2KLNA

Solution structure of stas domain of rv1739c from m. tuberculosis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
b'MHDIDDYPQAKRVPGLVVYRYDAPLCFANAEDFRRRALTVVDQDPGQVEWFVLNAESNVEVDLTALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDKIGEDHIFMTLPTAVQAFRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE SULPHATE-TRANSPORT TRANSMEMBRANE PROTEIN, COG0659
publication title Solution Structure of the Guanine Nucleotide-binding STAS Domain of SLC26-related SulP Protein Rv1739c from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium bovis
molecule tags Transport protein
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 2klnA00
3F43A 3IH8A 3IHBA 1TIDB 2KLNA 3AGDA 5EUUA 5EUZA 3AGEA 4HYLA 1THNB 1H4YA 3T6OA 3IH9A 3ZTBA 4QTPA 4DGFA 1H4XA 5EUWA 2KA5A 5EZBA 1H4ZA 3LKLA 4DGHA 2VY9A 3LLOA 3NY7A 5EUSA 1TH8B 1VC1A 5EUXA 3IF5A 1AUZA 1BUZA 3OIRA 3ZXNA 3MGLA 1SBOA 3OIZA 1TILB 4XS5A 1T6RA 3IHAA
chains in the Genus database with same CATH superfamily
3IHBA 3DORA 1TIDB 2KLNA 3AGDA 4DMGA 1THNB 1N6FA 1H4YA 3GK7A 4QTPA 1H4XA 4DGHA 4L8KA 1FC7A 3EH7A 1VC1A 4GHNA 3V8VA 3D03A 3OIRA 3MGLA 1SBOA 4XS5A 3GVJA 1T6RA 3LDFA 2CWWA 1N6EA 4AEJA 4L1CA 2RRLA 3IH9A 3D3UA 1FC6A 5EUWA 2KA5A 5EZBA 1WXWA 3C0KA 3DUPA 3LKLA 1V0FA 3NY7A 1TH8B 1J7XA 1WXXA 1AUZA 1BUZA 3VSEA 1HF2A 2DXLA 1TILB 3IHAA 3F43A 3IH8A 1N6DA 3V97A 5EUUA 4HIZA 3T6OA 3K50A 3MOGA 1BPLA 3LLOA 4JC0A 5EUXA 3IF5A 3GVLA 3GMFA 3DJAA 3ZXNA 3OIZA 1K32A 2B78A 3GHFA 2ZOAA 2AS0A 2ZO9B 5EUZA 3AGEA 4HYLA 2OASA 4AE2A 3ZTBA 1FC9A 1FCFA 4DGFA 1H4ZA 3JU4A 2VY9A 5EUSA 2DXNA 1V0EA 3QDQA 3GVKA
chains in the Genus database with same CATH topology
3F43A 3IH8A 3IHBA 1TIDB 2KLNA 3AGDA 5EUUA 5EUZA 3AGEA 4HYLA 1THNB 1H4YA 3T6OA 3IH9A 3ZTBA 4QTPA 4DGFA 1H4XA 5EUWA 2KA5A 5EZBA 1H4ZA 3LKLA 4DGHA 2VY9A 3LLOA 3NY7A 5EUSA 1TH8B 1VC1A 5EUXA 3IF5A 1AUZA 1BUZA 3OIRA 3ZXNA 3MGLA 1SBOA 3OIZA 1TILB 4XS5A 1T6RA 3IHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F43 A;  3IH8 A;  3IHB A;  1TID B;  2KLN A;  3AGD A;  5EUU A;  5EUZ A;  3AGE A;  4HYL A;  1THN B;  1H4Y A;  3T6O A;  3IH9 A;  3ZTB A;  4QTP A;  4DGF A;  1H4X A;  5EUW A;  2KA5 A;  5EZB A;  1H4Z A;  3LKL A;  4DGH A;  2VY9 A;  3LLO A;  3NY7 A;  5EUS A;  1TH8 B;  1VC1 A;  5EUX A;  3IF5 A;  1AUZ A;  1BUZ A;  3OIR A;  3ZXN A;  3MGL A;  1SBO A;  3OIZ A;  1TIL B;  4XS5 A;  1T6R A;  3IHA A; 
#chains in the Genus database with same CATH topology
 3IHB A;  3DOR A;  1TID B;  2KLN A;  3AGD A;  4DMG A;  1THN B;  1N6F A;  1H4Y A;  3GK7 A;  4QTP A;  1H4X A;  4DGH A;  4L8K A;  1FC7 A;  3EH7 A;  1VC1 A;  4GHN A;  3V8V A;  3D03 A;  3OIR A;  3MGL A;  1SBO A;  4XS5 A;  3GVJ A;  1T6R A;  3LDF A;  2CWW A;  1N6E A;  4AEJ A;  4L1C A;  2RRL A;  3IH9 A;  3D3U A;  1FC6 A;  5EUW A;  2KA5 A;  5EZB A;  1WXW A;  3C0K A;  3DUP A;  3LKL A;  1V0F A;  3NY7 A;  1TH8 B;  1J7X A;  1WXX A;  1AUZ A;  1BUZ A;  3VSE A;  1HF2 A;  2DXL A;  1TIL B;  3IHA A;  3F43 A;  3IH8 A;  1N6D A;  3V97 A;  5EUU A;  4HIZ A;  3T6O A;  3K50 A;  3MOG A;  1BPL A;  3LLO A;  4JC0 A;  5EUX A;  3IF5 A;  3GVL A;  3GMF A;  3DJA A;  3ZXN A;  3OIZ A;  1K32 A;  2B78 A;  3GHF A;  2ZOA A;  2AS0 A;  2ZO9 B;  5EUZ A;  3AGE A;  4HYL A;  2OAS A;  4AE2 A;  3ZTB A;  1FC9 A;  1FCF A;  4DGF A;  1H4Z A;  3JU4 A;  2VY9 A;  5EUS A;  2DXN A;  1V0E A;  3QDQ A;  3GVK A; 
#chains in the Genus database with same CATH homology
 3F43 A;  3IH8 A;  3IHB A;  1TID B;  2KLN A;  3AGD A;  5EUU A;  5EUZ A;  3AGE A;  4HYL A;  1THN B;  1H4Y A;  3T6O A;  3IH9 A;  3ZTB A;  4QTP A;  4DGF A;  1H4X A;  5EUW A;  2KA5 A;  5EZB A;  1H4Z A;  3LKL A;  4DGH A;  2VY9 A;  3LLO A;  3NY7 A;  5EUS A;  1TH8 B;  1VC1 A;  5EUX A;  3IF5 A;  1AUZ A;  1BUZ A;  3OIR A;  3ZXN A;  3MGL A;  1SBO A;  3OIZ A;  1TIL B;  4XS5 A;  1T6R A;  3IHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...