2KLNA

Solution structure of stas domain of rv1739c from m. tuberculosis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
MHDIDDYPQAKRVPGLVVYRYDAPLCFANAEDFRRRALTVVDQDPGQVEWFVLNAESNVEVDLTALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDKIGEDHIFMTLPTAVQAFRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PROBABLE SULPHATE-TRANSPORT TRANSMEMBRANE PROTEIN, COG0659
publication title Solution Structure of the Guanine Nucleotide-binding STAS Domain of SLC26-related SulP Protein Rv1739c from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium bovis
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 2klnA00
4HYLA 3OIZA 1TILB 1AUZA 1BUZA 3OIRA 5EUXA 1VC1A 3NY7A 2KA5A 5EUWA 1H4XA 4XS5A 3T6OA 1THNB 1H4YA 3AGEA 3LLOA 5EUZA 4DGFA 3ZTBA 3IHBA 1H4ZA 1T6RA 5EUSA 3F43A 5EZBA 4DGHA 1TIDB 1TH8B 1SBOA 4QTPA 3IH8A 3ZXNA 3MGLA 3IF5A 2VY9A 3AGDA 3LKLA 5EUUA 3IHAA 2KLNA 3IH9A
chains in the Genus database with same CATH superfamily
3OIZA 1WXXA 3GVJA 1AUZA 2RRLA 3OIRA 5EUXA 4AEJA 3T6OA 1N6FA 1H4YA 2AS0A 1N6EA 1H4ZA 1J7XA 1V0EA 5EUSA 2B78A 1TH8B 1HF2A 3MGLA 4L1CA 3GHFA 3AGDA 5EUUA 4AE2A 1FC9A 4HYLA 4JC0A 3C0KA 3GMFA 1BUZA 3DUPA 1H4XA 4XS5A 1THNB 2DXNA 3AGEA 1FC7A 3DJAA 3VSEA 4DGFA 1T6RA 4DGHA 2ZO9B 1BPLA 3IH8A 2CWWA 3DORA 3GK7A 1FCFA 3MOGA 3IH9A 1TILB 1V0FA 1VC1A 2OASA 3GVKA 3D3UA 2KA5A 4GHNA 1WXWA 3D03A 3JU4A 3K50A 4DMGA 5EZBA 1SBOA 3ZXNA 3IF5A 2ZOAA 1N6DA 3LKLA 3GVLA 2KLNA 3EH7A 3NY7A 1K32A 3V97A 5EUWA 3QDQA 3LLOA 1FC6A 5EUZA 4HIZA 3ZTBA 3IHBA 3F43A 2DXLA 1TIDB 4QTPA 2VY9A 4L8KA 3V8VA 3LDFA 3IHAA
chains in the Genus database with same CATH topology
4HYLA 3OIZA 1TILB 1AUZA 1BUZA 3OIRA 5EUXA 1VC1A 3NY7A 2KA5A 5EUWA 1H4XA 4XS5A 3T6OA 1THNB 1H4YA 3AGEA 3LLOA 5EUZA 4DGFA 3ZTBA 3IHBA 1H4ZA 1T6RA 5EUSA 3F43A 5EZBA 4DGHA 1TIDB 1TH8B 1SBOA 4QTPA 3IH8A 3ZXNA 3MGLA 3IF5A 2VY9A 3AGDA 3LKLA 5EUUA 3IHAA 2KLNA 3IH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYL A;  3OIZ A;  1TIL B;  1AUZ A;  1BUZ A;  3OIR A;  5EUX A;  1VC1 A;  3NY7 A;  2KA5 A;  5EUW A;  1H4X A;  4XS5 A;  3T6O A;  1THN B;  1H4Y A;  3AGE A;  3LLO A;  5EUZ A;  4DGF A;  3ZTB A;  3IHB A;  1H4Z A;  1T6R A;  5EUS A;  3F43 A;  5EZB A;  4DGH A;  1TID B;  1TH8 B;  1SBO A;  4QTP A;  3IH8 A;  3ZXN A;  3MGL A;  3IF5 A;  2VY9 A;  3AGD A;  3LKL A;  5EUU A;  3IHA A;  2KLN A;  3IH9 A; 
#chains in the Genus database with same CATH topology
 3OIZ A;  1WXX A;  3GVJ A;  1AUZ A;  2RRL A;  3OIR A;  5EUX A;  4AEJ A;  3T6O A;  1N6F A;  1H4Y A;  2AS0 A;  1N6E A;  1H4Z A;  1J7X A;  1V0E A;  5EUS A;  2B78 A;  1TH8 B;  1HF2 A;  3MGL A;  4L1C A;  3GHF A;  3AGD A;  5EUU A;  4AE2 A;  1FC9 A;  4HYL A;  4JC0 A;  3C0K A;  3GMF A;  1BUZ A;  3DUP A;  1H4X A;  4XS5 A;  1THN B;  2DXN A;  3AGE A;  1FC7 A;  3DJA A;  3VSE A;  4DGF A;  1T6R A;  4DGH A;  2ZO9 B;  1BPL A;  3IH8 A;  2CWW A;  3DOR A;  3GK7 A;  1FCF A;  3MOG A;  3IH9 A;  1TIL B;  1V0F A;  1VC1 A;  2OAS A;  3GVK A;  3D3U A;  2KA5 A;  4GHN A;  1WXW A;  3D03 A;  3JU4 A;  3K50 A;  4DMG A;  5EZB A;  1SBO A;  3ZXN A;  3IF5 A;  2ZOA A;  1N6D A;  3LKL A;  3GVL A;  2KLN A;  3EH7 A;  3NY7 A;  1K32 A;  3V97 A;  5EUW A;  3QDQ A;  3LLO A;  1FC6 A;  5EUZ A;  4HIZ A;  3ZTB A;  3IHB A;  3F43 A;  2DXL A;  1TID B;  4QTP A;  2VY9 A;  4L8K A;  3V8V A;  3LDF A;  3IHA A; 
#chains in the Genus database with same CATH homology
 4HYL A;  3OIZ A;  1TIL B;  1AUZ A;  1BUZ A;  3OIR A;  5EUX A;  1VC1 A;  3NY7 A;  2KA5 A;  5EUW A;  1H4X A;  4XS5 A;  3T6O A;  1THN B;  1H4Y A;  3AGE A;  3LLO A;  5EUZ A;  4DGF A;  3ZTB A;  3IHB A;  1H4Z A;  1T6R A;  5EUS A;  3F43 A;  5EZB A;  4DGH A;  1TID B;  1TH8 B;  1SBO A;  4QTP A;  3IH8 A;  3ZXN A;  3MGL A;  3IF5 A;  2VY9 A;  3AGD A;  3LKL A;  5EUU A;  3IHA A;  2KLN A;  3IH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...