4HYLA

The crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
113
structure length
113
Chain Sequence
NATDTQIRTEQGIDIITLHGHLDTRSSPAVQAAVLPRVTAKGKMILDLREVSYMSSAGLRVLLSLYRHTSNQQGALVLVGVSEEIRDTMEITGFWNFFTACASMDEALRILGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Stage II sporulation protein
publication title The crystal structure of an anti-sigma-factor antagonist from Haliangium ochraceum DSM 14365
rcsb
source organism Haliangium ochraceum
total genus 28
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 4hylA00
3F43A 5EUZA 3ZTBA 3AGEA 3T6OA 3IF5A 4QTPA 3AGDA 3LKLA 5EZBA 1H4XA 5EUWA 4HYLA 1TILB 1THNB 1VC1A 3OIRA 4XS5A 1TIDB 1TH8B 3IH8A 5EUSA 5EUUA 4DGHA 5EUXA 3IHAA 3LLOA 3ZXNA 1AUZA 1H4ZA 3OIZA 4DGFA 3IHBA 3MGLA 3NY7A 1T6RA 2KLNA 1BUZA 2KA5A 1H4YA 2VY9A 1SBOA 3IH9A
chains in the Genus database with same CATH superfamily
1V0FA 3IF5A 3QDQA 5EUWA 3DUPA 1FC6A 1FC7A 4L8KA 2RRLA 1J7XA 5EUXA 1H4ZA 3OIZA 3V8VA 1BUZA 1K32A 3DJAA 2DXLA 3LDFA 3ZTBA 4AE2A 3LKLA 1N6DA 3MOGA 4HYLA 1VC1A 1TIDB 1BPLA 1HF2A 3D3UA 2ZOAA 4DGFA 3IHBA 1WXWA 3K50A 2OASA 3D03A 3GHFA 1H4YA 4GHNA 3IH9A 3F43A 2AS0A 3AGDA 3GMFA 1THNB 3GVLA 3OIRA 1N6EA 2ZO9B 4XS5A 1TH8B 3IH8A 5EUSA 4DGHA 2B78A 3LLOA 1AUZA 3NY7A 3GVJA 3MGLA 1T6RA 2KA5A 2VY9A 5EUZA 2DXNA 3AGEA 4QTPA 3T6OA 5EZBA 4L1CA 1H4XA 1WXXA 1FC9A 3C0KA 1FCFA 3GVKA 4DMGA 1TILB 4AEJA 5EUUA 3VSEA 1V0EA 3IHAA 3ZXNA 4JC0A 1N6FA 3GK7A 3JU4A 3V97A 4HIZA 2KLNA 3EH7A 3DORA 2CWWA 1SBOA
chains in the Genus database with same CATH topology
3F43A 5EUZA 3ZTBA 3AGEA 3T6OA 3IF5A 4QTPA 3AGDA 3LKLA 5EZBA 1H4XA 5EUWA 4HYLA 1TILB 1THNB 1VC1A 3OIRA 4XS5A 1TIDB 1TH8B 3IH8A 5EUSA 5EUUA 4DGHA 5EUXA 3IHAA 3LLOA 3ZXNA 1AUZA 1H4ZA 3OIZA 4DGFA 3IHBA 3MGLA 3NY7A 1T6RA 2KLNA 1BUZA 2KA5A 1H4YA 2VY9A 1SBOA 3IH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F43 A;  5EUZ A;  3ZTB A;  3AGE A;  3T6O A;  3IF5 A;  4QTP A;  3AGD A;  3LKL A;  5EZB A;  1H4X A;  5EUW A;  4HYL A;  1TIL B;  1THN B;  1VC1 A;  3OIR A;  4XS5 A;  1TID B;  1TH8 B;  3IH8 A;  5EUS A;  5EUU A;  4DGH A;  5EUX A;  3IHA A;  3LLO A;  3ZXN A;  1AUZ A;  1H4Z A;  3OIZ A;  4DGF A;  3IHB A;  3MGL A;  3NY7 A;  1T6R A;  2KLN A;  1BUZ A;  2KA5 A;  1H4Y A;  2VY9 A;  1SBO A;  3IH9 A; 
#chains in the Genus database with same CATH topology
 1V0F A;  3IF5 A;  3QDQ A;  5EUW A;  3DUP A;  1FC6 A;  1FC7 A;  4L8K A;  2RRL A;  1J7X A;  5EUX A;  1H4Z A;  3OIZ A;  3V8V A;  1BUZ A;  1K32 A;  3DJA A;  2DXL A;  3LDF A;  3ZTB A;  4AE2 A;  3LKL A;  1N6D A;  3MOG A;  4HYL A;  1VC1 A;  1TID B;  1BPL A;  1HF2 A;  3D3U A;  2ZOA A;  4DGF A;  3IHB A;  1WXW A;  3K50 A;  2OAS A;  3D03 A;  3GHF A;  1H4Y A;  4GHN A;  3IH9 A;  3F43 A;  2AS0 A;  3AGD A;  3GMF A;  1THN B;  3GVL A;  3OIR A;  1N6E A;  2ZO9 B;  4XS5 A;  1TH8 B;  3IH8 A;  5EUS A;  4DGH A;  2B78 A;  3LLO A;  1AUZ A;  3NY7 A;  3GVJ A;  3MGL A;  1T6R A;  2KA5 A;  2VY9 A;  5EUZ A;  2DXN A;  3AGE A;  4QTP A;  3T6O A;  5EZB A;  4L1C A;  1H4X A;  1WXX A;  1FC9 A;  3C0K A;  1FCF A;  3GVK A;  4DMG A;  1TIL B;  4AEJ A;  5EUU A;  3VSE A;  1V0E A;  3IHA A;  3ZXN A;  4JC0 A;  1N6F A;  3GK7 A;  3JU4 A;  3V97 A;  4HIZ A;  2KLN A;  3EH7 A;  3DOR A;  2CWW A;  1SBO A; 
#chains in the Genus database with same CATH homology
 3F43 A;  5EUZ A;  3ZTB A;  3AGE A;  3T6O A;  3IF5 A;  4QTP A;  3AGD A;  3LKL A;  5EZB A;  1H4X A;  5EUW A;  4HYL A;  1TIL B;  1THN B;  1VC1 A;  3OIR A;  4XS5 A;  1TID B;  1TH8 B;  3IH8 A;  5EUS A;  5EUU A;  4DGH A;  5EUX A;  3IHA A;  3LLO A;  3ZXN A;  1AUZ A;  1H4Z A;  3OIZ A;  4DGF A;  3IHB A;  3MGL A;  3NY7 A;  1T6R A;  2KLN A;  1BUZ A;  2KA5 A;  1H4Y A;  2VY9 A;  1SBO A;  3IH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...