The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
124
|
structure length |
124
|
Chain Sequence |
MHDIDDYPQAKRVPGLVVYRYDAPLCFANAEDFRRRALTVVDQDPGQVEWFVLNAESNVEVDLTALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDKIGEDHIFMTLPTAVQAFRRR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
PROBABLE SULPHATE-TRANSPORT TRANSMEMBRANE PROTEIN, COG0659
|
| publication title |
Solution Structure of the Guanine Nucleotide-binding STAS Domain of SLC26-related SulP Protein Rv1739c from Mycobacterium tuberculosis.
pubmed doi rcsb |
| source organism |
Mycobacterium bovis
|
| molecule tags |
Transport protein
|
| total genus |
34
|
| structure length |
124
|
| sequence length |
124
|
| ec nomenclature | |
| pdb deposition date | 2009-07-06 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Transcription Regulator spoIIAA | STAS domain |
#chains in the Genus database with same CATH superfamily 5EUX A; 3AGE A; 1AUZ A; 3LKL A; 2KA5 A; 3IH9 A; 5EUS A; 4XS5 A; 1SBO A; 3ZTB A; 3ZXN A; 5EUW A; 3IHA A; 1TIL B; 4DGF A; 4DGH A; 1H4Y A; 4QTP A; 3OIZ A; 1T6R A; 5EUZ A; 4HYL A; 1H4Z A; 3OIR A; 3T6O A; 1TID B; 5EZB A; 1BUZ A; 1TH8 B; 3LLO A; 3MGL A; 2VY9 A; 3NY7 A; 3AGD A; 1THN B; 1VC1 A; 3F43 A; 3IH8 A; 3IHB A; 2KLN A; 1H4X A; 5EUU A; 3IF5 A; #chains in the Genus database with same CATH topology 1BPL A; 1N6D A; 3VSE A; 1AUZ A; 3MOG A; 1WXX A; 1FC9 A; 2CWW A; 5EUW A; 4QTP A; 3OIZ A; 2ZOA A; 1T6R A; 3C0K A; 2RRL A; 3D03 A; 3GVK A; 1V0F A; 3OIR A; 1TID B; 1BUZ A; 2VY9 A; 4DMG A; 1THN B; 2OAS A; 1K32 A; 3F43 A; 3IH8 A; 2DXN A; 3IHB A; 3AGE A; 4AE2 A; 3IH9 A; 2B78 A; 3ZTB A; 3IHA A; 4DGH A; 1FC7 A; 4L8K A; 3V97 A; 5EUZ A; 3GMF A; 1H4Z A; 4HIZ A; 1N6F A; 1TH8 B; 3LLO A; 3MGL A; 3DUP A; 3AGD A; 1VC1 A; 4AEJ A; 4L1C A; 1J7X A; 1WXW A; 3IF5 A; 3LKL A; 3V8V A; 3GVJ A; 1SBO A; 3ZXN A; 4DGF A; 4JC0 A; 4GHN A; 4HYL A; 3QDQ A; 5EZB A; 1FC6 A; 3D3U A; 3DJA A; 1HF2 A; 2KLN A; 1H4X A; 2ZO9 B; 5EUX A; 2KA5 A; 1V0E A; 5EUS A; 4XS5 A; 3GVL A; 1TIL B; 3GHF A; 1FCF A; 1H4Y A; 3JU4 A; 2DXL A; 3LDF A; 3DOR A; 2AS0 A; 3T6O A; 3EH7 A; 3NY7 A; 3K50 A; 3GK7 A; 1N6E A; 5EUU A; #chains in the Genus database with same CATH homology 5EUX A; 3AGE A; 1AUZ A; 3LKL A; 2KA5 A; 3IH9 A; 5EUS A; 4XS5 A; 1SBO A; 3ZTB A; 3ZXN A; 5EUW A; 3IHA A; 1TIL B; 4DGF A; 4DGH A; 1H4Y A; 4QTP A; 3OIZ A; 1T6R A; 5EUZ A; 4HYL A; 1H4Z A; 3OIR A; 3T6O A; 1TID B; 5EZB A; 1BUZ A; 1TH8 B; 3LLO A; 3MGL A; 2VY9 A; 3NY7 A; 3AGD A; 1THN B; 1VC1 A; 3F43 A; 3IH8 A; 3IHB A; 2KLN A; 1H4X A; 5EUU A; 3IF5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
