1BUZA

Solution structure of spoiiaa, a phosphorylatable component of the system that regulates transcription factor sigma-f of bacillus subtilis nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
SLGIDMNVKESVLCIRLTGELDHHTAETLKQKVTQSLEKDDIRHIVLNLEDLSFMDSSGLGVILGRYKQIKQIGGEMVVCAISPAVKRLFDMSGLFKIIRFEQSEQQALLTLGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords SPOIIAA
publication title Solution structure of SpoIIAA, a phosphorylatable component of the system that regulates transcription factor sigmaF of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 20
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1997-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1buzA00
3LLOA 3AGEA 3IH9A 1TIDB 5EUUA 3T6OA 3IF5A 1THNB 4HYLA 3NY7A 1SBOA 3OIZA 4DGHA 3LKLA 1AUZA 5EUZA 4DGFA 3ZXNA 3OIRA 1H4XA 1H4ZA 1TH8B 2VY9A 5EUWA 3IHBA 2KA5A 1BUZA 1VC1A 4QTPA 1TILB 3MGLA 4XS5A 3ZTBA 5EUXA 5EZBA 3IHAA 3AGDA 1T6RA 3F43A 5EUSA 3IH8A 1H4YA 2KLNA
chains in the Genus database with same CATH superfamily
2DXLA 4L1CA 2CWWA 4DGFA 1H4ZA 4GHNA 1FC9A 2DXNA 2OASA 1VC1A 2B78A 1TILB 1HF2A 3MGLA 3ZTBA 3GHFA 3AGDA 3GMFA 4AEJA 4DMGA 2KLNA 1FC7A 3GVJA 3AGEA 3T6OA 1THNB 3DJAA 1BPLA 3LKLA 1AUZA 3V97A 3JU4A 1FC6A 3MOGA 1N6EA 2VY9A 2KA5A 3D3UA 3LDFA 3QDQA 4XS5A 4AE2A 3C0KA 5EUXA 1H4YA 2ZOAA 3GVKA 3F43A 5EUSA 3VSEA 3LLOA 3GK7A 1TIDB 5EUUA 1J7XA 4HYLA 2AS0A 3DUPA 1SBOA 1WXWA 3OIZA 4DGHA 5EUZA 3K50A 3ZXNA 3OIRA 1H4XA 1N6DA 1N6FA 5EUWA 3IHBA 1BUZA 4L8KA 4QTPA 3D03A 3DORA 4JC0A 1T6RA 3IH8A 3IH9A 3IF5A 4HIZA 1V0FA 1FCFA 3NY7A 1V0EA 1TH8B 3GVLA 2RRLA 2ZO9B 5EZBA 3IHAA 1WXXA 3V8VA 1K32A 3EH7A
chains in the Genus database with same CATH topology
3LLOA 3AGEA 3IH9A 1TIDB 5EUUA 3T6OA 3IF5A 1THNB 4HYLA 3NY7A 1SBOA 3OIZA 4DGHA 3LKLA 1AUZA 5EUZA 4DGFA 3ZXNA 3OIRA 1H4XA 1H4ZA 1TH8B 2VY9A 5EUWA 3IHBA 2KA5A 1BUZA 1VC1A 4QTPA 1TILB 3MGLA 4XS5A 3ZTBA 5EUXA 5EZBA 3IHAA 3AGDA 1T6RA 3F43A 5EUSA 3IH8A 1H4YA 2KLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLO A;  3AGE A;  3IH9 A;  1TID B;  5EUU A;  3T6O A;  3IF5 A;  1THN B;  4HYL A;  3NY7 A;  1SBO A;  3OIZ A;  4DGH A;  3LKL A;  1AUZ A;  5EUZ A;  4DGF A;  3ZXN A;  3OIR A;  1H4X A;  1H4Z A;  1TH8 B;  2VY9 A;  5EUW A;  3IHB A;  2KA5 A;  1BUZ A;  1VC1 A;  4QTP A;  1TIL B;  3MGL A;  4XS5 A;  3ZTB A;  5EUX A;  5EZB A;  3IHA A;  3AGD A;  1T6R A;  3F43 A;  5EUS A;  3IH8 A;  1H4Y A;  2KLN A; 
#chains in the Genus database with same CATH topology
 2DXL A;  4L1C A;  2CWW A;  4DGF A;  1H4Z A;  4GHN A;  1FC9 A;  2DXN A;  2OAS A;  1VC1 A;  2B78 A;  1TIL B;  1HF2 A;  3MGL A;  3ZTB A;  3GHF A;  3AGD A;  3GMF A;  4AEJ A;  4DMG A;  2KLN A;  1FC7 A;  3GVJ A;  3AGE A;  3T6O A;  1THN B;  3DJA A;  1BPL A;  3LKL A;  1AUZ A;  3V97 A;  3JU4 A;  1FC6 A;  3MOG A;  1N6E A;  2VY9 A;  2KA5 A;  3D3U A;  3LDF A;  3QDQ A;  4XS5 A;  4AE2 A;  3C0K A;  5EUX A;  1H4Y A;  2ZOA A;  3GVK A;  3F43 A;  5EUS A;  3VSE A;  3LLO A;  3GK7 A;  1TID B;  5EUU A;  1J7X A;  4HYL A;  2AS0 A;  3DUP A;  1SBO A;  1WXW A;  3OIZ A;  4DGH A;  5EUZ A;  3K50 A;  3ZXN A;  3OIR A;  1H4X A;  1N6D A;  1N6F A;  5EUW A;  3IHB A;  1BUZ A;  4L8K A;  4QTP A;  3D03 A;  3DOR A;  4JC0 A;  1T6R A;  3IH8 A;  3IH9 A;  3IF5 A;  4HIZ A;  1V0F A;  1FCF A;  3NY7 A;  1V0E A;  1TH8 B;  3GVL A;  2RRL A;  2ZO9 B;  5EZB A;  3IHA A;  1WXX A;  3V8V A;  1K32 A;  3EH7 A; 
#chains in the Genus database with same CATH homology
 3LLO A;  3AGE A;  3IH9 A;  1TID B;  5EUU A;  3T6O A;  3IF5 A;  1THN B;  4HYL A;  3NY7 A;  1SBO A;  3OIZ A;  4DGH A;  3LKL A;  1AUZ A;  5EUZ A;  4DGF A;  3ZXN A;  3OIR A;  1H4X A;  1H4Z A;  1TH8 B;  2VY9 A;  5EUW A;  3IHB A;  2KA5 A;  1BUZ A;  1VC1 A;  4QTP A;  1TIL B;  3MGL A;  4XS5 A;  3ZTB A;  5EUX A;  5EZB A;  3IHA A;  3AGD A;  1T6R A;  3F43 A;  5EUS A;  3IH8 A;  1H4Y A;  2KLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...