4DGFA

Structure of sulp transporter stas domain from wolinella succinogenes refined to 1.6 angstrom resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
122
structure length
122
Chain Sequence
DDPDATSKKVVPLGVEIYEINGPFFFGVADRLKGVLDVIEETPKVFILRMRRVPVIDATGMHALWEFQESCEKRGTILLLSGVSDRLYGALNRFGFIEALGEERVFDHIDKALAYAKLLVET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords SULFATE TRANSPORTER SULFATE TRANSPORTER FAMILY PROTEIN
publication title Structure of SulP Transporter STAS Domain from Wolinella Succinogenes Refined to 1.6 Angstrom Resolution
rcsb
source organism Wolinella succinogenes
total genus 38
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 4dgfA00
3IH9A 1BUZA 1TH8B 4XS5A 3NY7A 1TIDB 1VC1A 5EUWA 1AUZA 3IHBA 3F43A 3LLOA 3ZTBA 3AGDA 4DGHA 1T6RA 3MGLA 2KA5A 3T6OA 5EUUA 1H4XA 1SBOA 4DGFA 3IF5A 3AGEA 3OIRA 1H4ZA 1THNB 2KLNA 3IH8A 4QTPA 1TILB 2VY9A 5EZBA 5EUZA 3LKLA 1H4YA 4HYLA 3ZXNA 5EUXA 3OIZA 3IHAA 5EUSA
chains in the Genus database with same CATH superfamily
2ZOAA 5EUWA 1AUZA 1BPLA 3LLOA 3ZTBA 3D3UA 1N6DA 3T6OA 4AE2A 3IF5A 3AGEA 3D03A 1N6EA 1TILB 3MOGA 2RRLA 3ZXNA 5EUXA 2DXNA 4DGFA 2AS0A 3GHFA 3F43A 1V0EA 1J7XA 3GVKA 2KA5A 2ZO9B 1V0FA 2DXLA 3V97A 1FC9A 2VY9A 3DJAA 1H4YA 3GK7A 3C0KA 3IH9A 4DMGA 4JC0A 3NY7A 1VC1A 3IHBA 4L1CA 1FCFA 2OASA 1WXWA 3MGLA 4GHNA 5EUUA 1H4XA 3EH7A 3GVJA 4L8KA 1FC7A 4QTPA 3QDQA 3LDFA 1FC6A 5EZBA 1HF2A 1K32A 3IHAA 3DORA 1N6FA 5EUSA 3DUPA 1BUZA 1TH8B 4XS5A 1TIDB 3K50A 3V8VA 3AGDA 4DGHA 1T6RA 3GMFA 4AEJA 3GVLA 3JU4A 4HIZA 3VSEA 2B78A 1SBOA 1WXXA 3OIRA 2CWWA 1H4ZA 1THNB 2KLNA 3IH8A 5EUZA 3LKLA 4HYLA 3OIZA
chains in the Genus database with same CATH topology
3IH9A 1BUZA 1TH8B 4XS5A 3NY7A 1TIDB 1VC1A 5EUWA 1AUZA 3IHBA 3F43A 3LLOA 3ZTBA 3AGDA 4DGHA 1T6RA 3MGLA 2KA5A 3T6OA 5EUUA 1H4XA 1SBOA 4DGFA 3IF5A 3AGEA 3OIRA 1H4ZA 1THNB 2KLNA 3IH8A 4QTPA 1TILB 2VY9A 5EZBA 5EUZA 3LKLA 1H4YA 4HYLA 3ZXNA 5EUXA 3OIZA 3IHAA 5EUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH9 A;  1BUZ A;  1TH8 B;  4XS5 A;  3NY7 A;  1TID B;  1VC1 A;  5EUW A;  1AUZ A;  3IHB A;  3F43 A;  3LLO A;  3ZTB A;  3AGD A;  4DGH A;  1T6R A;  3MGL A;  2KA5 A;  3T6O A;  5EUU A;  1H4X A;  1SBO A;  4DGF A;  3IF5 A;  3AGE A;  3OIR A;  1H4Z A;  1THN B;  2KLN A;  3IH8 A;  4QTP A;  1TIL B;  2VY9 A;  5EZB A;  5EUZ A;  3LKL A;  1H4Y A;  4HYL A;  3ZXN A;  5EUX A;  3OIZ A;  3IHA A;  5EUS A; 
#chains in the Genus database with same CATH topology
 2ZOA A;  5EUW A;  1AUZ A;  1BPL A;  3LLO A;  3ZTB A;  3D3U A;  1N6D A;  3T6O A;  4AE2 A;  3IF5 A;  3AGE A;  3D03 A;  1N6E A;  1TIL B;  3MOG A;  2RRL A;  3ZXN A;  5EUX A;  2DXN A;  4DGF A;  2AS0 A;  3GHF A;  3F43 A;  1V0E A;  1J7X A;  3GVK A;  2KA5 A;  2ZO9 B;  1V0F A;  2DXL A;  3V97 A;  1FC9 A;  2VY9 A;  3DJA A;  1H4Y A;  3GK7 A;  3C0K A;  3IH9 A;  4DMG A;  4JC0 A;  3NY7 A;  1VC1 A;  3IHB A;  4L1C A;  1FCF A;  2OAS A;  1WXW A;  3MGL A;  4GHN A;  5EUU A;  1H4X A;  3EH7 A;  3GVJ A;  4L8K A;  1FC7 A;  4QTP A;  3QDQ A;  3LDF A;  1FC6 A;  5EZB A;  1HF2 A;  1K32 A;  3IHA A;  3DOR A;  1N6F A;  5EUS A;  3DUP A;  1BUZ A;  1TH8 B;  4XS5 A;  1TID B;  3K50 A;  3V8V A;  3AGD A;  4DGH A;  1T6R A;  3GMF A;  4AEJ A;  3GVL A;  3JU4 A;  4HIZ A;  3VSE A;  2B78 A;  1SBO A;  1WXX A;  3OIR A;  2CWW A;  1H4Z A;  1THN B;  2KLN A;  3IH8 A;  5EUZ A;  3LKL A;  4HYL A;  3OIZ A; 
#chains in the Genus database with same CATH homology
 3IH9 A;  1BUZ A;  1TH8 B;  4XS5 A;  3NY7 A;  1TID B;  1VC1 A;  5EUW A;  1AUZ A;  3IHB A;  3F43 A;  3LLO A;  3ZTB A;  3AGD A;  4DGH A;  1T6R A;  3MGL A;  2KA5 A;  3T6O A;  5EUU A;  1H4X A;  1SBO A;  4DGF A;  3IF5 A;  3AGE A;  3OIR A;  1H4Z A;  1THN B;  2KLN A;  3IH8 A;  4QTP A;  1TIL B;  2VY9 A;  5EZB A;  5EUZ A;  3LKL A;  1H4Y A;  4HYL A;  3ZXN A;  5EUX A;  3OIZ A;  3IHA A;  5EUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...