3DUPA

Crystal structure of mutt/nudix family hydrolase from rhodospirillum rubrum atcc 11170
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
284
structure length
284
Chain Sequence
SLSFLKHVQDCNTHDLSNFVRFVIEGRRVGWVRKALAQRLKAHGRVFDVTRDAVLLSASLRTPQSRTRAVADVVDRLADEGVVPAPRGELYRVNQSWGEPTLMLLDRAVVPTFGVRAYGVHLNGYVGAGADLHLWIGRRSPDKSVAPGKLDNMVAGGQPADLSLRQNLIKECAEEADLPEALARQAIPVGAITYCMESPAGIKPDTLFLYDLALPEDFRPHNTDGEMADFMLWPAAKVVEAVRTTEAFKFNVNLTVIDFAIRHGLIDPDNEPDYQEILAGLRGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MutT/nudix family protein
publication title Crystal Structure of Mutt/Nudix Family Hydrolase from Rhodospirillum Rubrum
rcsb
source organism Rhodospirillum rubrum atcc 11170
molecule tags Hydrolase
total genus 89
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15916 DUF4743 Domain of unknown function (DUF4743)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.160 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 3dupA02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3dupA01
3FSPA 1NQZA 1Q33A 2A6TA 5LPGA 3I9XA 1K26A 2RRKA 4KG4A 1V8IA 3MGMA 1HZTA 2G73A 3X0RA 4S2XA 4N1UA 1V8WA 5ANUA 4JZUA 5C7TA 3FK9A 4HFQA 4KYXA 2R5WA 3Q2SA 5GHNA 3I7UA 4NFXA 3SHDA 3ZR0A 1V8LA 1V8NA 2DSDA 1XSAA 3EF5A 3ACAA 5ANTA 3SONA 3X0KA 3O61A 1RRSA 3GWYA 4NFWA 2JVBA 4JZSA 4ICKA 3MCFA 3BAPA 4ILQA 4N1TA 2A8RA 2A8TA 3GG6A 1V8VA 1TUMA 1R67A 2DUKA 3Q1PA 1NQYA 3AC9A 3Q4IA 3RH7A 3WHWA 1JRKA 5FSOA 1XSBA 2I8UA 2B0VA 5GHIA 2DHOA 3KVHA 1V8YA 3DUPA 2VNPA 1SZ3A 3R03A 3X0LA 1VRLA 3ID9A 2YVPA 1JKNA 2GT2A 1GA7A 1NFZA 2A8QA 3X0JA 5DPKA 2J8QA 3A6SA 3OGAA 3X0NA 3ZR1A 4JZTA 3O6ZA 3MDIA 1VIUA 2A8SA 2ICJA 2YVOA 5I8UA 1G0SA 3BM4A 1RRQA 1KHZA 1U20A 5GHJA 4S2VA 3O69A 3O52A 3CNGA 2AZWA 4K6EA 1XSCA 3N9UA 1PUSA 3FFUA 3X0PA 1IRYA 1KT9A 2DSBA 5GHMA 5BS6A 1PVFA 3SMDA 2QJOA 5HZXA 3A6TA 3GRNA 1OW2A 1NFSA 3QSJA 2YYHA 5C7QA 1SU2A 2QJTA 3H95A 1V8RA 5ISYA 5ANVA 2CL3A 3GZ6A 3F13A 1MQWA 2ICKA 3FJYA 4MPOA 5ANWA 3GZ8A 2PNYA 5DD4A 5C8LA 1VC8A 5BONA 1KTGA 1Q54A 2I8TA 4S2YA 1QVJA 4S2WA 4V14A 3E57A 4C9XA 2YVMA 3X0OA 1F3YA 3BHOA 3X0QA 3EXQA 2VNQA 1VIQA 1X51A 1RYAA 5IW5A 3EEUA 1V8TA 1PPWA 5FSMA 4KG3A 2O1CA 2GT4A 3FCMA 1PPVA 2W4EA 3Q2TA 4KTBA 3X0SA 3I7VA 5IW4A 3X0IA 4DYWA 2A8PA 2YVNA 3P6YA 1PPXA 4IJXA 3J7Ye 2B2KA 3X0MA 2B06A 1SOIA 1MR2A 5ANSA 5CFJA 1K2EA 3EESA 3P5TA 5FSLA 2QKMB 1MK1A 1VHGA 1V8UA 1X84A 4HVYA 2G74A 2FKBA 1HX3A 2FVVA 2I6KA 5GHQA 2KDVA 3G0QA 1MQEA 5FSKA 3HHJA 3Q91A 3DKUA 3A6UA 4C9WA 3A6VA 3MDGA 3O8SA 1VK6A 1VHZA 1MUTA 1VC9A 2DSCA 3L85A 1V8MA 3HYQA 5FSIA 5GHOA 4YPHA 4YPRA 2KDWA 3N77A 1Q27A 3COUA 4JZVA 5DDGA 5DEQA 2O5FA 5CFIA 4YOQA 2GB5A 3GZ5A 1MP2A 1X83A 1PUNA 2FMLA 1V8SA 1VCDA 5FSNA 1PUQA 2Q9PA 2XSQA 3Q93A 1G9QA 1SJYA 3F6AA 4ZG0A 5GHPA 1I9AA 2O5WA 3U53A 2PQVA
chains in the Genus database with same CATH superfamily
1NQZA 5LPGA 1V8IA 3T6OA 1VC1A 1V8WA 5EUSA 3Q2SA 4NFXA 3SHDA 1H4YA 4QTPA 1TIDB 5ANTA 3SONA 3X0KA 3O61A 5EUXA 2JVBA 4ICKA 4N1TA 2A8TA 3GVKA 2OASA 3AC9A 1N6EA 3WHWA 1JRKA 2B0VA 4L8KA 1V0FA 1SZ3A 3A6SA 4HYLA 3O6ZA 2YVOA 3IHBA 1G0SA 1KHZA 3OIZA 3O52A 3X0PA 2DSBA 5GHMA 3GRNA 1OW2A 1NFSA 3EH7A 3GZ6A 3G0QA 1FCFA 5C8LA 4S2WA 2YVMA 3X0OA 1K32A 1N6FA 3X0QA 3EXQA 1RYAA 3MGLA 5FSMA 2O1CA 3JU4A 4IJXA 1MR2A 1SOIA 5CFJA 1V8UA 4HVYA 1VHZA 1V8MA 2KDWA 1FC6A 1Q27A 5DEQA 2O5FA 2GB5A 3GZ5A 1MP2A 3OIRA 5FSNA 1PUQA 2Q9PA 3Q93A 1G9QA 5GHPA 2O5WA 1IRYA 3F43A 3V97A 4L1CA 3I9XA 2RRKA 3V8VA 1HZTA 5ANUA 4JZUA 5C7TA 3FK9A 3GMFA 1V8LA 2CZRA 3DJAA 3GK7A 3NY7A 2DSDA 3EF5A 3ACAA 3GWYA 3MCFA 4J7GA 2KLNA 4ILQA 5EUUA 2A8RA 3QDQA 1V8VA 3Q1PA 3RH7A 1NQYA 2CWWA 1XSBA 4AE2A 1V8YA 3R03A 2YVPA 3X0JA 2A8QA 3OGAA 2ICJA 1U20A 3LLOA 4S2VA 1XSCA 3N9UA 1PUSA 5BS6A 2B78A 5C7QA 1SU2A 2CL3A 2KA5A 3GVJA 3ZXNA 1MQWA 2ICKA 1BPLA 2PNYA 1VC8A 1Q54A 4J7HA 1QVJA 3GHFA 3K50A 4KG3A 2GT4A 2W4EA 5IW4A 3I7VA 3X0IA 3J7Ye 5ANSA 1WXXA 1MK1A 1VHGA 3Q91A 3A6UA 4C9WA 3A6VA 3MDGA 3LKLA 2DSCA 3HYQA 4YPRA 1T6RA 4YOQA 2DXLA 1X83A 2FMLA 1V8SA 1SJYA 3F6AA 4GHNA 4JC0A 3FSPA 1H4ZA 3D03A 3IF5A 1K26A 4KG4A 3MGMA 3X0RA 4N1UA 1BUZA 4KYXA 4DGHA 5GHNA 3ZR0A 1XSAA 3C0KA 1RRSA 4NFWA 4JZSA 2DUKA 3Q4IA 1FC9A 5FSOA 5GHIA 2DHOA 3DUPA 2VNPA 3ID9A 1NFZA 4JZTA 5EUZA 3LDFA 1VIUA 3ZTBA 1TH8B 3O69A 4K6EA 1PVFA 5HZXA 3A6TA 3QSJA 2YYHA 3H95A 1V8RA 1H4XA 5ANVA 3FJYA 4MPOA 5BONA 3IH8A 2I8TA 4S2YA 4C9XA 3VSEA 3BHOA 2VNQA 1VIQA 1X51A 4HIZA 5IW5A 3EEUA 1V8TA 3Q2TA 3X0SA 2RRLA 2A8PA 2YVNA 3P6YA 2B2KA 2B06A 1K2EA 5FSLA 1X84A 2G74A 3AGEA 3DORA 2FKBA 1HX3A 2FVVA 2I6KA 2KDVA 5FSKA 5GHOA 1AUZA 5EZBA 5FSIA 4YPHA 3N77A 3COUA 5DDGA 1V0EA 1N6DA 3GVLA 4DGFA 1VCDA 2VY9A 4ZG0A 3U53A 1I9AA 3IHAA 1Q33A 2A6TA 1HF2A 4S2XA 4AEJA 2G73A 4HFQA 2R5WA 1FC7A 3I7UA 1WXWA 1V8NA 3MOGA 2AS0A 3BAPA 1TILB 3D3UA 3GG6A 1TUMA 1R67A 2I8UA 5EUWA 3KVHA 3X0LA 1VRLA 1JKNA 2GT2A 1GA7A 5DPKA 2J8QA 3ZR1A 3X0NA 3MDIA 2A8SA 5I8UA 3BM4A 1RRQA 5GHJA 2ZO9B 3CNGA 2AZWA 3FFUA 1KT9A 1THNB 3SMDA 2QJOA 1J7XA 2QJTA 5ISYA 3IH9A 3F13A 5ANWA 3GZ8A 5DD4A 1KTGA 4V14A 3AGDA 3E57A 1F3YA 1PPWA 4DMGA 3FCMA 1PPVA 4KTBA 4DYWA 1PPXA 3X0MA 1SBOA 3EESA 3P5TA 2QKMB 5GHQA 1MQEA 2ZOAA 3HHJA 3DKUA 3O8SA 1VK6A 1MUTA 1VC9A 3L85A 4XS5A 4JZVA 5CFIA 1PUNA 2XSQA 2PQVA 2DXNA
chains in the Genus database with same CATH topology
4GHNA 4JC0A 3FSPA 1NQZA 1Q33A 4L1CA 2A6TA 5LPGA 3D03A 3I9XA 1K26A 2RRKA 4KG4A 1V8IA 3MGMA 4AEJA 1HZTA 2G73A 3X0RA 4N1UA 4S2XA 1V8WA 5ANUA 4JZUA 5C7TA 3FK9A 4HFQA 3GMFA 4KYXA 2R5WA 3Q2SA 1FC7A 5GHNA 3I7UA 4NFXA 3SHDA 3ZR0A 1V8LA 2CZRA 3DJAA 1V8NA 2DSDA 1XSAA 3EF5A 3ACAA 5ANTA 3MOGA 3SONA 3X0KA 3O61A 1RRSA 3GWYA 4NFWA 2JVBA 4JZSA 4ICKA 3MCFA 3BAPA 4J7GA 4ILQA 4N1TA 2A8RA 2A8TA 3GG6A 1V8VA 1TUMA 1R67A 2DUKA 3Q1PA 1NQYA 3AC9A 3Q4IA 3RH7A 1N6EA 3WHWA 1FC9A 1JRKA 5FSOA 1XSBA 2I8UA 2B0VA 5GHIA 4AE2A 2DHOA 3KVHA 1V8YA 4L8KA 3DUPA 2VNPA 1SZ3A 3R03A 3X0LA 1VRLA 3ID9A 2YVPA 1JKNA 2GT2A 1GA7A 1NFZA 2A8QA 3X0JA 5DPKA 2J8QA 3A6SA 3OGAA 3X0NA 3ZR1A 4JZTA 3O6ZA 3MDIA 1VIUA 2A8SA 2ICJA 2YVOA 5I8UA 1G0SA 3BM4A 1RRQA 1KHZA 1U20A 5GHJA 4S2VA 3O69A 2ZO9B 3O52A 3CNGA 2AZWA 4K6EA 1XSCA 3N9UA 1PUSA 3FFUA 3X0PA 1IRYA 1KT9A 2DSBA 5GHMA 5BS6A 1PVFA 3SMDA 2QJOA 5HZXA 3A6TA 3GRNA 1OW2A 1NFSA 3QSJA 2YYHA 5C7QA 1J7XA 1SU2A 2QJTA 3H95A 1V8RA 5ISYA 5ANVA 2CL3A 3GZ6A 3F13A 1FCFA 1MQWA 2ICKA 3FJYA 1BPLA 3GZ8A 2PNYA 4MPOA 5DD4A 1VC8A 5ANWA 1KTGA 5BONA 1Q54A 2I8TA 4S2YA 4J7HA 1QVJA 4S2WA 4V14A 3E57A 5C8LA 4C9XA 3GHFA 2YVMA 3X0OA 1F3YA 3K50A 3BHOA 1K32A 1N6FA 3X0QA 3EXQA 2VNQA 1VIQA 1X51A 1RYAA 5IW5A 3EEUA 1V8TA 1PPWA 5FSMA 4KG3A 2O1CA 2GT4A 3FCMA 1PPVA 2W4EA 3Q2TA 4KTBA 3X0SA 3I7VA 5IW4A 2RRLA 3X0IA 4DYWA 2A8PA 2YVNA 3P6YA 1PPXA 4IJXA 3J7Ye 2B2KA 3X0MA 2B06A 1SOIA 1MR2A 5ANSA 5CFJA 1K2EA 3EESA 3P5TA 5FSLA 2QKMB 1MK1A 1VHGA 1V8UA 1X84A 4HVYA 2G74A 3DORA 2FKBA 1HX3A 2FVVA 2I6KA 5GHQA 2KDVA 3G0QA 1MQEA 2ZOAA 5FSKA 3HHJA 3Q91A 3DKUA 3A6UA 4C9WA 3A6VA 3MDGA 3O8SA 1VK6A 1VHZA 1MUTA 1VC9A 2DSCA 3L85A 1V8MA 3HYQA 5FSIA 5GHOA 4YPHA 4YPRA 2KDWA 3N77A 1FC6A 1Q27A 3COUA 5DDGA 4JZVA 5DEQA 2O5FA 5CFIA 4YOQA 1N6DA 2GB5A 3GZ5A 1MP2A 2DXLA 1PUNA 1X83A 2FMLA 1V8SA 1VCDA 5FSNA 1PUQA 2Q9PA 2XSQA 3Q93A 1G9QA 1SJYA 3F6AA 4ZG0A 5GHPA 1I9AA 2O5WA 3U53A 2PQVA 2DXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FSP A;  1NQZ A;  1Q33 A;  2A6T A;  5LPG A;  3I9X A;  1K26 A;  2RRK A;  4KG4 A;  1V8I A;  3MGM A;  1HZT A;  2G73 A;  3X0R A;  4S2X A;  4N1U A;  1V8W A;  5ANU A;  4JZU A;  5C7T A;  3FK9 A;  4HFQ A;  4KYX A;  2R5W A;  3Q2S A;  5GHN A;  3I7U A;  4NFX A;  3SHD A;  3ZR0 A;  1V8L A;  1V8N A;  2DSD A;  1XSA A;  3EF5 A;  3ACA A;  5ANT A;  3SON A;  3X0K A;  3O61 A;  1RRS A;  3GWY A;  4NFW A;  2JVB A;  4JZS A;  4ICK A;  3MCF A;  3BAP A;  4ILQ A;  4N1T A;  2A8R A;  2A8T A;  3GG6 A;  1V8V A;  1TUM A;  1R67 A;  2DUK A;  3Q1P A;  1NQY A;  3AC9 A;  3Q4I A;  3RH7 A;  3WHW A;  1JRK A;  5FSO A;  1XSB A;  2I8U A;  2B0V A;  5GHI A;  2DHO A;  3KVH A;  1V8Y A;  3DUP A;  2VNP A;  1SZ3 A;  3R03 A;  3X0L A;  1VRL A;  3ID9 A;  2YVP A;  1JKN A;  2GT2 A;  1GA7 A;  1NFZ A;  2A8Q A;  3X0J A;  5DPK A;  2J8Q A;  3A6S A;  3OGA A;  3X0N A;  3ZR1 A;  4JZT A;  3O6Z A;  3MDI A;  1VIU A;  2A8S A;  2ICJ A;  2YVO A;  5I8U A;  1G0S A;  3BM4 A;  1RRQ A;  1KHZ A;  1U20 A;  5GHJ A;  4S2V A;  3O69 A;  3O52 A;  3CNG A;  2AZW A;  4K6E A;  1XSC A;  3N9U A;  1PUS A;  3FFU A;  3X0P A;  1IRY A;  1KT9 A;  2DSB A;  5GHM A;  5BS6 A;  1PVF A;  3SMD A;  2QJO A;  5HZX A;  3A6T A;  3GRN A;  1OW2 A;  1NFS A;  3QSJ A;  2YYH A;  5C7Q A;  1SU2 A;  2QJT A;  3H95 A;  1V8R A;  5ISY A;  5ANV A;  2CL3 A;  3GZ6 A;  3F13 A;  1MQW A;  2ICK A;  3FJY A;  4MPO A;  5ANW A;  3GZ8 A;  2PNY A;  5DD4 A;  5C8L A;  1VC8 A;  5BON A;  1KTG A;  1Q54 A;  2I8T A;  4S2Y A;  1QVJ A;  4S2W A;  4V14 A;  3E57 A;  4C9X A;  2YVM A;  3X0O A;  1F3Y A;  3BHO A;  3X0Q A;  3EXQ A;  2VNQ A;  1VIQ A;  1X51 A;  1RYA A;  5IW5 A;  3EEU A;  1V8T A;  1PPW A;  5FSM A;  4KG3 A;  2O1C A;  2GT4 A;  3FCM A;  1PPV A;  2W4E A;  3Q2T A;  4KTB A;  3X0S A;  3I7V A;  5IW4 A;  3X0I A;  4DYW A;  2A8P A;  2YVN A;  3P6Y A;  1PPX A;  4IJX A;  3J7Y e;  2B2K A;  3X0M A;  2B06 A;  1SOI A;  1MR2 A;  5ANS A;  5CFJ A;  1K2E A;  3EES A;  3P5T A;  5FSL A;  2QKM B;  1MK1 A;  1VHG A;  1V8U A;  1X84 A;  4HVY A;  2G74 A;  2FKB A;  1HX3 A;  2FVV A;  2I6K A;  5GHQ A;  2KDV A;  3G0Q A;  1MQE A;  5FSK A;  3HHJ A;  3Q91 A;  3DKU A;  3A6U A;  4C9W A;  3A6V A;  3MDG A;  3O8S A;  1VK6 A;  1VHZ A;  1MUT A;  1VC9 A;  2DSC A;  3L85 A;  1V8M A;  3HYQ A;  5FSI A;  5GHO A;  4YPH A;  4YPR A;  2KDW A;  3N77 A;  1Q27 A;  3COU A;  4JZV A;  5DDG A;  5DEQ A;  2O5F A;  5CFI A;  4YOQ A;  2GB5 A;  3GZ5 A;  1MP2 A;  1X83 A;  1PUN A;  2FML A;  1V8S A;  1VCD A;  5FSN A;  1PUQ A;  2Q9P A;  2XSQ A;  3Q93 A;  1G9Q A;  1SJY A;  3F6A A;  4ZG0 A;  5GHP A;  1I9A A;  2O5W A;  3U53 A;  2PQV A; 
#chains in the Genus database with same CATH topology
 1NQZ A;  5LPG A;  1V8I A;  3T6O A;  1VC1 A;  1V8W A;  5EUS A;  3Q2S A;  4NFX A;  3SHD A;  1H4Y A;  4QTP A;  1TID B;  5ANT A;  3SON A;  3X0K A;  3O61 A;  5EUX A;  2JVB A;  4ICK A;  4N1T A;  2A8T A;  3GVK A;  2OAS A;  3AC9 A;  1N6E A;  3WHW A;  1JRK A;  2B0V A;  4L8K A;  1V0F A;  1SZ3 A;  3A6S A;  4HYL A;  3O6Z A;  2YVO A;  3IHB A;  1G0S A;  1KHZ A;  3OIZ A;  3O52 A;  3X0P A;  2DSB A;  5GHM A;  3GRN A;  1OW2 A;  1NFS A;  3EH7 A;  3GZ6 A;  3G0Q A;  1FCF A;  5C8L A;  4S2W A;  2YVM A;  3X0O A;  1K32 A;  1N6F A;  3X0Q A;  3EXQ A;  1RYA A;  3MGL A;  5FSM A;  2O1C A;  3JU4 A;  4IJX A;  1MR2 A;  1SOI A;  5CFJ A;  1V8U A;  4HVY A;  1VHZ A;  1V8M A;  2KDW A;  1FC6 A;  1Q27 A;  5DEQ A;  2O5F A;  2GB5 A;  3GZ5 A;  1MP2 A;  3OIR A;  5FSN A;  1PUQ A;  2Q9P A;  3Q93 A;  1G9Q A;  5GHP A;  2O5W A;  1IRY A;  3F43 A;  3V97 A;  4L1C A;  3I9X A;  2RRK A;  3V8V A;  1HZT A;  5ANU A;  4JZU A;  5C7T A;  3FK9 A;  3GMF A;  1V8L A;  2CZR A;  3DJA A;  3GK7 A;  3NY7 A;  2DSD A;  3EF5 A;  3ACA A;  3GWY A;  3MCF A;  4J7G A;  2KLN A;  4ILQ A;  5EUU A;  2A8R A;  3QDQ A;  1V8V A;  3Q1P A;  3RH7 A;  1NQY A;  2CWW A;  1XSB A;  4AE2 A;  1V8Y A;  3R03 A;  2YVP A;  3X0J A;  2A8Q A;  3OGA A;  2ICJ A;  1U20 A;  3LLO A;  4S2V A;  1XSC A;  3N9U A;  1PUS A;  5BS6 A;  2B78 A;  5C7Q A;  1SU2 A;  2CL3 A;  2KA5 A;  3GVJ A;  3ZXN A;  1MQW A;  2ICK A;  1BPL A;  2PNY A;  1VC8 A;  1Q54 A;  4J7H A;  1QVJ A;  3GHF A;  3K50 A;  4KG3 A;  2GT4 A;  2W4E A;  5IW4 A;  3I7V A;  3X0I A;  3J7Y e;  5ANS A;  1WXX A;  1MK1 A;  1VHG A;  3Q91 A;  3A6U A;  4C9W A;  3A6V A;  3MDG A;  3LKL A;  2DSC A;  3HYQ A;  4YPR A;  1T6R A;  4YOQ A;  2DXL A;  1X83 A;  2FML A;  1V8S A;  1SJY A;  3F6A A;  4GHN A;  4JC0 A;  3FSP A;  1H4Z A;  3D03 A;  3IF5 A;  1K26 A;  4KG4 A;  3MGM A;  3X0R A;  4N1U A;  1BUZ A;  4KYX A;  4DGH A;  5GHN A;  3ZR0 A;  1XSA A;  3C0K A;  1RRS A;  4NFW A;  4JZS A;  2DUK A;  3Q4I A;  1FC9 A;  5FSO A;  5GHI A;  2DHO A;  3DUP A;  2VNP A;  3ID9 A;  1NFZ A;  4JZT A;  5EUZ A;  3LDF A;  1VIU A;  3ZTB A;  1TH8 B;  3O69 A;  4K6E A;  1PVF A;  5HZX A;  3A6T A;  3QSJ A;  2YYH A;  3H95 A;  1V8R A;  1H4X A;  5ANV A;  3FJY A;  4MPO A;  5BON A;  3IH8 A;  2I8T A;  4S2Y A;  4C9X A;  3VSE A;  3BHO A;  2VNQ A;  1VIQ A;  1X51 A;  4HIZ A;  5IW5 A;  3EEU A;  1V8T A;  3Q2T A;  3X0S A;  2RRL A;  2A8P A;  2YVN A;  3P6Y A;  2B2K A;  2B06 A;  1K2E A;  5FSL A;  1X84 A;  2G74 A;  3AGE A;  3DOR A;  2FKB A;  1HX3 A;  2FVV A;  2I6K A;  2KDV A;  5FSK A;  5GHO A;  1AUZ A;  5EZB A;  5FSI A;  4YPH A;  3N77 A;  3COU A;  5DDG A;  1V0E A;  1N6D A;  3GVL A;  4DGF A;  1VCD A;  2VY9 A;  4ZG0 A;  3U53 A;  1I9A A;  3IHA A;  1Q33 A;  2A6T A;  1HF2 A;  4S2X A;  4AEJ A;  2G73 A;  4HFQ A;  2R5W A;  1FC7 A;  3I7U A;  1WXW A;  1V8N A;  3MOG A;  2AS0 A;  3BAP A;  1TIL B;  3D3U A;  3GG6 A;  1TUM A;  1R67 A;  2I8U A;  5EUW A;  3KVH A;  3X0L A;  1VRL A;  1JKN A;  2GT2 A;  1GA7 A;  5DPK A;  2J8Q A;  3ZR1 A;  3X0N A;  3MDI A;  2A8S A;  5I8U A;  3BM4 A;  1RRQ A;  5GHJ A;  2ZO9 B;  3CNG A;  2AZW A;  3FFU A;  1KT9 A;  1THN B;  3SMD A;  2QJO A;  1J7X A;  2QJT A;  5ISY A;  3IH9 A;  3F13 A;  5ANW A;  3GZ8 A;  5DD4 A;  1KTG A;  4V14 A;  3AGD A;  3E57 A;  1F3Y A;  1PPW A;  4DMG A;  3FCM A;  1PPV A;  4KTB A;  4DYW A;  1PPX A;  3X0M A;  1SBO A;  3EES A;  3P5T A;  2QKM B;  5GHQ A;  1MQE A;  2ZOA A;  3HHJ A;  3DKU A;  3O8S A;  1VK6 A;  1MUT A;  1VC9 A;  3L85 A;  4XS5 A;  4JZV A;  5CFI A;  1PUN A;  2XSQ A;  2PQV A;  2DXN A; 
#chains in the Genus database with same CATH homology
 4GHN A;  4JC0 A;  3FSP A;  1NQZ A;  1Q33 A;  4L1C A;  2A6T A;  5LPG A;  3D03 A;  3I9X A;  1K26 A;  2RRK A;  4KG4 A;  1V8I A;  3MGM A;  4AEJ A;  1HZT A;  2G73 A;  3X0R A;  4N1U A;  4S2X A;  1V8W A;  5ANU A;  4JZU A;  5C7T A;  3FK9 A;  4HFQ A;  3GMF A;  4KYX A;  2R5W A;  3Q2S A;  1FC7 A;  5GHN A;  3I7U A;  4NFX A;  3SHD A;  3ZR0 A;  1V8L A;  2CZR A;  3DJA A;  1V8N A;  2DSD A;  1XSA A;  3EF5 A;  3ACA A;  5ANT A;  3MOG A;  3SON A;  3X0K A;  3O61 A;  1RRS A;  3GWY A;  4NFW A;  2JVB A;  4JZS A;  4ICK A;  3MCF A;  3BAP A;  4J7G A;  4ILQ A;  4N1T A;  2A8R A;  2A8T A;  3GG6 A;  1V8V A;  1TUM A;  1R67 A;  2DUK A;  3Q1P A;  1NQY A;  3AC9 A;  3Q4I A;  3RH7 A;  1N6E A;  3WHW A;  1FC9 A;  1JRK A;  5FSO A;  1XSB A;  2I8U A;  2B0V A;  5GHI A;  4AE2 A;  2DHO A;  3KVH A;  1V8Y A;  4L8K A;  3DUP A;  2VNP A;  1SZ3 A;  3R03 A;  3X0L A;  1VRL A;  3ID9 A;  2YVP A;  1JKN A;  2GT2 A;  1GA7 A;  1NFZ A;  2A8Q A;  3X0J A;  5DPK A;  2J8Q A;  3A6S A;  3OGA A;  3X0N A;  3ZR1 A;  4JZT A;  3O6Z A;  3MDI A;  1VIU A;  2A8S A;  2ICJ A;  2YVO A;  5I8U A;  1G0S A;  3BM4 A;  1RRQ A;  1KHZ A;  1U20 A;  5GHJ A;  4S2V A;  3O69 A;  2ZO9 B;  3O52 A;  3CNG A;  2AZW A;  4K6E A;  1XSC A;  3N9U A;  1PUS A;  3FFU A;  3X0P A;  1IRY A;  1KT9 A;  2DSB A;  5GHM A;  5BS6 A;  1PVF A;  3SMD A;  2QJO A;  5HZX A;  3A6T A;  3GRN A;  1OW2 A;  1NFS A;  3QSJ A;  2YYH A;  5C7Q A;  1J7X A;  1SU2 A;  2QJT A;  3H95 A;  1V8R A;  5ISY A;  5ANV A;  2CL3 A;  3GZ6 A;  3F13 A;  1FCF A;  1MQW A;  2ICK A;  3FJY A;  1BPL A;  3GZ8 A;  2PNY A;  4MPO A;  5DD4 A;  1VC8 A;  5ANW A;  1KTG A;  5BON A;  1Q54 A;  2I8T A;  4S2Y A;  4J7H A;  1QVJ A;  4S2W A;  4V14 A;  3E57 A;  5C8L A;  4C9X A;  3GHF A;  2YVM A;  3X0O A;  1F3Y A;  3K50 A;  3BHO A;  1K32 A;  1N6F A;  3X0Q A;  3EXQ A;  2VNQ A;  1VIQ A;  1X51 A;  1RYA A;  5IW5 A;  3EEU A;  1V8T A;  1PPW A;  5FSM A;  4KG3 A;  2O1C A;  2GT4 A;  3FCM A;  1PPV A;  2W4E A;  3Q2T A;  4KTB A;  3X0S A;  3I7V A;  5IW4 A;  2RRL A;  3X0I A;  4DYW A;  2A8P A;  2YVN A;  3P6Y A;  1PPX A;  4IJX A;  3J7Y e;  2B2K A;  3X0M A;  2B06 A;  1SOI A;  1MR2 A;  5ANS A;  5CFJ A;  1K2E A;  3EES A;  3P5T A;  5FSL A;  2QKM B;  1MK1 A;  1VHG A;  1V8U A;  1X84 A;  4HVY A;  2G74 A;  3DOR A;  2FKB A;  1HX3 A;  2FVV A;  2I6K A;  5GHQ A;  2KDV A;  3G0Q A;  1MQE A;  2ZOA A;  5FSK A;  3HHJ A;  3Q91 A;  3DKU A;  3A6U A;  4C9W A;  3A6V A;  3MDG A;  3O8S A;  1VK6 A;  1VHZ A;  1MUT A;  1VC9 A;  2DSC A;  3L85 A;  1V8M A;  3HYQ A;  5FSI A;  5GHO A;  4YPH A;  4YPR A;  2KDW A;  3N77 A;  1FC6 A;  1Q27 A;  3COU A;  5DDG A;  4JZV A;  5DEQ A;  2O5F A;  5CFI A;  4YOQ A;  1N6D A;  2GB5 A;  3GZ5 A;  1MP2 A;  2DXL A;  1PUN A;  1X83 A;  2FML A;  1V8S A;  1VCD A;  5FSN A;  1PUQ A;  2Q9P A;  2XSQ A;  3Q93 A;  1G9Q A;  1SJY A;  3F6A A;  4ZG0 A;  5GHP A;  1I9A A;  2O5W A;  3U53 A;  2PQV A;  2DXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...