4HYLA

The crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
NATDTQIRTEQGIDIITLHGHLDTRSSPAVQAAVLPRVTAKGKMILDLREVSYMSSAGLRVLLSLYRHTSNQQGALVLVGVSEEIRDTMEITGFWNFFTACASMDEALRILGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stage II sporulation protein
publication title The crystal structure of an anti-sigma-factor antagonist from Haliangium ochraceum DSM 14365
rcsb
source organism Haliangium ochraceum
molecule tags Transcription regulator
total genus 28
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 4hylA00
3ZXNA 1TH8B 4DGFA 3LLOA 1THNB 4QTPA 1VC1A 4DGHA 1TIDB 1SBOA 3T6OA 5EUWA 1H4ZA 5EUSA 3IHAA 3IH9A 2KA5A 3LKLA 3AGDA 4XS5A 1T6RA 1BUZA 1AUZA 3IF5A 5EZBA 3OIRA 3F43A 3IH8A 2VY9A 3NY7A 1H4YA 5EUUA 3ZTBA 1H4XA 5EUXA 1TILB 3OIZA 4HYLA 3IHBA 3MGLA 5EUZA 2KLNA 3AGEA
chains in the Genus database with same CATH superfamily
1TH8B 2DXLA 3VSEA 2CWWA 1SBOA 3IHAA 3LKLA 3AGDA 1AUZA 3F43A 3IH8A 4GHNA 4L8KA 3DUPA 1TILB 3GMFA 3OIZA 4HYLA 4AE2A 3IHBA 3MOGA 3MGLA 5EUZA 2KLNA 3AGEA 4DGFA 1BPLA 4HIZA 5EUWA 2AS0A 5EUSA 1FC9A 2KA5A 3JU4A 1BUZA 3LDFA 5EUUA 3C0KA 2ZOAA 1FCFA 3DJAA 3LLOA 2B78A 1VC1A 4L1CA 3EH7A 3T6OA 1WXWA 1V0EA 3IH9A 1FC7A 4XS5A 3GVJA 4AEJA 1N6EA 5EZBA 3V97A 2DXNA 1H4YA 3D3UA 3DORA 2RRLA 3ZTBA 1H4XA 2OASA 5EUXA 1J7XA 1WXXA 4DMGA 3GVLA 3ZXNA 4QTPA 1THNB 1K32A 4DGHA 1HF2A 1FC6A 1TIDB 1H4ZA 1N6DA 1N6FA 1T6RA 1V0FA 3D03A 3V8VA 3IF5A 3GHFA 3OIRA 2VY9A 3NY7A 2ZO9B 3GVKA 3GK7A 3QDQA 4JC0A 3K50A
chains in the Genus database with same CATH topology
3ZXNA 1TH8B 4DGFA 3LLOA 1THNB 4QTPA 1VC1A 4DGHA 1TIDB 1SBOA 3T6OA 5EUWA 1H4ZA 5EUSA 3IHAA 3IH9A 2KA5A 3LKLA 3AGDA 4XS5A 1T6RA 1BUZA 1AUZA 3IF5A 5EZBA 3OIRA 3F43A 3IH8A 2VY9A 3NY7A 1H4YA 5EUUA 3ZTBA 1H4XA 5EUXA 1TILB 3OIZA 4HYLA 3IHBA 3MGLA 5EUZA 2KLNA 3AGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZXN A;  1TH8 B;  4DGF A;  3LLO A;  1THN B;  4QTP A;  1VC1 A;  4DGH A;  1TID B;  1SBO A;  3T6O A;  5EUW A;  1H4Z A;  5EUS A;  3IHA A;  3IH9 A;  2KA5 A;  3LKL A;  3AGD A;  4XS5 A;  1T6R A;  1BUZ A;  1AUZ A;  3IF5 A;  5EZB A;  3OIR A;  3F43 A;  3IH8 A;  2VY9 A;  3NY7 A;  1H4Y A;  5EUU A;  3ZTB A;  1H4X A;  5EUX A;  1TIL B;  3OIZ A;  4HYL A;  3IHB A;  3MGL A;  5EUZ A;  2KLN A;  3AGE A; 
#chains in the Genus database with same CATH topology
 1TH8 B;  2DXL A;  3VSE A;  2CWW A;  1SBO A;  3IHA A;  3LKL A;  3AGD A;  1AUZ A;  3F43 A;  3IH8 A;  4GHN A;  4L8K A;  3DUP A;  1TIL B;  3GMF A;  3OIZ A;  4HYL A;  4AE2 A;  3IHB A;  3MOG A;  3MGL A;  5EUZ A;  2KLN A;  3AGE A;  4DGF A;  1BPL A;  4HIZ A;  5EUW A;  2AS0 A;  5EUS A;  1FC9 A;  2KA5 A;  3JU4 A;  1BUZ A;  3LDF A;  5EUU A;  3C0K A;  2ZOA A;  1FCF A;  3DJA A;  3LLO A;  2B78 A;  1VC1 A;  4L1C A;  3EH7 A;  3T6O A;  1WXW A;  1V0E A;  3IH9 A;  1FC7 A;  4XS5 A;  3GVJ A;  4AEJ A;  1N6E A;  5EZB A;  3V97 A;  2DXN A;  1H4Y A;  3D3U A;  3DOR A;  2RRL A;  3ZTB A;  1H4X A;  2OAS A;  5EUX A;  1J7X A;  1WXX A;  4DMG A;  3GVL A;  3ZXN A;  4QTP A;  1THN B;  1K32 A;  4DGH A;  1HF2 A;  1FC6 A;  1TID B;  1H4Z A;  1N6D A;  1N6F A;  1T6R A;  1V0F A;  3D03 A;  3V8V A;  3IF5 A;  3GHF A;  3OIR A;  2VY9 A;  3NY7 A;  2ZO9 B;  3GVK A;  3GK7 A;  3QDQ A;  4JC0 A;  3K50 A; 
#chains in the Genus database with same CATH homology
 3ZXN A;  1TH8 B;  4DGF A;  3LLO A;  1THN B;  4QTP A;  1VC1 A;  4DGH A;  1TID B;  1SBO A;  3T6O A;  5EUW A;  1H4Z A;  5EUS A;  3IHA A;  3IH9 A;  2KA5 A;  3LKL A;  3AGD A;  4XS5 A;  1T6R A;  1BUZ A;  1AUZ A;  3IF5 A;  5EZB A;  3OIR A;  3F43 A;  3IH8 A;  2VY9 A;  3NY7 A;  1H4Y A;  5EUU A;  3ZTB A;  1H4X A;  5EUX A;  1TIL B;  3OIZ A;  4HYL A;  3IHB A;  3MGL A;  5EUZ A;  2KLN A;  3AGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...