 2J5II 1UYRA 5DUCA 1DUBA 5G1RA 1YG6A 4F47A
chains in the Genus database with same CATH topology
2ZOAA 4U0HA 3KTGA 2VSSF 3GKBA 5DUFA 3T8AA 3K8XA 4JCQA 2VREA 2F9IA 1FC9A 2F6QA 2F9YB 4FJWD 4NEKA 4MI2A 5KDRB 4ELWA 4U0GA 2ZQRA 2X24A 5CTBA 3BF0A 3FF6A 3KTKA 3N6RB 3QMJA 4JFCA 3HP0A 2ZL4A 3TDCA 3LKEA 4FZWC 5IKLB 4JJTA 5E0SA 3HLN1 4JSBA 4Q1IA 3MOGA 2UZFA 2HW5A 1JXZA 2ZO9B 1VRGA 3BPPA 3T88A 3KTHA 5G1QA 3R9QA 4L8KA 3QYRA 3D03A 3TT6A 3P5MA 1UIYA 4JYLA 1ON3A 1SZOA 5INGA 3PEAA 4WZ8B 2X58A 4MOUA 4NNQA 4EMPA 3R0OA 3GF7A 5DU6A 5DTPA 3H0QA 1X0UA 5E0SH 1MJ3A 2DUBA 3RRVA 2CE3A 3H0SA 1RJNA 3PZKA 4KPKA 3I47A 2VSUA 1XX4A 3V5IA 3DJAA 5KJPA 2ZL3A 4L1CA 4U18A 4HDTA 4IZCA 4FZWA 2RRLA 2W3PA 3ZW9A 4JYJA 5FUSA 1UYVA 1NZYB 3HRXA 4L6WA 2PBPA 4RYFH 3ZWAA 3SLLA 3H81A 2FW2A 4B3IA 3M6NA 3P2LA 1N6FA 3U9TB 2F9IB 4ZU2A 4KD6A 3ISAA 4RYFA 1XO6A 4GHNA 4AE2A 5DL1A 4DI1A 3H0JA 4I52A 4HC8A 5DZKA 3OC7A 4G2RA 2Q2XA 2PPYA 2VSUF 3L3SA 3KQFA 2NP9A 2F9YA 3MOYA 4B3JA 4B3HA 4AEJA 1RJMA 2J5IA 5DU4A 3NJBA 4EMLA 4Z0MA 4YLHA 3ZWBA 3MT6A 2BZRA 1UYTA 4ZDEA 1K32A 3Q1TA 2VX2A 3TRRA 4WCZA 4FB8A 2J5GD 4JVTA 4Q0GA 4FN8A 3OT6A 4IZDA 2Q35A 1OD2A 3P85A 3MFMA 5INIA 1UYSA 4KNPA 2QQ3A 1K39A 1XNYA 4EMMA 4FNDA 3T8BA 1EF9A 4OLQA 4ELSA 4ZDBA 2VSSA 5HUQA 3GLMA 1TG6A 4JCRA 4JCSA 4OMRA 5JBXA 3GMAA 3T89A 4K2NA 4WYOB 4FNBA 4K3WA 1FCFA 3M6MA 1FC6A 3WG5A 5FIFA 4U19A 5C90A 5E0NX 2CBYA 3TVUA 1XNWA 1WDKA 5DU8A 5MGBA 3PGQA 2A7SA 3Q0JA 2Q34A 3BPTA 2D3TA 4ZDDA 1HNOA 4ELXA 1EY3A 1ON9A 3RSTA 2A81A 3LAOA 3IBBA 4I4ZA 3STAA 3QXIA 3GF3A 4ZDFA 2YJGA 4JOTA 4IZBA 2VSUE 3QKAA 3HE2A 3GMFA 3G64A 3QK8A 4I42A 5DKPA 3QXZA 3KTIA 4ASIA 5CTCA 3FDUA 3Q0GA 3QREA 3DUPA 3TVWA 2FBMA 3ZW8A 1EF8A 4ZDCA 4LK5A 4OG1A 1SG4A 2ZL0A 3TT7A 1WZ8A 2J5GA 1W2XA 3DORA 3Q7HA 3K50A 3SWXA 3MYBA 2PG8A 2WTBA 4JCTA 3R9SA 2J5IB 3R9TA 1WDLA 2C8TA 5DTWA 1WDMA 3NJDA 1YG8A 1J7XA 4U0GH 2ZL2A 3QWDA 4QIIA 4U1AA 1Y7OA 4J2UA 3TV5A 3TLFA 1BPLA 3U9RB 3V5EA 1TYFA 1HZDA 3RSIA 5INFA 2IEXA 4QIJA 5G1SA 2FZSA 1N6EA 5C9GA 3T3WA 2VSSE 1DCIA 1N6DA 2GTRA 4NARA 3TZ3A 5DZKH 3H02A 1XNVA 3U9SB 1NZYA 4KWBA 4QFEA 1FC7A 3PE8A 4MXIA 2A7KA 4JC0A 2DXNA 3GHFA 3ZWCA 3JU1A 4GM2A 2VSUC 3VIVA 1Q51A 1PJHA 4K29A 1Q52A 3OMEA 5KDRA 4RCNA 4FN7A 2DXLA 5JBWA 3IAVA 2ZQQA 1HNUA 4JWVA 3R6HA 1PIXA 2J5SA 2F6IA 2EJ5A 3HINA 3KTJA 3H0UA 3ST9A 2DEOA 4HNKA 3IB9A 3BEZA 1O8UA 1OD4A 2J5II 1UYRA 5DUCA 1DUBA 5G1RA 1YG6A 4F47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0H A;  3KTG A;  2VSS F;  3GKB A;  5DUF A;  3T8A A;  3K8X A;  4JCQ A;  2VRE A;  2F9I A;  1FC9 A;  2F6Q A;  2F9Y B;  4FJW D;  4NEK A;  4MI2 A;  5KDR B;  4ELW A;  4U0G A;  2ZQR A;  2X24 A;  5CTB A;  3BF0 A;  3FF6 A;  3KTK A;  3N6R B;  3QMJ A;  4JFC A;  3HP0 A;  2ZL4 A;  3TDC A;  3LKE A;  4FZW C;  5IKL B;  4JJT A;  5E0S A;  3HLN 1;  4JSB A;  4Q1I A;  2UZF A;  2HW5 A;  1JXZ A;  1VRG A;  3BPP A;  3T88 A;  3KTH A;  3R9Q A;  4L8K A;  3QYR A;  5G1Q A;  3TT6 A;  3P5M A;  1UIY A;  4JYL A;  1ON3 A;  1SZO A;  5ING A;  3PEA A;  4WZ8 B;  2X58 A;  4MOU A;  4NNQ A;  4EMP A;  3R0O A;  3GF7 A;  5DU6 A;  5DTP A;  3H0Q A;  1X0U A;  5E0S H;  1MJ3 A;  2DUB A;  3RRV A;  2CE3 A;  3H0S A;  1RJN A;  3PZK A;  4KPK A;  3I47 A;  2VSU A;  1XX4 A;  3V5I A;  3DJA A;  5KJP A;  2ZL3 A;  4U18 A;  4IZC A;  4FZW A;  2W3P A;  3ZW9 A;  4JYJ A;  5FUS A;  1UYV A;  1NZY B;  3HRX A;  4L6W A;  2PBP A;  4RYF H;  3ZWA A;  3SLL A;  3H81 A;  2FW2 A;  4B3I A;  3M6N A;  3P2L A;  1N6F A;  3U9T B;  2F9I B;  4ZU2 A;  4KD6 A;  3ISA A;  4RYF A;  1XO6 A;  4GHN A;  5DL1 A;  4DI1 A;  3H0J A;  4I52 A;  4HC8 A;  5DZK A;  3OC7 A;  4G2R A;  2Q2X A;  2PPY A;  2VSU F;  3L3S A;  3KQF A;  2NP9 A;  2F9Y A;  3MOY A;  4B3J A;  4B3H A;  1RJM A;  2J5I A;  5DU4 A;  3NJB A;  4EML A;  4Z0M A;  4YLH A;  3ZWB A;  3MT6 A;  2BZR A;  1UYT A;  4ZDE A;  1K32 A;  3Q1T A;  2VX2 A;  3TRR A;  4WCZ A;  4FB8 A;  2J5G D;  4JVT A;  4Q0G A;  4FN8 A;  3OT6 A;  4IZD A;  2Q35 A;  1OD2 A;  3P85 A;  3MFM A;  5INI A;  1UYS A;  4KNP A;  2QQ3 A;  1K39 A;  1XNY A;  4EMM A;  4FND A;  3T8B A;  1EF9 A;  4OLQ A;  4ELS A;  4ZDB A;  2VSS A;  3GLM A;  1TG6 A;  4JCR A;  4JCS A;  4OMR A;  5JBX A;  3GMA A;  3T89 A;  4K2N A;  4WYO B;  4FNB A;  4K3W A;  1FCF A;  3M6M A;  1FC6 A;  5FIF A;  3WG5 A;  4U19 A;  5C90 A;  5E0N X;  2CBY A;  3TVU A;  1XNW A;  1WDK A;  5DU8 A;  5MGB A;  3PGQ A;  2A7S A;  3Q0J A;  2Q34 A;  2D3T A;  4ZDD A;  1HNO A;  4ELX A;  1EY3 A;  1ON9 A;  3RST A;  2A81 A;  3LAO A;  3IBB A;  4I4Z A;  3STA A;  3QXI A;  3GF3 A;  4ZDF A;  4JOT A;  4IZB A;  2VSU E;  3QKA A;  3HE2 A;  3G64 A;  3QK8 A;  4I42 A;  5DKP A;  3QXZ A;  3KTI A;  4ASI A;  5CTC A;  3FDU A;  3Q0G A;  3QRE A;  3TVW A;  2FBM A;  3ZW8 A;  1EF8 A;  4ZDC A;  4LK5 A;  4OG1 A;  1SG4 A;  2ZL0 A;  3TT7 A;  1WZ8 A;  2J5G A;  1W2X A;  3DOR A;  3Q7H A;  3K50 A;  3SWX A;  3MYB A;  2PG8 A;  2WTB A;  4JCT A;  3R9S A;  2J5I B;  3R9T A;  1WDL A;  2C8T A;  5DTW A;  1WDM A;  3NJD A;  1YG8 A;  1J7X A;  4U0G H;  2ZL2 A;  3QWD A;  4QII A;  4U1A A;  1Y7O A;  3TV5 A;  3TLF A;  3U9R B;  3V5E A;  1TYF A;  1HZD A;  3RSI A;  5INF A;  2IEX A;  4QIJ A;  5G1S A;  2FZS A;  1N6E A;  5C9G A;  3T3W A;  2VSS E;  1DCI A;  1N6D A;  2GTR A;  3TZ3 A;  5DZK H;  3H02 A;  1XNV A;  3U9S B;  1NZY A;  4KWB A;  4QFE A;  1FC7 A;  3PE8 A;  4MXI A;  2A7K A;  3ZWC A;  3JU1 A;  4GM2 A;  2VSU C;  3VIV A;  1Q51 A;  1PJH A;  4K29 A;  1Q52 A;  3OME A;  5KDR A;  4RCN A;  4FN7 A;  5JBW A;  3IAV A;  2ZQQ A;  1HNU A;  4JWV A;  3R6H A;  1PIX A;  2J5S A;  2F6I A;  2EJ5 A;  3HIN A;  3KTJ A;  3H0U A;  3ST9 A;  2DEO A;  4HNK A;  3IB9 A;  3BEZ A;  1O8U A;  1OD4 A;  2J5I I;  1UYR A;  5DUC A;  1DUB A;  5G1R A;  1YG6 A;  4F47 A; 
#chains in the Genus database with same CATH topology
 2ZOA A;  4U0H A;  3KTG A;  1TID B;  2VSS F;  3GKB A;  5DUF A;  3T8A A;  3K8X A;  4JCQ A;  2VRE A;  2F9I A;  1FC9 A;  3LKL A;  2F6Q A;  2F9Y B;  4FJW D;  4NEK A;  4MI2 A;  5KDR B;  4ELW A;  4U0G A;  2ZQR A;  2X24 A;  5CTB A;  3BF0 A;  3FF6 A;  3KTK A;  3N6R B;  3QMJ A;  4JFC A;  3HP0 A;  1WXX A;  2ZL4 A;  3TDC A;  3LKE A;  4FZW C;  5IKL B;  4JJT A;  5E0S A;  3HLN 1;  4JSB A;  4Q1I A;  3MOG A;  3GVK A;  2HW5 A;  2UZF A;  1JXZ A;  2ZO9 B;  1VRG A;  3BPP A;  1BUZ A;  3T88 A;  3KTH A;  5G1Q A;  4L8K A;  3QYR A;  3R9Q A;  3D03 A;  3TT6 A;  3V97 A;  3P5M A;  1UIY A;  4JYL A;  5EUW A;  1ON3 A;  1SZO A;  5ING A;  3PEA A;  4WZ8 B;  2X58 A;  1TIL B;  4MOU A;  4NNQ A;  4EMP A;  2AS0 A;  3R0O A;  3GF7 A;  5DU6 A;  5DTP A;  5EUS A;  2VY9 A;  3H0Q A;  1X0U A;  4HYL A;  5E0S H;  1MJ3 A;  2DUB A;  3RRV A;  2CE3 A;  3H0S A;  1RJN A;  3PZK A;  4KPK A;  3I47 A;  2VSU A;  1H4Y A;  1XX4 A;  3V5I A;  3DJA A;  5KJP A;  2ZL3 A;  4L1C A;  4U18 A;  4HDT A;  4IZC A;  4FZW A;  1VC1 A;  2RRL A;  3IHB A;  5EUZ A;  2W3P A;  3ZW9 A;  4JYJ A;  5FUS A;  1UYV A;  1NZY B;  3HRX A;  4L6W A;  2PBP A;  4RYF H;  3ZWA A;  3SLL A;  3H81 A;  2FW2 A;  1TH8 B;  3AGD A;  4B3I A;  3M6N A;  3P2L A;  1V0E A;  1N6F A;  3U9T B;  2F9I B;  4ZU2 A;  4KD6 A;  3ISA A;  4RYF A;  1XO6 A;  4GHN A;  4AE2 A;  5DL1 A;  3IF5 A;  4DI1 A;  3H0J A;  3IHA A;  3NY7 A;  4I52 A;  4HC8 A;  4XS5 A;  5DZK A;  3OC7 A;  4G2R A;  2Q2X A;  2KA5 A;  2PPY A;  2VSU F;  3L3S A;  3KQF A;  2NP9 A;  2F9Y A;  3MOY A;  4B3J A;  4B3H A;  3V8V A;  4AEJ A;  1RJM A;  2J5I A;  5DU4 A;  1T6R A;  3MGL A;  3NJB A;  4EML A;  3ZXN A;  4Z0M A;  4YLH A;  3ZWB A;  3MT6 A;  2BZR A;  1UYT A;  4ZDE A;  1K32 A;  3Q1T A;  2VX2 A;  3TRR A;  4WCZ A;  4FB8 A;  3JU4 A;  2J5G D;  3LDF A;  2KLN A;  4JVT A;  4Q0G A;  4FN8 A;  3OT6 A;  3IH9 A;  1H4X A;  4IZD A;  2Q35 A;  1OD2 A;  3VSE A;  3P85 A;  3MFM A;  5INI A;  1UYS A;  4KNP A;  3OIZ A;  2QQ3 A;  1K39 A;  1XNY A;  4EMM A;  4FND A;  2CWW A;  3T8B A;  1THN B;  1EF9 A;  4OLQ A;  3T6O A;  3F43 A;  3GVL A;  4ELS A;  4ZDB A;  2VSS A;  5HUQ A;  5EZB A;  3GLM A;  1TG6 A;  4JCR A;  3OIR A;  4JCS A;  4OMR A;  5JBX A;  3GMA A;  3AGE A;  3T89 A;  4K2N A;  4WYO B;  4FNB A;  4K3W A;  1FCF A;  3M6M A;  1FC6 A;  5FIF A;  3WG5 A;  5EUU A;  4DMG A;  4U19 A;  5C90 A;  5E0N X;  2CBY A;  3LLO A;  3TVU A;  1XNW A;  1WDK A;  5DU8 A;  4DGH A;  5MGB A;  3PGQ A;  2A7S A;  3Q0J A;  2Q34 A;  3BPT A;  2D3T A;  4ZDD A;  1HNO A;  4ELX A;  1EY3 A;  1ON9 A;  3RST A;  2A81 A;  3LAO A;  3IBB A;  3GVJ A;  4I4Z A;  3STA A;  3QXI A;  3GF3 A;  4ZDF A;  2YJG A;  4JOT A;  4DGF A;  3QDQ A;  4IZB A;  2VSU E;  3QKA A;  3HE2 A;  3GMF A;  3G64 A;  3QK8 A;  4I42 A;  5DKP A;  3QXZ A;  3KTI A;  4ASI A;  5CTC A;  1WXW A;  3FDU A;  3Q0G A;  3QRE A;  3DUP A;  3TVW A;  2FBM A;  3ZW8 A;  1EF8 A;  4ZDC A;  4LK5 A;  4OG1 A;  1V0F A;  1SG4 A;  2ZL0 A;  3TT7 A;  3ZTB A;  3EH7 A;  1WZ8 A;  2J5G A;  1W2X A;  3DOR A;  3Q7H A;  3K50 A;  3SWX A;  3MYB A;  1AUZ A;  2PG8 A;  2WTB A;  4JCT A;  1SBO A;  3R9S A;  2J5I B;  3R9T A;  1WDL A;  2C8T A;  5DTW A;  1WDM A;  3NJD A;  1YG8 A;  1J7X A;  4U0G H;  2ZL2 A;  3QWD A;  4QII A;  4U1A A;  1Y7O A;  4J2U A;  3TV5 A;  3TLF A;  4HIZ A;  1BPL A;  4QTP A;  3U9R B;  3V5E A;  1TYF A;  1HZD A;  3RSI A;  3D3U A;  5INF A;  2IEX A;  4QIJ A;  5G1S A;  2FZS A;  1N6E A;  5EUX A;  5C9G A;  3C0K A;  2B78 A;  3T3W A;  2VSS E;  1DCI A;  1H4Z A;  2OAS A;  1N6D A;  2GTR A;  4NAR A;  1HF2 A;  3TZ3 A;  5DZK H;  3H02 A;  1XNV A;  3U9S B;  1NZY A;  4KWB A;  4QFE A;  1FC7 A;  3PE8 A;  4MXI A;  2A7K A;  4JC0 A;  2DXN A;  3GHF A;  3ZWC A;  3JU1 A;  4GM2 A;  2VSU C;  3VIV A;  1Q51 A;  1PJH A;  4K29 A;  1Q52 A;  3OME A;  3IH8 A;  5KDR A;  4RCN A;  4FN7 A;  2DXL A;  5JBW A;  3IAV A;  2ZQQ A;  1HNU A;  4JWV A;  3R6H A;  1PIX A;  2J5S A;  2F6I A;  2EJ5 A;  3HIN A;  3KTJ A;  3H0U A;  3ST9 A;  2DEO A;  4HNK A;  3IB9 A;  3BEZ A;  1O8U A;  1OD4 A;  3GK7 A;  2J5I I;  1UYR A;  5DUC A;  1DUB A;  5G1R A;  1YG6 A;  4F47 A; 
#chains in the Genus database with same CATH homology
 2ZOA A;  4U0H A;  3KTG A;  2VSS F;  3GKB A;  5DUF A;  3T8A A;  3K8X A;  4JCQ A;  2VRE A;  2F9I A;  1FC9 A;  2F6Q A;  2F9Y B;  4FJW D;  4NEK A;  4MI2 A;  5KDR B;  4ELW A;  4U0G A;  2ZQR A;  2X24 A;  5CTB A;  3BF0 A;  3FF6 A;  3KTK A;  3N6R B;  3QMJ A;  4JFC A;  3HP0 A;  2ZL4 A;  3TDC A;  3LKE A;  4FZW C;  5IKL B;  4JJT A;  5E0S A;  3HLN 1;  4JSB A;  4Q1I A;  3MOG A;  2UZF A;  2HW5 A;  1JXZ A;  2ZO9 B;  1VRG A;  3BPP A;  3T88 A;  3KTH A;  5G1Q A;  3R9Q A;  4L8K A;  3QYR A;  3D03 A;  3TT6 A;  3P5M A;  1UIY A;  4JYL A;  1ON3 A;  1SZO A;  5ING A;  3PEA A;  4WZ8 B;  2X58 A;  4MOU A;  4NNQ A;  4EMP A;  3R0O A;  3GF7 A;  5DU6 A;  5DTP A;  3H0Q A;  1X0U A;  5E0S H;  1MJ3 A;  2DUB A;  3RRV A;  2CE3 A;  3H0S A;  1RJN A;  3PZK A;  4KPK A;  3I47 A;  2VSU A;  1XX4 A;  3V5I A;  3DJA A;  5KJP A;  2ZL3 A;  4L1C A;  4U18 A;  4HDT A;  4IZC A;  4FZW A;  2RRL A;  2W3P A;  3ZW9 A;  4JYJ A;  5FUS A;  1UYV A;  1NZY B;  3HRX A;  4L6W A;  2PBP A;  4RYF H;  3ZWA A;  3SLL A;  3H81 A;  2FW2 A;  4B3I A;  3M6N A;  3P2L A;  1N6F A;  3U9T B;  2F9I B;  4ZU2 A;  4KD6 A;  3ISA A;  4RYF A;  1XO6 A;  4GHN A;  4AE2 A;  5DL1 A;  4DI1 A;  3H0J A;  4I52 A;  4HC8 A;  5DZK A;  3OC7 A;  4G2R A;  2Q2X A;  2PPY A;  2VSU F;  3L3S A;  3KQF A;  2NP9 A;  2F9Y A;  3MOY A;  4B3J A;  4B3H A;  4AEJ A;  1RJM A;  2J5I A;  5DU4 A;  3NJB A;  4EML A;  4Z0M A;  4YLH A;  3ZWB A;  3MT6 A;  2BZR A;  1UYT A;  4ZDE A;  1K32 A;  3Q1T A;  2VX2 A;  3TRR A;  4WCZ A;  4FB8 A;  2J5G D;  4JVT A;  4Q0G A;  4FN8 A;  3OT6 A;  4IZD A;  2Q35 A;  1OD2 A;  3P85 A;  3MFM A;  5INI A;  1UYS A;  4KNP A;  2QQ3 A;  1K39 A;  1XNY A;  4EMM A;  4FND A;  3T8B A;  1EF9 A;  4OLQ A;  4ELS A;  4ZDB A;  2VSS A;  5HUQ A;  3GLM A;  1TG6 A;  4JCR A;  4JCS A;  4OMR A;  5JBX A;  3GMA A;  3T89 A;  4K2N A;  4WYO B;  4FNB A;  4K3W A;  1FCF A;  3M6M A;  1FC6 A;  3WG5 A;  5FIF A;  4U19 A;  5C90 A;  5E0N X;  2CBY A;  3TVU A;  1XNW A;  1WDK A;  5DU8 A;  5MGB A;  3PGQ A;  2A7S A;  3Q0J A;  2Q34 A;  3BPT A;  2D3T A;  4ZDD A;  1HNO A;  4ELX A;  1EY3 A;  1ON9 A;  3RST A;  2A81 A;  3LAO A;  3IBB A;  4I4Z A;  3STA A;  3QXI A;  3GF3 A;  4ZDF A;  2YJG A;  4JOT A;  4IZB A;  2VSU E;  3QKA A;  3HE2 A;  3GMF A;  3G64 A;  3QK8 A;  4I42 A;  5DKP A;  3QXZ A;  3KTI A;  4ASI A;  5CTC A;  3FDU A;  3Q0G A;  3QRE A;  3DUP A;  3TVW A;  2FBM A;  3ZW8 A;  1EF8 A;  4ZDC A;  4LK5 A;  4OG1 A;  1SG4 A;  2ZL0 A;  3TT7 A;  1WZ8 A;  2J5G A;  1W2X A;  3DOR A;  3Q7H A;  3K50 A;  3SWX A;  3MYB A;  2PG8 A;  2WTB A;  4JCT A;  3R9S A;  2J5I B;  3R9T A;  1WDL A;  2C8T A;  5DTW A;  1WDM A;  3NJD A;  1YG8 A;  1J7X A;  4U0G H;  2ZL2 A;  3QWD A;  4QII A;  4U1A A;  1Y7O A;  4J2U A;  3TV5 A;  3TLF A;  1BPL A;  3U9R B;  3V5E A;  1TYF A;  1HZD A;  3RSI A;  5INF A;  2IEX A;  4QIJ A;  5G1S A;  2FZS A;  1N6E A;  5C9G A;  3T3W A;  2VSS E;  1DCI A;  1N6D A;  2GTR A;  4NAR A;  3TZ3 A;  5DZK H;  3H02 A;  1XNV A;  3U9S B;  1NZY A;  4KWB A;  4QFE A;  1FC7 A;  3PE8 A;  4MXI A;  2A7K A;  4JC0 A;  2DXN A;  3GHF A;  3ZWC A;  3JU1 A;  4GM2 A;  2VSU C;  3VIV A;  1Q51 A;  1PJH A;  4K29 A;  1Q52 A;  3OME A;  5KDR A;  4RCN A;  4FN7 A;  2DXL A;  5JBW A;  3IAV A;  2ZQQ A;  1HNU A;  4JWV A;  3R6H A;  1PIX A;  2J5S A;  2F6I A;  2EJ5 A;  3HIN A;  3KTJ A;  3H0U A;  3ST9 A;  2DEO A;  4HNK A;  3IB9 A;  3BEZ A;  1O8U A;  1OD4 A;  2J5I I;  1UYR A;  5DUC A;  1DUB A;  5G1R A;  1YG6 A;  4F47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...