3DUPA

Crystal structure of mutt/nudix family hydrolase from rhodospirillum rubrum atcc 11170
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
284
structure length
284
Chain Sequence
SLSFLKHVQDCNTHDLSNFVRFVIEGRRVGWVRKALAQRLKAHGRVFDVTRDAVLLSASLRTPQSRTRAVADVVDRLADEGVVPAPRGELYRVNQSWGEPTLMLLDRAVVPTFGVRAYGVHLNGYVGAGADLHLWIGRRSPDKSVAPGKLDNMVAGGQPADLSLRQNLIKECAEEADLPEALARQAIPVGAITYCMESPAGIKPDTLFLYDLALPEDFRPHNTDGEMADFMLWPAAKVVEAVRTTEAFKFNVNLTVIDFAIRHGLIDPDNEPDYQEILAGLRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MutT/nudix family protein
publication title Crystal Structure of Mutt/Nudix Family Hydrolase from Rhodospirillum Rubrum
rcsb
source organism Rhodospirillum rubrum atcc 11170
total genus 89
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15916 DUF4743 Domain of unknown function (DUF4743)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.160 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 3dupA02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3dupA01
2YVOA 5DPKA 2DSBA 3DKUA 1MP2A 3A6TA 5GHQA 2O5WA 3Q2SA 1V8NA 1KTGA 2G74A 3E57A 5DEQA 2ICKA 2R5WA 3X0SA 3WHWA 5HZXA 1VRLA 1XSAA 3O8SA 3X0MA 5FSLA 2B0VA 3F6AA 3Q4IA 4JZUA 3EESA 3R03A 4YPHA 1OW2A 2FVVA 3A6UA 4ICKA 3X0IA 1VIQA 2B2KA 4KG3A 1R67A 3DUPA 3A6VA 3O6ZA 1SU2A 1NQYA 5DDGA 3BM4A 2KDVA 3FSPA 1K2EA 2PQVA 1PPXA 2DSDA 1SJYA 2W4EA 5ANSA 1VK6A 5ISYA 2PNYA 4ILQA 3Q91A 1JKNA 3G0QA 5GHOA 1QVJA 2FKBA 4JZVA 3FK9A 1VCDA 2O1CA 3Q93A 3X0KA 4YPRA 3ACAA 4IJXA 3COUA 1PVFA 1V8UA 1PUNA 1IRYA 2ICJA 2QKMB 5C7QA 4S2WA 1RRQA 1I9AA 4K6EA 5GHMA 3L85A 3ZR1A 1HZTA 5ANUA 1V8TA 5FSIA 1RYAA 5I8UA 1RRSA 4KG4A 3N77A 4YOQA 2I8TA 2AZWA 3I7VA 2VNPA 3MGMA 5GHJA 2O5FA 2QJOA 4KTBA 3EXQA 3SHDA 2RRKA 5GHNA 2Q9PA 1TUMA 2YVNA 3CNGA 2DHOA 3SMDA 1HX3A 3BAPA 5BONA 3ZR0A 3AC9A 5GHPA 3HYQA 4JZSA 1Q27A 1NFZA 3A6SA 3O61A 3X0QA 3Q2TA 1GA7A 1Q33A 2KDWA 3OGAA 4KYXA 4DYWA 4S2XA 1MR2A 4C9XA 5LPGA 1XSCA 5DD4A 1G9QA 1JRKA 1XSBA 2YVMA 5C8LA 1MQWA 1MK1A 2GT2A 3F13A 1V8MA 1PPWA 2DUKA 3O52A 4MPOA 1X51A 3EEUA 2YYHA 5FSNA 3RH7A 4HVYA 3P6YA 1U20A 1MQEA 4NFWA 3SONA 1V8VA 1V8WA 4S2YA 5GHIA 1NQZA 2A8PA 2A8TA 2YVPA 3X0JA 2GB5A 5BS6A 1X84A 3X0PA 3FCMA 1G0SA 5ANVA 1F3YA 1V8LA 3GZ8A 5FSKA 3GG6A 3I9XA 4ZG0A 4C9WA 5ANTA 1K26A 5CFIA 3X0LA 2GT4A 1KT9A 1SOIA 3FFUA 2A8RA 2VNQA 3ID9A 3P5TA 1KHZA 3Q1PA 3MCFA 2XSQA 5ANWA 2G73A 3H95A 3X0OA 1MUTA 3GWYA 1VC9A 2FMLA 4N1TA 3HHJA 4N1UA 5IW5A 2A8SA 3GRNA 2A6TA 2J8QA 3BHOA 3U53A 3X0NA 5IW4A 4JZTA 1VIUA 3QSJA 1V8RA 3EF5A 1V8SA 3MDGA 2A8QA 3KVHA 3N9UA 3O69A 1VHZA 1PUSA 3X0RA 5C7TA 3J7Ye 2B06A 1SZ3A 1VHGA 3I7UA 4S2VA 1X83A 2CL3A 1PPVA 2I6KA 3GZ5A 4V14A 1PUQA 3FJYA 1V8IA 1Q54A 4NFXA 2JVBA 1NFSA 4HFQA 3MDIA 5FSMA 1V8YA 2QJTA 2DSCA 5CFJA 2I8UA 3GZ6A 5FSOA 1VC8A
chains in the Genus database with same CATH superfamily
2DSBA 3A6TA 5GHQA 3Q2SA 1KTGA 3WHWA 1FC9A 3F6AA 1THNB 3AGDA 3R03A 2FVVA 4ICKA 1VIQA 2B2KA 1H4XA 1R67A 1NQYA 5DDGA 1K2EA 1FC7A 1PPXA 1VK6A 4ILQA 1JKNA 4J7HA 1VCDA 2ZOAA 1IRYA 2ICJA 4S2WA 3L85A 2VY9A 1RYAA 3ZTBA 3I7VA 3MGMA 2CZRA 3IH8A 2RRKA 2RRLA 3AGEA 1FCFA 2Q9PA 2ZO9B 3SMDA 3C0KA 5GHPA 3HYQA 4JZSA 1Q27A 1GA7A 1Q33A 1XSCA 5DD4A 1G9QA 1XSBA 5C8LA 2GT2A 3O52A 5FSNA 3P6YA 2KLNA 3MGLA 1V8WA 2YVPA 3X0JA 2GB5A 3X0PA 3FCMA 5ANVA 4ZG0A 3GG6A 1H4YA 5CFIA 2VNQA 3DORA 3ID9A 3MCFA 1N6EA 5IW5A 3GRNA 3BHOA 3X0NA 5IW4A 1V8RA 2B78A 3EF5A 2A8QA 1PUSA 2OASA 3K50A 1X83A 3GZ5A 4V14A 1HF2A 4HFQA 1NFSA 5FSMA 5FSOA 1AUZA 2O5WA 3F43A 1V0EA 3E57A 4L1CA 5DEQA 3LKLA 2ICKA 2R5WA 3Q4IA 3EESA 4L8KA 4YPHA 3DUPA 2PQVA 2DSDA 1SJYA 2W4EA 5ANSA 2PNYA 1TIDB 3G0QA 4AE2A 4JZVA 3FK9A 2O1CA 3ACAA 4IJXA 3D03A 5C7QA 1RRQA 5GHMA 1HZTA 5FSIA 3GVJA 2I8TA 2VNPA 2O5FA 5EZBA 3CNGA 4QTPA 1HX3A 1NFZA 4DYWA 4C9XA 1BUZA 5LPGA 3GMFA 1MK1A 3F13A 1PPWA 1TILB 3SONA 3OIZA 3VSEA 1NQZA 2A8TA 2CWWA 3LLOA 5BS6A 1X84A 4XS5A 1F3YA 5EUSA 1V8LA 5FSKA 3MOGA 1KHZA 3Q1PA 2G73A 2FMLA 4N1TA 2A8SA 3GVLA 2A6TA 3IH9A 1V0FA 1VIUA 1WXWA 3GHFA 1V8SA 3I7UA 1PPVA 2DXLA 4NFXA 2JVBA 2I8UA 5EUUA 5EUXA 5DPKA 2G74A 3X0SA 1VRLA 5HZXA 1XSAA 3O8SA 1OW2A 3A6UA 4JC0A 3X0IA 3JU4A 4DGHA 3A6VA 3O6ZA 1SU2A 2KDVA 1VC1A 5ISYA 1WXXA 3Q91A 5GHOA 2FKBA 3T6OA 5EUWA 4YPRA 3COUA 3V97A 1PVFA 1V8UA 4GHNA 2QKMB 5ANUA 1V8TA 4KG4A 3N77A 2QJOA 1FC6A 5GHNA 1T6RA 3DJAA 2DHOA 3BAPA 3AC9A 3NY7A 3IF5A 3X0QA 3Q2TA 1J7XA 2KDWA 3QDQA 4KYXA 4S2XA 1MR2A 1JRKA 1SBOA 2DUKA 4MPOA 3RH7A 2YYHA 1U20A 3EH7A 4S2YA 3GZ8A 3V8VA 3I9XA 1K26A 4J7GA 1KT9A 3FFUA 3X0OA 1MUTA 3HHJA 3U53A 3LDFA 3MDGA 1VHZA 1SZ3A 1VHGA 2CL3A 4HYLA 2I6KA 1PUQA 1V8IA 1Q54A 3GZ6A 2QJTA 2DSCA 2YVOA 3DKUA 1MP2A 2AS0A 1V8NA 4AEJA 3X0MA 5FSLA 2B0VA 4JZUA 3GVKA 2DXNA 4DGFA 4KG3A 3BM4A 3FSPA 1QVJA 3Q93A 3X0KA 1PUNA 1N6FA 1I9AA 4K6EA 3ZR1A 5I8UA 1RRSA 1BPLA 4YOQA 2AZWA 1TH8B 5EUZA 5GHJA 3IHAA 4KTBA 3EXQA 3SHDA 2KA5A 4HIZA 1TUMA 2YVNA 5BONA 3ZR0A 3OIRA 3A6SA 3O61A 3OGAA 2YVMA 1N6DA 1MQWA 3D3UA 1V8MA 4HVYA 1X51A 3EEUA 1MQEA 4NFWA 1V8VA 5GHIA 2A8PA 3ZXNA 1G0SA 1H4ZA 4C9WA 5ANTA 3X0LA 2GT4A 3P5TA 1SOIA 2A8RA 2XSQA 5ANWA 3H95A 3GWYA 1VC9A 4N1UA 2J8QA 4JZTA 3QSJA 3KVHA 3O69A 3N9UA 3IHBA 3X0RA 5C7TA 3J7Ye 2B06A 4S2VA 3FJYA 3MDIA 1V8YA 5CFJA 3GK7A 4DMGA 1K32A 1VC8A
chains in the Genus database with same CATH topology
2YVOA 5DPKA 2DSBA 3DKUA 1MP2A 3A6TA 5GHQA 2O5WA 3Q2SA 1V8NA 1KTGA 4L1CA 2G74A 3E57A 5DEQA 4AEJA 2ICKA 2R5WA 3WHWA 3X0SA 5HZXA 1XSAA 3O8SA 3X0MA 5FSLA 1FC9A 2B0VA 3F6AA 3Q4IA 4JZUA 3EESA 4L8KA 3R03A 4YPHA 1OW2A 2FVVA 2DXNA 3A6UA 4ICKA 4JC0A 3X0IA 1VIQA 2B2KA 4KG3A 1R67A 3DUPA 3A6VA 3O6ZA 1SU2A 1NQYA 5DDGA 1VRLA 3BM4A 2KDVA 3FSPA 1K2EA 1FC7A 2PQVA 1PPXA 2DSDA 1SJYA 2W4EA 5ANSA 1VK6A 5ISYA 2PNYA 4ILQA 3Q91A 1JKNA 3G0QA 4AE2A 5GHOA 1QVJA 2FKBA 4J7HA 3FK9A 1VCDA 4JZVA 2O1CA 2ZOAA 3Q93A 3X0KA 4YPRA 3ACAA 4IJXA 3COUA 3D03A 1PVFA 1V8UA 1PUNA 1IRYA 4GHNA 2ICJA 2QKMB 5C7QA 4S2WA 1RRQA 1N6FA 1I9AA 4K6EA 5GHMA 3L85A 3ZR1A 1HZTA 5ANUA 1V8TA 5FSIA 1RYAA 5I8UA 1RRSA 5FSOA 4KG4A 1BPLA 3N77A 4YOQA 2I8TA 2AZWA 3I7VA 2VNPA 3MGMA 5GHJA 2O5FA 2QJOA 2CZRA 4KTBA 1FC6A 3EXQA 3SHDA 2RRKA 5GHNA 2RRLA 1FCFA 3DJAA 1TUMA 2Q9PA 2YVNA 2ZO9B 2DHOA 3CNGA 3SMDA 1HX3A 3BAPA 5BONA 3ZR0A 3AC9A 5GHPA 3HYQA 4JZSA 1Q27A 1NFZA 3A6SA 3O61A 1J7XA 3X0QA 3Q2TA 1GA7A 1Q33A 2KDWA 3OGAA 4KYXA 4DYWA 4S2XA 1MR2A 4C9XA 5LPGA 1XSCA 5DD4A 1G9QA 1JRKA 1XSBA 2YVMA 1N6DA 5C8LA 1MQWA 3GMFA 1MK1A 2GT2A 3F13A 1V8MA 1PPWA 2DUKA 3O52A 4MPOA 1X51A 3EEUA 2YYHA 5FSNA 3RH7A 4HVYA 3P6YA 1U20A 1MQEA 4NFWA 3SONA 1V8VA 1V8WA 4S2YA 5GHIA 1NQZA 2A8PA 2A8TA 2YVPA 3X0JA 2GB5A 5BS6A 1X84A 3X0PA 3FCMA 1G0SA 5ANVA 1F3YA 1V8LA 3GZ8A 5FSKA 3GG6A 3I9XA 4ZG0A 4C9WA 5ANTA 1K26A 4J7GA 5CFIA 3X0LA 2GT4A 1KT9A 1SOIA 3FFUA 2A8RA 3DORA 3MOGA 2VNQA 1KHZA 3ID9A 3P5TA 3Q1PA 3MCFA 2XSQA 5ANWA 2G73A 3H95A 3X0OA 1MUTA 3GWYA 1VC9A 1N6EA 2FMLA 4N1TA 3HHJA 4N1UA 5IW5A 2A8SA 3GRNA 2A6TA 2J8QA 3BHOA 3U53A 3X0NA 5IW4A 4JZTA 1VIUA 3QSJA 1V8RA 3EF5A 3GHFA 1V8SA 3MDGA 2A8QA 3KVHA 3N9UA 3O69A 1VHZA 1PUSA 3X0RA 5C7TA 3K50A 2B06A 3J7Ye 1SZ3A 1VHGA 3I7UA 4S2VA 1X83A 2CL3A 1PPVA 2I6KA 3GZ5A 2DXLA 4V14A 1PUQA 3FJYA 1V8IA 1Q54A 4NFXA 2JVBA 1NFSA 4HFQA 3MDIA 5FSMA 1V8YA 2QJTA 2DSCA 5CFJA 2I8UA 3GZ6A 1K32A 1VC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVO A;  5DPK A;  2DSB A;  3DKU A;  1MP2 A;  3A6T A;  5GHQ A;  2O5W A;  3Q2S A;  1V8N A;  1KTG A;  2G74 A;  3E57 A;  5DEQ A;  2ICK A;  2R5W A;  3X0S A;  3WHW A;  5HZX A;  1VRL A;  1XSA A;  3O8S A;  3X0M A;  5FSL A;  2B0V A;  3F6A A;  3Q4I A;  4JZU A;  3EES A;  3R03 A;  4YPH A;  1OW2 A;  2FVV A;  3A6U A;  4ICK A;  3X0I A;  1VIQ A;  2B2K A;  4KG3 A;  1R67 A;  3DUP A;  3A6V A;  3O6Z A;  1SU2 A;  1NQY A;  5DDG A;  3BM4 A;  2KDV A;  3FSP A;  1K2E A;  2PQV A;  1PPX A;  2DSD A;  1SJY A;  2W4E A;  5ANS A;  1VK6 A;  5ISY A;  2PNY A;  4ILQ A;  3Q91 A;  1JKN A;  3G0Q A;  5GHO A;  1QVJ A;  2FKB A;  4JZV A;  3FK9 A;  1VCD A;  2O1C A;  3Q93 A;  3X0K A;  4YPR A;  3ACA A;  4IJX A;  3COU A;  1PVF A;  1V8U A;  1PUN A;  1IRY A;  2ICJ A;  2QKM B;  5C7Q A;  4S2W A;  1RRQ A;  1I9A A;  4K6E A;  5GHM A;  3L85 A;  3ZR1 A;  1HZT A;  5ANU A;  1V8T A;  5FSI A;  1RYA A;  5I8U A;  1RRS A;  4KG4 A;  3N77 A;  4YOQ A;  2I8T A;  2AZW A;  3I7V A;  2VNP A;  3MGM A;  5GHJ A;  2O5F A;  2QJO A;  4KTB A;  3EXQ A;  3SHD A;  2RRK A;  5GHN A;  2Q9P A;  1TUM A;  2YVN A;  3CNG A;  2DHO A;  3SMD A;  1HX3 A;  3BAP A;  5BON A;  3ZR0 A;  3AC9 A;  5GHP A;  3HYQ A;  4JZS A;  1Q27 A;  1NFZ A;  3A6S A;  3O61 A;  3X0Q A;  3Q2T A;  1GA7 A;  1Q33 A;  2KDW A;  3OGA A;  4KYX A;  4DYW A;  4S2X A;  1MR2 A;  4C9X A;  5LPG A;  1XSC A;  5DD4 A;  1G9Q A;  1JRK A;  1XSB A;  2YVM A;  5C8L A;  1MQW A;  1MK1 A;  2GT2 A;  3F13 A;  1V8M A;  1PPW A;  2DUK A;  3O52 A;  4MPO A;  1X51 A;  3EEU A;  2YYH A;  5FSN A;  3RH7 A;  4HVY A;  3P6Y A;  1U20 A;  1MQE A;  4NFW A;  3SON A;  1V8V A;  1V8W A;  4S2Y A;  5GHI A;  1NQZ A;  2A8P A;  2A8T A;  2YVP A;  3X0J A;  2GB5 A;  5BS6 A;  1X84 A;  3X0P A;  3FCM A;  1G0S A;  5ANV A;  1F3Y A;  1V8L A;  3GZ8 A;  5FSK A;  3GG6 A;  3I9X A;  4ZG0 A;  4C9W A;  5ANT A;  1K26 A;  5CFI A;  3X0L A;  2GT4 A;  1KT9 A;  1SOI A;  3FFU A;  2A8R A;  2VNQ A;  3ID9 A;  3P5T A;  1KHZ A;  3Q1P A;  3MCF A;  2XSQ A;  5ANW A;  2G73 A;  3H95 A;  3X0O A;  1MUT A;  3GWY A;  1VC9 A;  2FML A;  4N1T A;  3HHJ A;  4N1U A;  5IW5 A;  2A8S A;  3GRN A;  2A6T A;  2J8Q A;  3BHO A;  3U53 A;  3X0N A;  5IW4 A;  4JZT A;  1VIU A;  3QSJ A;  1V8R A;  3EF5 A;  1V8S A;  3MDG A;  2A8Q A;  3KVH A;  3N9U A;  3O69 A;  1VHZ A;  1PUS A;  3X0R A;  5C7T A;  3J7Y e;  2B06 A;  1SZ3 A;  1VHG A;  3I7U A;  4S2V A;  1X83 A;  2CL3 A;  1PPV A;  2I6K A;  3GZ5 A;  4V14 A;  1PUQ A;  3FJY A;  1V8I A;  1Q54 A;  4NFX A;  2JVB A;  1NFS A;  4HFQ A;  3MDI A;  5FSM A;  1V8Y A;  2QJT A;  2DSC A;  5CFJ A;  2I8U A;  3GZ6 A;  5FSO A;  1VC8 A; 
#chains in the Genus database with same CATH topology
 2DSB A;  3A6T A;  5GHQ A;  3Q2S A;  1KTG A;  3WHW A;  1FC9 A;  3F6A A;  1THN B;  3AGD A;  3R03 A;  2FVV A;  4ICK A;  1VIQ A;  2B2K A;  1H4X A;  1R67 A;  1NQY A;  5DDG A;  1K2E A;  1FC7 A;  1PPX A;  1VK6 A;  4ILQ A;  1JKN A;  4J7H A;  1VCD A;  2ZOA A;  1IRY A;  2ICJ A;  4S2W A;  3L85 A;  2VY9 A;  1RYA A;  3ZTB A;  3I7V A;  3MGM A;  2CZR A;  3IH8 A;  2RRK A;  2RRL A;  3AGE A;  1FCF A;  2Q9P A;  2ZO9 B;  3SMD A;  3C0K A;  5GHP A;  3HYQ A;  4JZS A;  1Q27 A;  1GA7 A;  1Q33 A;  1XSC A;  5DD4 A;  1G9Q A;  1XSB A;  5C8L A;  2GT2 A;  3O52 A;  5FSN A;  3P6Y A;  2KLN A;  3MGL A;  1V8W A;  2YVP A;  3X0J A;  2GB5 A;  3X0P A;  3FCM A;  5ANV A;  4ZG0 A;  3GG6 A;  1H4Y A;  5CFI A;  2VNQ A;  3DOR A;  3ID9 A;  3MCF A;  1N6E A;  5IW5 A;  3GRN A;  3BHO A;  3X0N A;  5IW4 A;  1V8R A;  2B78 A;  3EF5 A;  2A8Q A;  1PUS A;  2OAS A;  3K50 A;  1X83 A;  3GZ5 A;  4V14 A;  1HF2 A;  4HFQ A;  1NFS A;  5FSM A;  5FSO A;  1AUZ A;  2O5W A;  3F43 A;  1V0E A;  3E57 A;  4L1C A;  5DEQ A;  3LKL A;  2ICK A;  2R5W A;  3Q4I A;  3EES A;  4L8K A;  4YPH A;  3DUP A;  2PQV A;  2DSD A;  1SJY A;  2W4E A;  5ANS A;  2PNY A;  1TID B;  3G0Q A;  4AE2 A;  4JZV A;  3FK9 A;  2O1C A;  3ACA A;  4IJX A;  3D03 A;  5C7Q A;  1RRQ A;  5GHM A;  1HZT A;  5FSI A;  3GVJ A;  2I8T A;  2VNP A;  2O5F A;  5EZB A;  3CNG A;  4QTP A;  1HX3 A;  1NFZ A;  4DYW A;  4C9X A;  1BUZ A;  5LPG A;  3GMF A;  1MK1 A;  3F13 A;  1PPW A;  1TIL B;  3SON A;  3OIZ A;  3VSE A;  1NQZ A;  2A8T A;  2CWW A;  3LLO A;  5BS6 A;  1X84 A;  4XS5 A;  1F3Y A;  5EUS A;  1V8L A;  5FSK A;  3MOG A;  1KHZ A;  3Q1P A;  2G73 A;  2FML A;  4N1T A;  2A8S A;  3GVL A;  2A6T A;  3IH9 A;  1V0F A;  1VIU A;  1WXW A;  3GHF A;  1V8S A;  3I7U A;  1PPV A;  2DXL A;  4NFX A;  2JVB A;  2I8U A;  5EUU A;  5EUX A;  5DPK A;  2G74 A;  3X0S A;  1VRL A;  5HZX A;  1XSA A;  3O8S A;  1OW2 A;  3A6U A;  4JC0 A;  3X0I A;  3JU4 A;  4DGH A;  3A6V A;  3O6Z A;  1SU2 A;  2KDV A;  1VC1 A;  5ISY A;  1WXX A;  3Q91 A;  5GHO A;  2FKB A;  3T6O A;  5EUW A;  4YPR A;  3COU A;  3V97 A;  1PVF A;  1V8U A;  4GHN A;  2QKM B;  5ANU A;  1V8T A;  4KG4 A;  3N77 A;  2QJO A;  1FC6 A;  5GHN A;  1T6R A;  3DJA A;  2DHO A;  3BAP A;  3AC9 A;  3NY7 A;  3IF5 A;  3X0Q A;  3Q2T A;  1J7X A;  2KDW A;  3QDQ A;  4KYX A;  4S2X A;  1MR2 A;  1JRK A;  1SBO A;  2DUK A;  4MPO A;  3RH7 A;  2YYH A;  1U20 A;  3EH7 A;  4S2Y A;  3GZ8 A;  3V8V A;  3I9X A;  1K26 A;  4J7G A;  1KT9 A;  3FFU A;  3X0O A;  1MUT A;  3HHJ A;  3U53 A;  3LDF A;  3MDG A;  1VHZ A;  1SZ3 A;  1VHG A;  2CL3 A;  4HYL A;  2I6K A;  1PUQ A;  1V8I A;  1Q54 A;  3GZ6 A;  2QJT A;  2DSC A;  2YVO A;  3DKU A;  1MP2 A;  2AS0 A;  1V8N A;  4AEJ A;  3X0M A;  5FSL A;  2B0V A;  4JZU A;  3GVK A;  2DXN A;  4DGF A;  4KG3 A;  3BM4 A;  3FSP A;  1QVJ A;  3Q93 A;  3X0K A;  1PUN A;  1N6F A;  1I9A A;  4K6E A;  3ZR1 A;  5I8U A;  1RRS A;  1BPL A;  4YOQ A;  2AZW A;  1TH8 B;  5EUZ A;  5GHJ A;  3IHA A;  4KTB A;  3EXQ A;  3SHD A;  2KA5 A;  4HIZ A;  1TUM A;  2YVN A;  5BON A;  3ZR0 A;  3OIR A;  3A6S A;  3O61 A;  3OGA A;  2YVM A;  1N6D A;  1MQW A;  3D3U A;  1V8M A;  4HVY A;  1X51 A;  3EEU A;  1MQE A;  4NFW A;  1V8V A;  5GHI A;  2A8P A;  3ZXN A;  1G0S A;  1H4Z A;  4C9W A;  5ANT A;  3X0L A;  2GT4 A;  3P5T A;  1SOI A;  2A8R A;  2XSQ A;  5ANW A;  3H95 A;  3GWY A;  1VC9 A;  4N1U A;  2J8Q A;  4JZT A;  3QSJ A;  3KVH A;  3O69 A;  3N9U A;  3IHB A;  3X0R A;  5C7T A;  3J7Y e;  2B06 A;  4S2V A;  3FJY A;  3MDI A;  1V8Y A;  5CFJ A;  3GK7 A;  4DMG A;  1K32 A;  1VC8 A; 
#chains in the Genus database with same CATH homology
 2YVO A;  5DPK A;  2DSB A;  3DKU A;  1MP2 A;  3A6T A;  5GHQ A;  2O5W A;  3Q2S A;  1V8N A;  1KTG A;  4L1C A;  2G74 A;  3E57 A;  5DEQ A;  4AEJ A;  2ICK A;  2R5W A;  3WHW A;  3X0S A;  5HZX A;  1XSA A;  3O8S A;  3X0M A;  5FSL A;  1FC9 A;  2B0V A;  3F6A A;  3Q4I A;  4JZU A;  3EES A;  4L8K A;  3R03 A;  4YPH A;  1OW2 A;  2FVV A;  2DXN A;  3A6U A;  4ICK A;  4JC0 A;  3X0I A;  1VIQ A;  2B2K A;  4KG3 A;  1R67 A;  3DUP A;  3A6V A;  3O6Z A;  1SU2 A;  1NQY A;  5DDG A;  1VRL A;  3BM4 A;  2KDV A;  3FSP A;  1K2E A;  1FC7 A;  2PQV A;  1PPX A;  2DSD A;  1SJY A;  2W4E A;  5ANS A;  1VK6 A;  5ISY A;  2PNY A;  4ILQ A;  3Q91 A;  1JKN A;  3G0Q A;  4AE2 A;  5GHO A;  1QVJ A;  2FKB A;  4J7H A;  3FK9 A;  1VCD A;  4JZV A;  2O1C A;  2ZOA A;  3Q93 A;  3X0K A;  4YPR A;  3ACA A;  4IJX A;  3COU A;  3D03 A;  1PVF A;  1V8U A;  1PUN A;  1IRY A;  4GHN A;  2ICJ A;  2QKM B;  5C7Q A;  4S2W A;  1RRQ A;  1N6F A;  1I9A A;  4K6E A;  5GHM A;  3L85 A;  3ZR1 A;  1HZT A;  5ANU A;  1V8T A;  5FSI A;  1RYA A;  5I8U A;  1RRS A;  5FSO A;  4KG4 A;  1BPL A;  3N77 A;  4YOQ A;  2I8T A;  2AZW A;  3I7V A;  2VNP A;  3MGM A;  5GHJ A;  2O5F A;  2QJO A;  2CZR A;  4KTB A;  1FC6 A;  3EXQ A;  3SHD A;  2RRK A;  5GHN A;  2RRL A;  1FCF A;  3DJA A;  1TUM A;  2Q9P A;  2YVN A;  2ZO9 B;  2DHO A;  3CNG A;  3SMD A;  1HX3 A;  3BAP A;  5BON A;  3ZR0 A;  3AC9 A;  5GHP A;  3HYQ A;  4JZS A;  1Q27 A;  1NFZ A;  3A6S A;  3O61 A;  1J7X A;  3X0Q A;  3Q2T A;  1GA7 A;  1Q33 A;  2KDW A;  3OGA A;  4KYX A;  4DYW A;  4S2X A;  1MR2 A;  4C9X A;  5LPG A;  1XSC A;  5DD4 A;  1G9Q A;  1JRK A;  1XSB A;  2YVM A;  1N6D A;  5C8L A;  1MQW A;  3GMF A;  1MK1 A;  2GT2 A;  3F13 A;  1V8M A;  1PPW A;  2DUK A;  3O52 A;  4MPO A;  1X51 A;  3EEU A;  2YYH A;  5FSN A;  3RH7 A;  4HVY A;  3P6Y A;  1U20 A;  1MQE A;  4NFW A;  3SON A;  1V8V A;  1V8W A;  4S2Y A;  5GHI A;  1NQZ A;  2A8P A;  2A8T A;  2YVP A;  3X0J A;  2GB5 A;  5BS6 A;  1X84 A;  3X0P A;  3FCM A;  1G0S A;  5ANV A;  1F3Y A;  1V8L A;  3GZ8 A;  5FSK A;  3GG6 A;  3I9X A;  4ZG0 A;  4C9W A;  5ANT A;  1K26 A;  4J7G A;  5CFI A;  3X0L A;  2GT4 A;  1KT9 A;  1SOI A;  3FFU A;  2A8R A;  3DOR A;  3MOG A;  2VNQ A;  1KHZ A;  3ID9 A;  3P5T A;  3Q1P A;  3MCF A;  2XSQ A;  5ANW A;  2G73 A;  3H95 A;  3X0O A;  1MUT A;  3GWY A;  1VC9 A;  1N6E A;  2FML A;  4N1T A;  3HHJ A;  4N1U A;  5IW5 A;  2A8S A;  3GRN A;  2A6T A;  2J8Q A;  3BHO A;  3U53 A;  3X0N A;  5IW4 A;  4JZT A;  1VIU A;  3QSJ A;  1V8R A;  3EF5 A;  3GHF A;  1V8S A;  3MDG A;  2A8Q A;  3KVH A;  3N9U A;  3O69 A;  1VHZ A;  1PUS A;  3X0R A;  5C7T A;  3K50 A;  2B06 A;  3J7Y e;  1SZ3 A;  1VHG A;  3I7U A;  4S2V A;  1X83 A;  2CL3 A;  1PPV A;  2I6K A;  3GZ5 A;  2DXL A;  4V14 A;  1PUQ A;  3FJY A;  1V8I A;  1Q54 A;  4NFX A;  2JVB A;  1NFS A;  4HFQ A;  3MDI A;  5FSM A;  1V8Y A;  2QJT A;  2DSC A;  5CFJ A;  2I8U A;  3GZ6 A;  1K32 A;  1VC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...