1BUZA

Solution structure of spoiiaa, a phosphorylatable component of the system that regulates transcription factor sigma-f of bacillus subtilis nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
SLGIDMNVKESVLCIRLTGELDHHTAETLKQKVTQSLEKDDIRHIVLNLEDLSFMDSSGLGVILGRYKQIKQIGGEMVVCAISPAVKRLFDMSGLFKIIRFEQSEQQALLTLGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPOIIAA
publication title Solution structure of SpoIIAA, a phosphorylatable component of the system that regulates transcription factor sigmaF of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
total genus 20
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1997-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1buzA00
3F43A 3ZXNA 1AUZA 5EZBA 3AGDA 5EUXA 1SBOA 3IHAA 4DGHA 1TH8B 1H4XA 5EUSA 4DGFA 1H4YA 3OIZA 5EUWA 3MGLA 3NY7A 1TILB 1VC1A 2KA5A 3IH8A 1THNB 4QTPA 3IHBA 2VY9A 5EUZA 3OIRA 3ZTBA 4HYLA 1H4ZA 1BUZA 4XS5A 3T6OA 3IH9A 1TIDB 5EUUA 3AGEA 3LKLA 3LLOA 2KLNA 3IF5A 1T6RA
chains in the Genus database with same CATH superfamily
5EZBA 1SBOA 3IHAA 4DGHA 1TH8B 5EUSA 4DGFA 3GK7A 3K50A 3V97A 3MGLA 4DMGA 1BPLA 3DJAA 1FC6A 2ZO9B 3OIRA 3ZTBA 4AE2A 1BUZA 4XS5A 3DUPA 5EUUA 2DXNA 1T6RA 4HIZA 3QDQA 1J7XA 2AS0A 1H4XA 2ZOAA 1H4YA 3GVJA 5EUWA 1N6EA 1WXXA 3NY7A 1VC1A 2RRLA 3IHBA 3JU4A 5EUZA 3IH9A 3D03A 1HF2A 4JC0A 3V8VA 3IF5A 3VSEA 1AUZA 3MOGA 2OASA 4AEJA 1FC9A 3GHFA 3OIZA 3D3UA 1THNB 3IH8A 4QTPA 1K32A 2VY9A 4L1CA 1N6DA 4HYLA 1H4ZA 3LDFA 3C0KA 1N6FA 3LKLA 1WXWA 1FC7A 2B78A 3GVLA 3LLOA 2CWWA 3F43A 3ZXNA 3AGDA 5EUXA 4L8KA 3GMFA 3GVKA 1TILB 2KA5A 2DXLA 1V0FA 1V0EA 4GHNA 3T6OA 1TIDB 3AGEA 2KLNA 1FCFA 3DORA 3EH7A
chains in the Genus database with same CATH topology
3F43A 3ZXNA 1AUZA 5EZBA 3AGDA 5EUXA 1SBOA 3IHAA 4DGHA 1TH8B 1H4XA 5EUSA 4DGFA 1H4YA 3OIZA 5EUWA 3MGLA 3NY7A 1TILB 1VC1A 2KA5A 3IH8A 1THNB 4QTPA 3IHBA 2VY9A 5EUZA 3OIRA 3ZTBA 4HYLA 1H4ZA 1BUZA 4XS5A 3T6OA 3IH9A 1TIDB 5EUUA 3AGEA 3LKLA 3LLOA 2KLNA 3IF5A 1T6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F43 A;  3ZXN A;  1AUZ A;  5EZB A;  3AGD A;  5EUX A;  1SBO A;  3IHA A;  4DGH A;  1TH8 B;  1H4X A;  5EUS A;  4DGF A;  1H4Y A;  3OIZ A;  5EUW A;  3MGL A;  3NY7 A;  1TIL B;  1VC1 A;  2KA5 A;  3IH8 A;  1THN B;  4QTP A;  3IHB A;  2VY9 A;  5EUZ A;  3OIR A;  3ZTB A;  4HYL A;  1H4Z A;  1BUZ A;  4XS5 A;  3T6O A;  3IH9 A;  1TID B;  5EUU A;  3AGE A;  3LKL A;  3LLO A;  2KLN A;  3IF5 A;  1T6R A; 
#chains in the Genus database with same CATH topology
 5EZB A;  1SBO A;  3IHA A;  4DGH A;  1TH8 B;  5EUS A;  4DGF A;  3GK7 A;  3K50 A;  3V97 A;  3MGL A;  4DMG A;  1BPL A;  3DJA A;  1FC6 A;  2ZO9 B;  3OIR A;  3ZTB A;  4AE2 A;  1BUZ A;  4XS5 A;  3DUP A;  5EUU A;  2DXN A;  1T6R A;  4HIZ A;  3QDQ A;  1J7X A;  2AS0 A;  1H4X A;  2ZOA A;  1H4Y A;  3GVJ A;  5EUW A;  1N6E A;  1WXX A;  3NY7 A;  1VC1 A;  2RRL A;  3IHB A;  3JU4 A;  5EUZ A;  3IH9 A;  3D03 A;  1HF2 A;  4JC0 A;  3V8V A;  3IF5 A;  3VSE A;  1AUZ A;  3MOG A;  2OAS A;  4AEJ A;  1FC9 A;  3GHF A;  3OIZ A;  3D3U A;  1THN B;  3IH8 A;  4QTP A;  1K32 A;  2VY9 A;  4L1C A;  1N6D A;  4HYL A;  1H4Z A;  3LDF A;  3C0K A;  1N6F A;  3LKL A;  1WXW A;  1FC7 A;  2B78 A;  3GVL A;  3LLO A;  2CWW A;  3F43 A;  3ZXN A;  3AGD A;  5EUX A;  4L8K A;  3GMF A;  3GVK A;  1TIL B;  2KA5 A;  2DXL A;  1V0F A;  1V0E A;  4GHN A;  3T6O A;  1TID B;  3AGE A;  2KLN A;  1FCF A;  3DOR A;  3EH7 A; 
#chains in the Genus database with same CATH homology
 3F43 A;  3ZXN A;  1AUZ A;  5EZB A;  3AGD A;  5EUX A;  1SBO A;  3IHA A;  4DGH A;  1TH8 B;  1H4X A;  5EUS A;  4DGF A;  1H4Y A;  3OIZ A;  5EUW A;  3MGL A;  3NY7 A;  1TIL B;  1VC1 A;  2KA5 A;  3IH8 A;  1THN B;  4QTP A;  3IHB A;  2VY9 A;  5EUZ A;  3OIR A;  3ZTB A;  4HYL A;  1H4Z A;  1BUZ A;  4XS5 A;  3T6O A;  3IH9 A;  1TID B;  5EUU A;  3AGE A;  3LKL A;  3LLO A;  2KLN A;  3IF5 A;  1T6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...