4JC0A

Crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
432
structure length
424
Chain Sequence
RVGIKVLGCPKNEADCEVLAGVLREGGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSFVDAKDQYGYKLVVKGCLVQRYYEELKKEIPEVDQWIGVADPEEIANAIETDLVPDRYRKRIDLEERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Fe-S clusters catalyze sulfur insertion by radical-SAM methylthiotransferases.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Ribosomal protein S12 methylthiotransferase RimO
total genus 124
structure length 424
sequence length 432
chains with identical sequence B
ec nomenclature ec 2.8.4.4: [Ribosomal protein S12] (aspartate(89)-C(3))-methylthiotransferase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00919 UPF0004 Uncharacterized protein family UPF0004
A PF04055 Radical_SAM Radical SAM superfamily
A PF18693 TRAM_2 TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jc0A04
3.30.750.200 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A03
3.30.750.210 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A02
3.40.50.12160 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jc0A01
4JG2A 4JI1Q 5IYCG 4X64Q 3ERSX 1SR3A 1KL9A 2L15A 2YYZA 4DV4Q 1VQKA 4B3TQ 3F8TA 3HOUH 3T1HQ 4QY7A 3FKIG 4DV6L 2Y0SE 4IOAA 1QVGA 1VQMA 4AH6A 1L1OA 2WAQE 1GKHA 3G48A 1VS0A 3UDIA 4B3RQ 1MJCA 1A62A 1WOCA 3BU2A 2JQOA 1Q7YC 4RG1A 4YHHL 2K14A 4X66Q 3J81j 4P72A 1S72A 4LF8Q 1HNXL 2E5LL 5JJIA 2NZHA 4A4IA 4GKJQ 4LF6L 3PIOA 4DR1L 4DPGA 2UXDQ 2EIFA 4YY3L 5IE8A 3RZDH 2R6GA 2HT1A 4NXML 2CFMA 4X6AH 1IBLQ 2LSSA 3F2CA 3E9IA 5M3MG 1VQ5A 4JI8Q 2AWOA 1I94Q 4OONA 4X65L 1Y1WH 1H95A 2V1CC 3AFPA 4LFAQ 1X56A 2IHEA 1VQDA 1X55A 2YTYA 2N3SA 1SROA 1CSPA 3U4ZA 2NZOA 1WI5A 4DR2L 4JC0A 1M1KC 1Y1VG 1Q1EA 3MEFA 4BA2I 4OO1G 4GKJL 3H3VH 4DK6C 3S17H 1G291 2JE6I 3ER0A 2DGYA 3W1GA 5IP9H 3M85A 4KHPL 4YWKA 3PF4A 1L1OC 1C0AA 2IY5B 3U58A 4A3BH 4X62L 5FJ8G 4JCVE 3OTOL 2CWPA 1JJCB 4GLXA 2K4KA 4A3KH 4JBJA 2JA9A 1VQPA 4C3IH 1PH9A 4JI7Q 1HNWL 4DV5Q 4GNXC 3JC66 3PUXA 2N8NA 4YWLA 1LTLA 3HOZH 3CCQA 3A5ZB 4DR4Q 2ZTDA 1BVSA 1X3FA 3CW2C 3GTQH 3UDFA 3UE1A 4A3GH 3PO2H 3CC7A 2OWOA 2I5MX 4B3ML 2EXDA 3WWVA 5AJ3Q 1FL0A 3ULPA 3S24A 4A3IH 2YTVA 1U5KA 5FLMH 2R92G 3W5OA 2QA4A 3K80C 1PVOA 2NVQH 1PYSB 4DNIA 4X62Q 1M90C 4JI4Q 1VQHA 1XTDA 2A1AA 4TVAB 3I55A 3HKZG 2YU9H 4BY1H 1Q8KA 3S1RH 2UUCL 5C4XG 1Q12A 2JA6H 1X65A 1Q46A 4A3MG 4BY7G 1SE8A 1IBKL 3CC4A 3M4QA 2N78A 1O7IA 1G51A 4A76A 1PH1A 3AQQA 2UXCQ 5C3EH 1HH2P 2WP8J 1HZAA 3NELA 4LFCL 5GADC 5FJ8H 2MO0A 4DK3C 1WYDA 3CQZH 3KF8B 3LGJA 1K8AC 1MJEA 4HJAA 1PH2A 3GD7A 1XMOL 4A75A 2JEAI 5C0XG 4JI4L 3F2DA 1YHBA 4EQ5A 3JAMc 4IFDJ 5JEAG 2HIXA 3GTJH 5M3FH 4GLVB 1TXYA 2K5NA 4MTNA 1KD1C 2I0QA 1QUQB 1JT8A 2K75A 2UXBQ 2OTJA 4OO1I 1AE2A 1V9PA 3K8AA 1GVPA 4C3HH 5M3FG 1X9NA 4A3EG 2UUBL 2JA8H 3TQYA 5M5WH 4KHZA 1VQ9A 4JBWA 4DAYB 4GNXA 1TWCH 4R1JA 4A3JH 4JI5Q 1D7QA 2VQFL 3A74A 4L5QA 4P73A 5IT9c 1Q1BA 3KJPA 3PF5A 1K73C 4A3FH 1PH5A 1HR0W 3CD6A 2Z6KC 4GN5A 1HZCA 4DUYL 4OX9Q 4JI3Q 3A5UA 1WJJA 2VL6A 2VZAA 2Z0SA 3UDXA 2C35B 1BKBA 1U0LA 4B3SL 4BY7H 1Q81C 2Z6KA 1E24A 4GOPB 5HY6A 3PUVA 4JI0L 5IY0A 3CF5A 1IBLL 5M5XH 3GTOH 1X6OA 4HIKA 5E7NA 1TWHH 2ID0A 3HOXH 3HOYG 1YHAA 1I50H 1V43A 4J15A 1AH9A 5C0XJ 2I5LX 5IWAL 2OCEA 1N9WA 4A3IG 1Y1WG 1J5EQ 2CWAA 2KBNA 1GD7A 2F52A 4KLKA 3HOVH 2WFWA 1HJPA 1L1OB 2UU9L 2E2HH 4A93H 4B3SQ 1PFSA 3CC2A 4Y7NH 1JB7A 1YBYA 2KCMA 1OXXK 2BH8A 3ULJA 1VQ7A 3S14H 3CAMA 1CKOA 4B3RL 2RCNA 4LF4L 4R4TA 1TWFH 1I5FA 1SN8A 3UE0A 4BBRG 1OTCA 2YTXA 2R93G 3MXNB 1IL2A 2ZTCA 1UE1A 2BA0A 4K0KL 1S3OA 2ZJQA 1IYJB 2JEBI 2HHHQ 1KRTA 2OQ0A 3PGZA 4NXNL 3K7UC 1E1TA 4X64L 2JA5H 3AFQA 2AKWB 4OWXB 1LUZA 1P16A 4BBSG 5JEAJ 5HGQA 4DV3Q 2Q2IA 5GAEC 2NVXH 4AIMA 4DR3L 1YITA 1NMFA 1CKMA 2A19A 3CCLA 4POGA 1E22A 1YI2A 1YZ6A 3K81C 3I2ZA 1QVFA 2NVTH 4DR6Q 4AYBE 1X54A 4GKKL 3HOVG 4IPGA 3H15A 2EQSA 3L0OA 4LUVA 5LMNQ 3K7AH 4GS3A 4YY3Q 1R9TH 4DV3L 4YWMA 3J80c 4LF6Q 1Y1VH 4TQUS 5JJLA 4L5SA 4DV0Q 1QZHA 1K83H 1Z47A 1FVIA 5BR8L 3DLLA 1GM5A 1XNQL 3VDYA 5C44H 3I4OA 3KYHC 4RMFA 4OXPA 3KJOA 1N32Q 3STBC 4JBMA 3SGIA 2KCTA 1JE5A 3W1BA 1EUJA 2VQFQ 1SMXA 1VQAA 2ALYB 2MNAA 1I6HH 4ME3A 5EAYA 5IYDG 4P74A 3J81i 2ZM6Q 1YVCA 1XNRL 4A3DG 4GKKQ 5K36G 3HKSA 1VQEA 4A3LG 3RLFA 1JJ2A 3OTOQ 2K50A 4DR7L 4HJ5A 3T1HL 5IYBG 4JI1L 5C4JH 4DV4L 4BXXH 3DM3A 1CSQA 1VQFA 4LF5Q 3IRBA 2WB1G 2XTIA 3E9HA 4A3EH 1VCIA 4DR4L 4IPHA 1EWIA 3CXCA 3CCVA 1ASYA 4DAMA 1OXVA 2ZM6L 1KC8C 4R4IA 1NMGA 5C0XI 2Q2TA 2GVBA 1NY4A 1KQSA 1PH8A 4PZ8A 4C2MH 3HOUG 2A8VA 1XNRQ 4MNOA 3ZJYC 1PH3A 2QEXA 4PZ6A 1QUQA 1EYGA 2H5XA 3J80i 1DGSA 2E2JH 1IXRA 3B6YA 4QQBX 5C3EG 3EN2A 3G6EA 4DR7Q 3BZCA 4H02A 2LXJA 3FHWA 5M5YH 4L5RC 1IBMQ 4NPSA 4C3JH 1QVCA 1FJGL 3PCOB 4YCVA 2JK8A 3CCSA 2B63H 1A63A 2R7ZH 4QJFA 4NB3A 2R92H 3U4VA 1XPRA 1PH7A 1NBWA 2D0PA 4JI6L 3PIPA 3CCMA 1S40A 1T9HA 2RHQB 3NENA 4XTCS 4BBRH 4LUZA 4BXXG 4HJ7A 4R4QA 3ULLA 3PV0A 4WJ4A 3NBHB 1FJGQ 3D0FA 2MQHA 2ATWA 4A3FG 4LWCA 1IBML 3F1ZA 1VQIA 5FLXc 3A0JA 1N34Q 2UUAL 1RIPA 4DR6L 1HNZL 3PSIA 4JBKA 1J5EL 3ICEA 1PHJA 1SFOH 3UDGA 1VQLA 2GVAA 1KIXA 1NJIC 1XPUA 4JYAQ 3KDFA 3OYYA 1UE5A 1VQJA 4IPDA 2K52A 1L0WA 4A3CG 4LFBL 4XIGS 2B3GA 4BBSH 2AMCB 4LUOA 3J7A5 4O2DA 2DUDA 2E2IH 3KLWA 1UWVA 3HFZB 1JJGA 4LF7L 2B63G 4HIDA 3E0EA 2XGTA 4PZ7A 3NEMA 2KHIA 1HNXQ 5LMUQ 2JA7H 3TS2A 3I4MG 3S2DH 2VY3A 4DUZL 4UP8A 3CCRA 2UXCL 4X66L 4OWTB 2VS1A 1HZ9A 3PUWA 1Z9FA 4HIOA 2LXKA 1QZGA 1JMCA 3GTKH 3PO3G 5IWAQ 3S15H 4JYAL 1K0RA 4IFDI 4LFBQ 3KFUA 1VQ6A 1YJ9A 3PO3H 2JA6G 1AE3A 4X65Q 1YEZA 2KHJA 2F4VQ 4LFAL 4EX5A 1YNXA 4A3BG 4GN3B 2IX0A 4JI8L 4HIMA 3H0GG 1L2FA 3HKZE 1YJNA 1UE7A 1CUKA 5LMUL 3HOXG 1NTGA 5GQOA 4HJ9A 4GLAC 4LF7Q 3M7NA 1KHIA 4IFDG 2JA5G 2VQEQ 2NN6G 3RN2A 4DR2Q 5LMNW 2R7ZG 2D0OA 1WFQA 2E8GA 2WB1E 4FDBA 1EIFA 4GNXB 3S1QH 3HOZG 2PI2A 2UUBQ 4JI5L 4A3CH 2HHHL 4IPCA 2R7DA 4AYBG 3RLNA 4K0KQ 2VUMH 1BBUA 1Q86C 4L5TA 1HNWQ 3D31A 1Q82C 5GAHC 5GROA 2YV5A 2NVYH 3JAMi 1N33Q 3TEHB 4OWWB 2VUMG 1FGUA 2JA7G 4JI3L 1BBWA 2IHFA 4GOPA 3CCEA 2MFIA 1MKHA 4POFA 1SRUA 5C4XH 4YHHQ 4DR1Q 5IP7H 1HR0L 4YCUA 2Q2HA 1MIUA 1VQ4A 4B3MQ 3TRZA 2RHSB 5IP7G 5ELOA 3L2PA 5DLQE 3CMEA 3GO5A 1NE3A 3M4PA 2VW9A 1EQQA 3J81c 1C7YA 3GTGH 2VNUD 2MO1A 4B3TL 2BH2A 3M3YH 5IYDH 5J3BA 3U50C 2BA1A 4A3DH 1E3PA 1P8LA 2B29A 3I7FA 2ZJRA 1G6PA 2UUAQ 4LW1A 4ALPA 1E1OA 3GTLH 1N8RC 2K5VA 4UP7A 3STBD 1K9MC 4QIWE 4DV1Q 1XMQQ 2OTLA 2F3IA 2IX1A 2CKZB 2RF4A 4JV5Q 4BA1I 2N49A 1K3RA 4R4OA 4UP9A 3RZOH 3M4OH 4LF8L 2JA8G 1B8AA 4A93G 4NXNQ 2R7FA 2ASBA 1TWAH 4MZ9A 1LYLA 2GN5A 1IZ6A 2HIVA 4LF9Q 3RNUA 3FKIH 2R93H 1V1QA 3H0GH 3K0XA 3G71A 5IYCH 1ASZA 2KENA 3CPFA 4DR3Q 3RN5A 3GTPH 4JV5L 2QGQA 4DR5Q 1Y14B 4GOPC 4QL5A 4AQYQ 4DV7L 4A3MH 1YJWA 1WCMH 3J7ZC 1W2BA 4A3LH 4DUYQ 1K8GA 3PUYA 2UXBL 3T1YL 1GO3E 4JOIA 3F2BA 5LMNL 1WCMG 4KHPQ 3BJUA 4IOCA 1YIJA 1EFWA 3OW2A 3I4MH 3TS0A 3GTMH 3HOWG 4DV2L 2IT1A 3GDEA 2UUCQ 1X3GA 4DV6Q 1IBKQ 1VQOA 4P71A 4JI7L 1UEBA 3CPWA 4DV5L 5JJKA 1HNZQ 4DV0L 1PH6A 1A0IA 1EQRA 4AQYL 3S1NH 2ZTEA 4O0AA 1W3SA 2WAQG 1OXTA 2D62A 1XMOQ 1N32L 5M3MH 3T1YQ 4DR5L 3KDFB 3I4NH 2UU9Q 2AWNA 4JI2Q 2E5LQ 4JI6Q 1SLJA 5AJ3L 3L7ZC 1LM0A 3EIVA 1XJVA 1N36L 4A3KG 4NXMQ 1OXSC 4DV2Q 4LNQA 4IO9A 4WJ3M 1VQBA 2FXQA 4LF4Q 2PNHA 3CP0A 3RLOA 4DUZQ 3I56A 4DKAC 1N34L 1EOVA 1EIYB 2OQKA 1RL2A 1UE6A 2ES2A 1C9OA 4JI2L 4OX9L 3PO2G 2PQAA 3H3VI 3CCJA 3KF6B 5IYBH 3FP9A 1CKNA 5FLMG 2I5HA 2PMZE 1XPOA 4A3GG 4APVA 4JOIC 3G4SA 1N36Q 1PA6A 2PQAB 1TWGH 4UPAA 1E7ZA 4KI0A 2K5HA 5H1SE 1VQNA 3KF6A 5ELNA 4YCWA 2ZJPA 4Y52H 1B7YB 2JJQA 1CKNB 4PG3A 1OXUA 2CQOA 1D8LA 3RR5A 1I3QH 1X3EA 2Y0SG 3M9BA 3I4NG 4LF5L 4DV1L 1XMQL 2PI2E 4BY1G 3CCUA 3AEVA 1KRSA 5C44G 3S16H 1KAWA 5IP9G 2Q2UA 3S1MH 1HZBA 4UY8C 4R4CA 3TREA 1KXLA 3BZKA 4HJ8A 1N33L 4LF9L 3HOYH 1VQ8A 2F4VL 4IJHA 3KOJA 1PH4A 1YHQA 3HOWH 1VQGA 4PMWA 3AYHB 3PUZA 2HQLA 4GN4B 4IJLA 5BR8Q 1XNQQ 1A8VA 4P75A 2AHOB 2NN6I 3EBEA 4JI0Q 1HR0Q 4DV7Q 3S2HH 1B70B 1PYBA 1I94L 3Q8DA 1PV4A 5GAGC 2CCZA 3CMAA 1J6QA 4A3JG 2VQEL 1VQCA 4LFCQ 4QGUA 2UXDL
chains in the Genus database with same CATH superfamily
2F1MA 1BWQA 4IS3A 4A73A 2BT4A 5DYYA 4KIGA 3IT3A 1FRZA 1O77A 2FZKA 2XCLA 1ICIA 3OM0A 4DV4Q 1C0EA 4ODGA 1PJLA 1YJQA 3KFLA 4RPJA 4KQWA 3G7UA 4ZAWA 2G07A 3RVRA 5BVHA 3THYA 1ITZA 1U6KA 4WZAE 1VQMA 2H3EA 3BGIA 2X0IA 3BMCA 4RHXA 5T6MA 1D4OA 5CVDA 1FUUA 1LB1B 4JT4A 4WZAA 4RPKA 1BX0A 3GZNA 1LTQA 1CY8A 1M2NA 5G1PA 1B9MA 1KJ9A 3WJ2A 2BOVA 3ZWAA 4QRIA 3C2QA 3FUUA 3J81j 5HFAA 3IPYA 2ZW9A 3WSVA 4CMIB 1EM8B 1FBNA 3RBXA 1E6CA 2GYWA 1WB9A 1IY2A 1U1DA 4LF6L 4QYSA 1LC0A 3GNSA 1T9GS 3OBBA 3SIXA 2JFZA 3OJCA 4OTZA 1W6UA 4LA4A 3OX2A 1UM9A 1E6LA 5BY2A 3NQIA 1QLWA 4X6AH 3KQMA 3NEYA 4TV9B 3QXCA 2E74C 1VQ5A 3C1AA 4LGYA 4DV2B 5EIXA 4GMDA 5EMJA 2AG6A 4L8KA 2Q2QA 2PCFB 4GNRA 3SHFA 5LNK1 2IHEA 2EQAA 1VHWA 1C7IA 2VPPA 4FONA 4LE2A 2Q2VA 3W2TA 4X3UA 5TB5A 2J41A 3BS4A 3PG5A 4JQOA 2R7ZB 4HTFB 4M0UA 4QQFA 4YJ2B 4BA2I 1STYA 1R0ZA 1JS1X 2KPOA 2AK3A 2WAMA 1MB9A 3FPGA 3H9BA 3KXIA 4YASA 1UEAB 3U7QB 1E1QD 3FTCA 4HPJB 4DNXA 3S29A 2QN3A 3SZRA 3P94A 1HUQA 3BJZA 2OK8A 1RI3A 3HU3A 5L3QB 1JSLA 2Q6OA 5CV9A 4MO2A 3E9DA 3K6KA 1PH9A 4BBJA 1DQPA 1JH8A 1T3ZA 2J9YB 5IT5A 3FA2A 5K0BA 1XAGA 2X2PA 2VZEA 1UZUA 3RRZA 1KI3A 3VJMA 5JANA 3KFVA 3S8YA 5L3ZA 2L17A 4UZSA 3D1LA 2JGDA 4DR4Q 4J03A 4AYTA 4I1PA 3FOEC 1X7WA 5E4XA 1KHTA 4RLFA 5FBWB 4NCNA 4A91A 4B6GA 3RWOA 3AP2A 2HDNB 1K8MA 4NBRA 2V7VA 5HS4A 3CC7A 3I0MA 4Q3OA 3TINA 5MHTA 1YE8A 2PLAA 1NXSA 3GEIA 2JAPA 2EBFX 2FU5C 4OIFA 1QQ7A 4RAOA 5ALKA 5HQ3A 2L1BA 4NE9A 1KKLA 5CA0F 4QFMA 5YASA 1TM7E 4PCAA 2Y1DA 1IM5A 4MKZA 3VKVA 1OC4A 3BXXA 3KZVA 1BRMA 2NBFA 4N6OA 1N92A 3FFBA 4P53A 4YP7A 5BSRA 2SNSA 3KSUA 3B9BA 2WZQA 4FFRA 2PSEA 2YWGA 4ZOAA 5E6UA 4UEQA 2Q7OE 4US2R 3NDBB 2H2IA 5HWSA 4Q4HA 2QEQA 5IDXA 1WLYA 1IHDA 3M4QA 1YONA 2E4XA 2J5QA 2CHQA 2M6LA 1DRJA 4B3HA 1X3PA 2W2MA 2K2QB 4AVYA 1Z5VA 4LZJA 2C4VA 4V0NA 3RC8A 2BC9A 4DRZA 3LGJA 3BE5A 3EJ6A 3FKIB 2WIFA 3LUCA 1P5HA 4QELA 4CT4B 1JG2A 1NBOA 1U9ZA 2JAOA 2Q45A 2X42A 1JDSA 2EFGA 3K3PA 4OHBA 3ROZA 3TZKA 3WLEA 4B48A 4Y9UA 4MTNA 4KH0A 1VE7A 2K75A 1L7BA 2D13A 4JVMA 1D2BA 3STWA 1KDVA 3AERB 1FXWF 1J2RA 1L5WA 4BC1A 4ZFNA 5B6PA 4BTVA 1FFSA 3D8HA 2WB1B 2GI4A 2VXBA 3TQYA 3ZHZA 3EPKA 1FUEA 1QV6A 1R9JA 1TVCA 1CRLA 3QW2A 4HPXB 2P0YA 2CBZA 5EE0A 4ACBA 4P73A 9GPBA 5K3AA 5J39A 5L6MB 1UP4A 5EAIA 3USZA 1R15A 1RQLA 1I4RA 4TTAA 4EECA 2QV0A 1SXJE 3RYHB 4JBNA 4QHTA 4FCCA 3DUPA 3T06B 3LPDA 1LBTA 1YZGA 5D3IB 1MHPA 3W4IA 4AIRA 4JQZA 2EX1A 4GOPB 2BBTA 2ATXA 3NHFA 4UVIA 4R5MA 5EP2A 2VYQA 5LR6A 2A5GA 4TWBA 3ISVA 3B1VA 2RG7A 2V7GA 1O03A 1Z08A 1V43A 4ZK9B 1VC1A 4R54A 4C89A 2O5VA 4B6PA 3I9FA 1J5EQ 4A3EB 1YNNC 3U13A 4DYHA 4XB1A 1ZOPA 2ONKA 2F52A 3OZAA 1C9KA 3QJ5A 5EEGA 4I5EA 3WRWA 2X3FA 4D9CA 1YBYA 3H94A 1DM0B 2BF4A 1NPDA 2V65A 1AKNA 2V8OA 5KCZA 1SEPA 3RU2A 1FNVA 3ZV3A 3CEJA 1P2BA 3C3YA 4L2IA 2QPAA 5BO5A 5J22A 1M1YB 2XWQA 2UZ1B 4XQ9A 5CM8B 5T3UA 3RBAA 5DTIA 1YDMA 2O0LA 3ZNPA 4EDFA 1F7UA 5EXTA 3DHWC 1N2JA 1DI0A 3O03A 5AW6A 2XQJA 3A58B 4Z1OA 1EEFD 3K7UC 3AR8A 4MOWA 2LY7A 4TXLA 1MX5A 3PXCX 2W6QA 2VAWA 1BXTA 3BT7A 1BGXT 3VO8A 4RKEA 4LDPA 2B2VC 3IH9A 1GQFA 2X2EA 3ESDA 4P08A 3R74A 4A1FA 2QENA 1B00A 2RH5A 4PINA 1GQ2A 1IM8A 1GTVA 5EKXA 2OQVA 1LRJA 4WLNA 5ALFA 4ARSA 4AKIA 5IU6A 1BSVA 1J2TA 1U11A 2WV9A 4KQEA 1BX1A 1KBQA 1R0SA 2W0SA 1VSUA 1IPEA 1DFGA 3H15A 3N8NA 1CJBA 3SC4A 3ZI0A 1ZEQX 2EQSA 1OGYA 4M88A 4BWFB 4ASUD 1YCFA 2W8ZA 1CUUA 3LA6A 4DIUA 3N2EA 1RJDA 2A7XA 3M2TA 2W4QA 2DSTA 3L8DA 4GZLA 1XJWA 3GJ8A 2HF9A 1ZEJA 1U6IA 4BMDA 4OB7A 1RBQA 5FL7A 2M00A 4KIUA 5C0OE 3FVWA 4B3SB 2C4KA 1KVTA 1CZKA 1QQ5A 4TUYB 4EJSA 2D3TA 1UKAA 1FNNA 2VF8A 1SNQA 2XWJB 4DGHA 1GKYA 1XXHA 4YRFA 1AUOA 1NDHA 5KQLA 4R51A 1Y7TA 3MCVA 2XUDA 4TMVA 4TRRA 3TWOA 3HRIA 1FMFA 1ZIDA 3AEKA 4GBMA 4JY7A 3SFZA 1TDJA 1VQEA 5CT6A 5LXTB 3OTOQ 1ISMA 4M9CA 1AJEA 1GV1A 1VB5A 1ZEMA 2GN2A 4KQHA 4BHTA 3H09A 5CIYA 1H3EA 4NMXB 3TW4A 4DV4L 3ILSA 4U7HA 3ONDA 2CB9A 4WXMA 3H7AA 1A2UA 2FZ4A 3UMBA 4X1OA 5HJEA 2KEDA 1H3FA 1NONA 3VR5A 4LHWA 4TLBA 2XD9A 5BVGA 1JU4A 3G6JB 3GTQB 3H8WA 5ENVA 1SULA 3G89A 1IY0A 1ZD8A 3ONEA 4IWXA 3K1AB 4HDKA 3R3OA 2GJKA 4Q9DA 1XQ9A 4ZOLA 2FVXA 5JC1A 3TD9A 1FQKA 3A9RA 2C5FA 3NBKA 3IOCA 4GKBA 3Q0TA 4QXPA 3STHA 4BDSA 1RXVA 4AY6A 3HK2A 1H2ZA 4R8SA 2A68C 5JXJA 1OKKD 3B6YA 1EZZA 4M83A 2L5TA 3HBJA 3T7KA 3BREA 3WLHA 3K15A 1KPHA 4DNPA 3BZWA 3P20A 4D96A 3SX4A 1XEWX 4M7OA 3N2KB 3QEBZ 5G3LD 4X1KB 2QPTA 5CJJA 4AJKA 1H0HA 5KYWB 3UHOA 4A3JB 4XARA 3RNLA 1XVAA 4J2TA 1XPRA 1SD2A 1YDWA 4FFMA 1B9NA 5KOJA 1N6OA 2OEOA 1JEEA 2CL7X 3TX6A 1KEVA 4JI6L 1Q0PA 3N1UA 2LXNA 2BMFA 5IUNC 1PSZA 5DNAA 1C3OB 1RAFA 3AEUB 3PV0A 1ZD1A 3B2EA 1D0SA 5CCDA 2CHFA 1FJHA 2Q0XA 3IDOA 3WB9A 5TXGA 1FJGQ 5DU2A 1FVFA 3LK6A 3O82A 3PIDA 5E4FA 5I7WA 3DXYA 4YRAA 3F1ZA 3V7FA 5CBPA 2OHVA 1YRHA 4KYIB 2QAJA 4N0MA 2L0CA 1RI4A 4PYMA 5C3EB 2VJYA 5DSXA 1U5BB 4IF4A 3SJZA 7YASA 3CZ5A 2IK8A 2P9EA 4K28A 4QXQA 5JMOA 3KKNA 5EMLA 4HCJA 3QELB 2V54A 1G9SA 2V45A 2K52A 3OOJA 2OASA 1SIUA 2Y1LA 1T0HB 1WXWA 1PJ8A 2FPGB 2PRIA 2E2IH 3ESAA 2LKVA 4H4DA 1ADYA 2GWHA 2AG5A 3VVBA 2GD2A 3E0EA 3H2JA 1BCPB 4DSZA 1UBLS 4PMCA 5LMUQ 3THWA 3GIWA 3P4UA 3TR5A 4A0HA 3D4PA 4DUZL 2L19A 3V1YA 1SSOA 1MQ8B 1ZJJA 1VI2A 1MVOA 2FI1A 5MF6A 1CHDA 3MWFA 4FJ2A 5T4FA 4LFBQ 3STUA 4B3MB 1JAXA 3AOGA 1T0PA 3ZGNA 3QKWA 1VJRA 4L5YA 1YEZA 1XAJA 5JVDF 2V7EA 4KQIA 1WW8A 4IPTA 1W7AA 2NUAB 4A3KB 1YC2A 4U3JA 3H0GG 3TNJA 3Q1KA 1TGYA 1UK6A 4YP6A 5GQOA 3WKEA 1HR0B 1XJ0A 2ZJ0A 1MW9X 3M6FA 4R41A 5DHQA 1JBEA 5DGCA 4E33A 721PA 1P3Y1 3RN2A 2VPTA 5IJ9B 5D5PA 4N40A 2HIMA 1KP2A 2R6R1 5J4HA 4BQIA 2O5JC 3RO7A 3B78A 4IPCA 2YIDA 3TMYA 5EPOA 5T8KC 1NPTO 3AJEA 4K0KQ 3I2KA 4IRMA 1JEYB 5IGDA 2CVFA 4B40A 1U0OC 5C3MA 3R3VA 1X1CA 1NW6A 2F43A 2BE9A 2PCJA 3E5RA 4QUFA 2A1UB 1QHXA 4D5EA 3HKCB 1RJWA 3JVEA 3KRTA 4G5YA 3HXOA 3EMBA 1QIJA 1OIVA 2CNKA 2VDQB 3EPJA 1TWHB 1SRUA 2JBWA 4UU8A 2EVBA 2IEAA 3NETA 5L3SA 2D0PB 4FGUA 1UDCA 1X7ZA 2EU8A 2Q9CA 3IELA 1ORWA 3FRJA 3IIJA 3MPOA 5CU7A 5DEOA 3A27A 5KCMA 3UK0A 4J0JA 1PJBA 1SK9A 1G5TA 3FW1A 3W8NA 2AHRA 3O6VA 4HT3B 5B12A 5IP7G 2GILA 3C48A 3DPSA 1RPNA 3HQ4O 2FUNB 3R0ZA 3P4YA 1N5JA 4J0GA 2VHTA 1PV2A 3RE1A 4ZRDA 3VR2D 3CG4A 3WV5A 821PA 2JCVA 4DIEA 3VPCA 4FB5A 1AY0A 1LF0A 4BRWA 1T10A 4PZ0A 1SKYE 1E62A 2Q62A 4A3DH 1JLLB 3MYYA 1C5KA 1XZGA 3F6CA 3PKJA 3QZUA 5ECDA 1T5XD 1E4EB 4ON9A 4XVQA 5TRTA 3GTLH 2II6A 2I4IA 3AG5A 1AUXA 1K9MC 1CJKC 2O3UA 2B7BA 3R0XA 1T9GR 4J4TA 4BEVA 2YHIA 1ZOIA 4DMMA 1NNSA 4MV7A 4Y2JA 5CA0B 1KL7A 4QT4A 1RODA 2PNRC 4KNVA 4RF3A 1YWGO 2WV6D 1MIHA 4AC9A 3OFKA 4GZ5A 4NENB 1BE1A 1NG9A 1RCFA 4XSVA 3X43A 5JRDS 1Y37A 4HNAA 4ZJPA 2X8LA 1QYXA 4JW0A 2WJ4A 4FR2A 1N2GA 3ODPA 2BE5D 4IDGA 1EU1A 1EFRD 2X5NA 2HB6A 2C2HA 1ZGHA 2G08A 4B84A 1MENA 3QF4B 1R16A 3B3FA 4V39A 2ZSUA 4AJLA 5CFRA 3FY4A 2YIVX 3PQCA 4WK6A 4ZJYA 3ZW9A 2E6UX 3DAPA 1BO0A 1JHQA 3LPAA 5JVG3 1QG6A 1JT9A 3QIVA 2PX0A 1KI4A 1NBIA 1IVNA 4UCFA 5EZ6B 3KAKA 4PNZA 1GYQA 1GO3E 1U63A 3CRQA 2PQEA 3FNHA 1C4WA 2C59A 2CWDA 2GRUA 2HA2A 1GPYA 3VNBA 5K8IA 5CCXA 5L7WA 3GTMH 3CNHA 1NQVA 1EL0A 4C3UA 1C8LA 1X3GA 4Y1EA 3R5KA 2W43A 3FCCA 1Z5OA 3W2GA 1UEBA 4JLAA 2J0UB 4W5JA 4F93B 4AQYL 3F67A 3ORYA 1FRNA 2F0HA 1O95A 4KK3A 1NVBA 5A2QA 5E3HA 2K32A 4QBTA 1VL5A 3HKEB 4KBYA 2C7OA 1J0EA 1ZGAA 1CYEA 1CK1A 4ZCKA 3LBAA 2YXEA 3RGGA 5D01A 1SVLA 3LT5A 1FQWA 3RFTA 4JT9A 1M8AA 1Z7TA 1S7CA 5A7HA 2G8NA 1RTTA 3EXFA 3RADC 2GETA 4EPTA 5F7OA 5E8RA 3VO1A 3DMHA 4IO9A 3JU3A 1K7YA 2ISCA 4B85A 5IYZA 5C5EA 2QD4A 3N28A 4GYJA 3TCXB 3I2JA 1GGFA 4O42A 1EX7A 1WAMA 3ANLA 3G0OA 2PUFA 2OXEA 1NJ2A 1YFZA 1UPBA 2XVZA 3AQ4A 1PYWD 4FKZA 2VQ3A 3FGNA 3K6RA 4TWIA 1N1GA 4A5OA 3RWMB 1JDPA 4CWAA 4D8TA 1U2SA 1UBNA 3LYAA 1DCMA 3O2NA 3GXBA 4FFPA 5EJ2A 2I5HA 2WJGA 1NBAA 4C08A 2WKPA 2PU5A 4WBNA 2VDPB 3H5NA 2VKTA 2V4MA 1QIEA 4FFLA 3SAJA 5GPBA 4DGFA 2EP7A 3ZOKA 3B9QA 4WGGA 5ALNA 4YRGA 1SYCA 2PO7A 5DBHX 5EKDA 4WORA 2EKBA 5K7SA 3GMIA 4LBWA 1OASA 1QR6A 2G28A 5EGNA 1FC7A 3MNFA 4EABA 1LW6E 3HRZC 4RA9B 1D1SA 2PS0A 3DYIA 4I08A 1O0CA 4I1SA 5G4LA 1Y89A 2DWCA 3GAFA 4WUTA 5BSMA 5K0JA 4R83A 1L7RA 4ENVA 4QM7A 3Q8WA 3CF0A 4B6SA 3MTAA 4LRWA 1CY6A 1X42A 2PH3A 4KD4A 2R62A 4C2AA 3Q12A 1SBZA 1V9CA 2EKDA 4WZBA 1NUPA 3P0HA 3GEMA 1XNRB 4UEOA 4N41A 3VDRA 5CK5A 1QGUB 4EPYA 3PO3B 1VQGA 3WL5A 2PGJA 1WHSB 3OX1A 1DJLA 2B8JA 3N8DA 5DCWA 5LP6C 3Q0AA 2B98A 1T5HX 5BNWA 5JEDA 2NN6I 1M6NA 3IO3A 4CEHA 2BP7B 4CTKA 1IXSB 4RCZA 5BRNA 1NP6A 4AX4A 4DQXA 2VP6A 2ZR8A 2O5IC 1HE1C 1X1AA 2CHVA 4G56A 4QREA 2OK7A 4XSHA 1X2EA 4EMTA 4H6XA 3HTXA 4LHZA 5AJWA 5LQMA 4JJ6A 4UBKA 1ZX1A 3WKDA 4BMXA 4X7RA 3VR5D 3X3HA 2YYZA 4BRUA 3MGBA 3DAYA 5KHLB 3KT3A 3CLTC 3JAML 3Q11A 3R5JA 2F0SA 4IOAA 1FL9A 4WOKA 4J43A 4L51A 4QDUA 1UFQA 2LFNA 2R60A 3D3JA 4HEDA 1QONA 1SPXA 3DUWA 3LVQE 4OB8A 1BVUA 1DAHA 3SCZA 1A3UA 2JLQA 4H7HA 1SFOB 3QMVA 3BU2A 1Q7YC 2PSJA 3HJGA 4P81A 2P1ZA 2V6JA 3FNIA 4N7JA 4AZWA 5CDHA 5KUTA 3HB1A 1IOZA 2SNMA 1U8UA 2CNDA 4CV2A 4BB0A 3RFFA 3OUUA 2PEZA 1QRSA 1FRQA 2EIFA 3RZDH 2ACVA 2RH9B 5EL0A 1LS6A 1QS0A 2Z5LA 2E48A 3R6LA 2HR1A 2WWTA 3ECAA 2ZU6A 3B8HA 4OONA 4WN9A 2BFPA 4OHWA 1JR4A 2E2HB 3F6PA 1ECCA 4YEDA 4B2LA 3I5YA 1FS6A 1TK2A 3HDYA 4UJ3A 2FSUA 5D3ZA 3GVPA 1IW7C 1AC5A 2GZDA 3H0CA 3H97A 4JB8A 4O6VA 4UNSA 5F2OA 5FWAA 2QMQA 4CQLB 4DIMA 2HGZA 2R8BA 4W5TA 1Y4UA 4EHFA 4O5AA 2CJYA 1DARA 5JE8A 2J9FB 5LU9A 4K9MA 3O7WA 1XO1A 2W6IA 5AESA 3IAXA 2KOLA 5IC5A 3PFGA 1KEEB 2B4RO 4HG2A 5JJ5A 1SA0A 2PZGA 4UE3S 4MRNA 3SKXA 4BLPA 1AUPA 3I70A 1PEDA 2DZDA 5D84A 3SHOA 1S5FD 1P7PA 3H9QA 2BD0A 3IH5A 2XR1A 5C18A 2FSPA 1F2TA 3CW2C 4CIWA 1S3SA 4R8NA 3MIZA 3AX6A 1Y1LA 4MRMB 4ZHQA 3PO2H 1WD5A 1DJPA 4I1VA 3AXSA 4DR7B 2D3WA 1Z29A 3D8GA 1ZD9A 3I4FA 3RBVA 3C5CA 3RDPA 5KMGB 4U9IS 5CVJA 1DOZA 3MZ5A 1N3BA 4BVHA 1A8HA 2I29A 2YNMC 1M90C 2G7ZA 4H7JA 4M6WB 4L5BA 4UVGA 2YU9H 4F45A 2GPAA 1UIRA 4P34A 4U02A 2RGYA 3IP7A 4ZYZA 1ZITA 2O2HA 4A16A 1OYOA 2VT2A 1AKYA 3CC4A 2YFQA 4JZKA 1MB0A 3CU7A 4NBTA 3JYLA 5E6SA 3AQQA 1J8MF 2DUNA 1QOPB 3DEHA 5GADC 4H7KA 1U0FA 3B7PA 1TM2A 1V7CA 1XVVA 2P4EA 4ZRMA 3CQZH 3KF8B 1SFRA 2ZROA 3H2GA 4EIWA 4ZI2A 3GD7A 1J23A 2ZTLA 3VNRA 4XT1B 2BFAA 2GUGA 3F2DA 2P7IA 3X1YA 4DG9A 4EHLA 5HXAA 3IJPA 2G63A 1J9OA 2VJLA 3QIAA 2GS9A 3EC1A 3G68A 3ITEA 3WO1A 4HSVA 2PM8A 3BVPA 4XFDA 4B6EA 4C6TA 3Q98A 2ZYHA 3KSRA 4J9VA 3AVWA 2BFDB 4LK1C 3M7GA 1GVPA 1U0JA 3I28A 3FHJA 3R6GA 4G0OA 2CGEA 4NCHA 3R20A 5B4VA 3I23A 4UBNA 4DWWA 3NHBA 1FW8A 2DQKA 4WX2B 2IV3A 4CQJA 1IVSA 3A8IE 3DQQA 4OGGA 1TWCH 2BKAA 2Q2NA 3BN3A 1Z56C 3HYCA 4POOA 1D7QA 1QWSA 4S3SA 3D4LA 4FR5A 3EEFA 4MH0R 2CNLA 2F64A 3TBFA 1B53A 2DQ4A 5EJMA 1L0BA 2H31A 3GWZA 1OX6A 3ZKWA 5KYVA 4U7PB 1VG1A 1MQAA 1ZRHA 4KY6A 5HZKA 3G0CA 2XOKA 2FRDA 2XQGA 3AR3A 1N8SA 2R1ZA 2EZ9A 3JQ9C 4ECEA 1PQUA 2OM2A 3MTBA 4QJ5A 5IY0A 2BTOA 2QVBA 3WDMA 2DJFC 3GTOH 1GT6A 1JECA 1JZSA 3HA7A 4HIKA 3OFNA 3FFTA 2EARA 3QFHA 4YH1A 3JASA 3EXHA 5TT1A 5KWVA 1Y98A 1GNRA 4KUHA 2IV2X 3KLRA 1I50H 2C96A 1XQYA 2K7ZA 3T16A 2VYVA 3U9TA 4ZZ0A 4CIYA 2XRMA 4D9NA 3L46A 2DF8A 3NUZA 4Q82A 4V24A 2J85A 3VRHA 3WDKA 4FNAA 3CYFA 3B82A 3OEEA 3WLQA 1Q2UA 3EVEA 1IL0A 5JUWA 1QPBA 8ADHA 2HCRA 1WOYA 3TSYA 3EFOA 3JTMA 3ZPXA 1PDWA 4RZ2A 2P3LA 1GP2A 4XR4A 3ONAB 1QH1B 3ITPA 1Y80A 2GVNA 1DOLA 1ODLA 1OAOA 4L9WA 5JZVA 1GPJA 4REOA 1TJ3A 3V9PA 1ZZEA 1SAPA 1FNWA 3CLTD 3WKAA 1W0JA 1E3WA 1TTHA 3OLYA 4MRSA 3VU8A 3S1SA 5KYLA 2OPBA 3W77A 1CK4A 3LBIA 1UWKA 4KQMA 3NHJA 4LYYA 3ZWCA 3KT0A 1ZUNA 1WF3A 2YOHA 4ALKA 1OVGA 1Y33E 4J3JA 5JPDA 4ZRNA 1G41A 1NJFA 3CF4G 3PGZA 2ACEA 1DAPA 4ASUA 2KHZA 2ATCA 3AFQA 2XNCA 4Q3BA 1J7JA 2JLCA 1UMCA 1K27A 2OBBA 3VUEA 3HVKA 4V1CA 4ZYYA 3KV1A 1EAYA 1HYBA 4DBLE 3VPHA 5IFKA 4EM6A 2GDJA 2KLBA 4AN4A 1E69A 3FLBA 4IDBA 1V0EA 3CCLA 1GL9B 4EI8A 4HQKA 2HF7A 2QAGA 1C1DA 1LDGA 1I6WA 2FMCA 1NT4A 2ASEA 3ROFA 4F4JA 3RTEA 5B4TA 1XN1A 1Y8AA 1SK8A 3ORQA 3K0CC 5AO9A 4AYBE 1HEIA 3WGYA 1GPBA 5CDGA 4OELB 3C3WA 3H1AA 2R6DA 3I2IA 4FSDA 1DCKA 1F60A 4IH9A 1VG9B 3AH8A 5LMNQ 2Q1XA 1E1LA 1HXYD 1XD8A 3HDQA 1OFHA 3UMCA 2FSIA 3LTNC 1L5OA 3E0QA 5TE9A 2Q28A 1BGVA 4BASA 4CIAA 3HCBA 4RH1A 1Z5PA 5TSSA 1KGSA 1U65A 1JV2B 4M98A 3TRIA 3VU0A 5B1YA 4C0XA 3H91A 5B6JA 2ZYUX 3U37A 3SYTA 2I80A 3IP3A 4RMFA 1KOJA 1WQ4A 2WZBA 4IJMA 4XDHA 3UGTA 4D9JA 5JJBA 2CL5A 2G09A 3FDXA 4MGYR 4DW8A 1GN9A 1Z06A 1VE1A 1EUJA 1FYDA 2CLCX 3WL8A 1I6HH 1VQAA 1KDBA 3PCRB 3PFCA 4G01B 4IILA 2VRCA 4P74A 4GKKQ 4Q4LA 4JNCA 1Z7BA 4YJ3F 3R9XA 4ZIRB 5K36G 2QG6A 1S5CD 3ADPA 4L8LA 4BY1B 3HJTA 3NPMA 4X85A 5L3VA 3QHPA 1HOTA 3QYFA 2NO5A 3PYLA 2VB3X 1REQB 3WQSB 1BMDA 1MC1A 2AOTB 2O2XA 2AN9A 2P2ZA 3IRBA 3MBKA 3NJ4A 1K68A 4HN9A 2HQOA 4N3AA 4R40A 2Q3LA 2JLZA 4KN7C 3R3UA 1R5BA 1JILA 3ISJA 1CF4A 4YMIA 1R37A 2PL5A 3TLEA 2G1JA 1T24A 2F1JA 4EP1A 3HOUG 1KQSA 1TIDB 1NFQA 1VECA 2UZ0A 1G2SA 3LGSA 3CZMA 5J1TB 3IEMA 5CG1A 2ZJ8A 3JQCA 1VL2A 2QEXA 2CK3A 1L1FA 3RK0A 4ZQHA 3L4BC 3WLPA 2H48A 1GLVA 3NOOA 3VPSA 3ESZA 2WDPA 4RH0A 4XUDA 3G6EA 3ZBPA 4LRQA 2VRBA 4CM7A 4DNQA 4WNCA 4X41A 5KBYA 8LDHA 3EPLA 3AF5A 4V3BA 1SUDA 4F84A 1N7GA 3BMOB 2V7BA 3R23A 4W1SA 3BZDB 4QYIB 4NJMB 3FHTA 2UYCA 1GZ3A 4JU9A 4NB3A 1S9DA 1VKZA 2HBQA 4LECA 4JJAA 2OHOA 1PR4A 4M21A 4W5NA 2J7KA 4UASA 2ZXPA 2CXHA 4M2LA 3L43A 5KJ1A 3PC2A 4R6WA 3U17A 4R4QA 2V3VA 2ZR7A 5JASA 1M6VB 1R6XA 3TZ6A 6REQA 1YKGA 1D6SA 1RXIA 5DMHA 1I2AA 3N8KA 3UW1A 1Z2OX 4R0VA 7ABPA 2JYOA 2EYJA 4PQRA 5ER6A 4PGGA 1A9OA 1Y4DE 5FUBA 4R2LA 1TRKA 2B9EA 3MAJA 3BZBA 4H9GA 2IODA 5CEFA 1AMNA 5C8YF 3GIDA 1CHQD 2WJVA 5DK4A 3NBHA 5A6SB 3HJBA 4FU0A 4FOOA 1T9AA 2G9NA 3DVAB 2M2LA 1KIXA 3IE2A 1TM1E 4GOJA 1P2DA 4JX8A 4RCVA 2H1IA 4N49A 5ALHA 5CMDA 1OH5A 1U1GA 4C6HA 3S8MA 5CD9A 4PC2A 4Q4CA 5CFPA 3JR7A 2CXOA 4QXRA 4V02A 5KNCH 1OVMA 3DPIA 3Q7RA 3QVXA 3UF0A 1V6AA 2BFCB 3BIXA 4BMYA 1ULTA 2MR6A 2C7BA 4PQYA 1V9LA 2JFNA 3VBCA 4EPRA 3MSCA 5FR2A 3QVTA 4OUDB 5T6BA 4DUGD 5MGNA 4L5IA 2GJAA 1TA9A 1GA6A 3CCRA 1XCOA 2VSQA 3JTEA 5ALUA 1TJNA 4Q3AA 1JLHA 3SJBA 2OA0A 3G0HA 1UBTS 1FP1D 1TADA 4G26A 5AKLA 4CR7A 1UH5A 1VYHA 2ZXOA 3PZRA 2Z3ZA 5I7AA 4AD8A 1OH7A 4GRDA 5HIKA 2ECOA 4C0SA 5A5VA 4QGGA 1RJ9B 2CXNA 5EKIA 4QODA 2WINB 2X9GA 4IG9A 4EHNA 3JY6A 5I7VA 2AUJD 5ICEA 3L4EA 4JUBA 4EA7A 4Q12A 3VTFA 4A3BG 5AHXA 1Y1RA 1QH8A 1XCLA 3L2OB 3NIDB 4H3KB 4RK0A 5HZGA 1JEOA 1E3JA 1IYZA 2HDHA 4YNBA 4OKIA 1JEQB 3QOLA 2FAXA 5CDFA 1EY5A 3QXHA 1ONLA 3EWAA 5CGQB 3NQTA 3L7IA 4KQFA 3U7QA 2R7DA 1ZD2P 3H3XA 3WJAA 2O8FA 3RLNA 5FL3A 4GUAA 2I2WA 4WEQA 2PBRA 1DFHA 1GPMA 3HRKA 2AFIE 1PBNA 2VK2A 4M89A 5B7NA 3MS2A 4BV8A 1IHXA 4F04A 1AHHA 2FMHA 5KYXB 3HWX1 4CPDA 2H52A 3MUFA 1U0TA 3JSXA 5B1SA 1LT4D 1U0RA 3O92A 1LT3D 4WFJA 4I50A 2K87A 1HG0A 2VUMB 1QFMA 4OHUA 5FRDA 3W7BA 2Z2YA 1EPUA 3DEAA 5B4UA 3GTOB 2RGCA 4TX1A 2WG0A 3WSTA 1IBMB 4MPJA 2WKRA 1JOKA 5BOSA 4IDOA 2RHSB 2I71A 3RKUA 5MN5A 3FVQA 1W36C 1QIHA 1FSPA 1TLTA 1VGVA 1EUDB 3DV0B 5B58T 3L2PA 1I7QB 4E11A 1QIIA 1ZM9A 2VW9A 3CXRA 3G7NA 3DUZA 2MUYA 3J81c 3GTGH 1CY0A 1BOOA 1D2CA 1VZ3A 1XHEA 2AIRA 2E4WA 3I4LA 2MSDB 4Q0FA 3NM5A 4QX6A 5JSFA 5KNCA 1W59A 1RM0A 1KI8A 1OYYA 2B1IA 3B89A 4YQZA 1EDDA 5GJBA 1OZHA 1RCUA 3I1IA 2BEUA 4Q4HB 5L51A 3OQIB 1CJCA 2VBIA 4UHVA 4HDRA 3HR8A 3T6OA 4UP7A 2XH8A 4MQBA 4G5GA 4HVCA 1KVRA 3KQWA 4ZK6A 5J4YA 1H5NA 3ER6A 1AV7A 3H87A 3QENA 4OFXA 4OQEA 4QGAA 2NVUB 2D0IA 4YUWA 1PJRA 1KYQA 1X70A 3U3KA 3THXB 3HACA 1NW3A 4E88A 4B80A 4JIGA 2GN5A 3CPEA 3HHPA 4XSGA 5ITZA 4HATA 4N8DA 1RF2D 1EB8A 5JNRA 2ZJAA 3IMFA 1M6YA 1C3VA 4NBKA 1XNHA 4DXFA 2A9PA 1DDOA 2IYYA 4B71A 2HJRA 1VI5A 3EZ9A 1X3QA 3SMQA 1KS2A 4YRCA 2ZUTA 5EZSA 1JT2A 3J81L 1M0EA 3CPFA 1J24A 1ISPA 1RCVD 4YDHB 4JV5L 3CH7A 5FUYA 4DR5Q 2IL1A 5HUJA 4KDEA 5EC8A 1UZMA 4Z99A 4Z4GA 1HF2A 1MABB 4DUYQ 4GQAA 2YW2A 1AEXA 4B3DA 2P65A 3OIGA 4GRIA 1RRMA 1Q8IA 1YIJA 1UJCA 2HZBA 2JD2A 5JAHA 1HRJA 3ZWBA 2I3AA 4JBXA 4PS0A 3PQ6A 3GYGA 1QAQA 3DULA 4URYR 4UPEA 5CH3A 4DV5B 2OCXA 4WNAB 4HWGA 1A04A 3VUFA 2XNJA 4DA2A 2DFLA 2O1WA 3O91A 1P4GA 2JEOA 2WQ7A 1LVGA 1V1MB 3QQ5A 3P9RA 1AIPA 1FLVA 3WFIA 1EQRA 4GM0A 4OI2A 2ZI5A 3EGXA 3MF4A 3UTDA 4FX2A 3HOZB 1BE6A 1GZ7A 2ORWA 4MUJA 1HL7A 2P9QA 3T1YQ 3LDFA 3QLJA 1DAMA 5EJAA 4ZAYA 4XGKA 1K9SA 3HM9A 1NXTA 1JHXA 5CVCA 3F96A 2EBUA 1PFNA 2D2FA 1CFJA 2PD4A 2ZGVA 4GLLA 2YXBA 3EIVA 3HYLA 1O97C 4FFVA 4JQCA 1B0AA 4ZEWA 5JTTA 2XADA 3EXEB 1T2FA 3HCWA 1NXXA 4HDSB 2CLMB 3WBKA 2K33A 3K5NA 4F88A 5KC8A 3F43A 4LNQA 1R66A 2F8LA 4Q1VA 4UAIA 1PT6A 4AFNA 1II8B 4FGSA 2F0WA 1P0MA 4EG1A 2WG1A 4Q02A 5K99A 5KTSA 1QVZA 3ETJA 2GZSA 4Z0TA 3N8GA 3MVVA 3P7JA 4L8YA 1T6ZA 2C00A 2Y76A 4TMWA 4UHDA 4DT1A 1F6BA 3GZJA 5LP6A 3GUVA 4U6NA 2YICA 2O19A 1DONA 3DO8A 1Z34A 4FQ5A 4YMVA 4DGSA 1UEIA 4KXLA 4PHTA 5FIUA 2EXZA 1CUEA 1S3FA 2XCIA 1IONA 3EZLA 3M6MD 1UPUA 3OMCA 1P1HA 4NF2A 5AI0A 5IF3A 3M5CA 3PQ4A 5AW7A 5JFTA 1YT5A 4YP0A 1YJCA 2F0LA 1CTMA 3CLRC 3O26A 4KFRA 5JPIA 2K5HA 1K8ZB 3KF6A 3KEGA 3PNKA 4GX1A 1DDIA 2JFXA 3RTCA 3SX0A 2WM2A 4WE3A 3VX4A 4DV1L 1FYWA 1WUYA 4E94A 2DECA 1CRZA 1GVHA 1FTWA 2O7VA 1S5ED 3P9SA 4DMUB 1KYXA 3DDWA 1DTWA 2J6IA 1PJ3A 2YNMD 3WTCA 5I4KA 5ELXA 2QW7A 4UY8C 1P1RA 1R3UA 2I4OA 3X2FA 3QEJA 4MS4A 3QVWA 3WYAA 5E7MA 5FKAC 2CMGA 2Y0PA 3PJEA 2ZZMA 3HV2A 3GUHA 3ZI7A 5IK2D 4LS3A 1VP3A 4AAYA 4TOIA 1M54A 3TP8A 2B37A 2FSGA 2P6UA 1T36B 2G1KA 3TTTA 1CZUA 2BRUC 4HNTA 4BC0A 3DYBA 2UVDA 5COQA 3FRIA 4CMGA 4GN4B 1G5IA 1V2HE 4FEEA 4J90A 3JAMA 3K7AB 1P9LA 1OLOA 4MDFA 3ZY2A 1ETHA 1HR0Q 5ANRB 4E08A 1KMHA 2FOIA 3H5WA 1VC2A 2JBAB 2WKWA 1VGQA 4LE0A 1EY7A 3RQIA 1MOSA 4RANA 3ZY5A 3DLBA 1R8SA 2AE2A 5ADVA 2PZFA 4B8ZA 3CCBA 1KZYC 4UAUA 2Y9PB 2F0QA 1CE8A 2ZBQA 4RNCA 1KL9A 2W6OA 3UXEA 3MMZA 4A2PA 3GK7A 5M29A 2HQ1A 2BGLA 1NSNS 3O90A 3QH4A 3Q6NA 4PZUA 4LRSB 5I48A 3K70D 1TCAA 3DT8A 2IH5A 4MS1A 1NVFA 2VZ9A 1FXSA 4GD3Q 2OGSA 5HJ5A 3O3CA 2M98A 4PE5B 2CNOA 1ZH0A 4JT8A 3RSHA 3OCWA 2IKQA 3FAKA 2YXLA 1XNQB 3DPUA 5C1BA 4RMGA 1O54A 3VYWA 4GPD1 1NNI1 2H1HA 3CO0S 4NIMA 2NPFA 4QSMA 4MHTA 1G6ZA 2I6SA 2QE7A 2VJDA 3AEZA 1QYIA 2NQTA 1KFBB 2Y1OA 4FK8A 5HF8A 1PGJA 2CFMA 5JI3E 3ICQB 3ZZUA 1NW9B 2A69C 1JR3A 3IESA 3QLTA 4JR0A 3LCRA 1XF1A 4DCUA 1Y1WH 1A96A 4FF2A 1H95A 2DPGA 2EATA 2MSEB 2VYNA 1GQQA 1EYZA 1JG7A 1X56A 2MWMA 2P8SA 1X55A 1N57A 2FR8C 3CC8A 3NBAA 1QK5A 3OJXA 4PRKA 2YJ3A 2R92B 1SC3A 4ZCQA 1I9GA 1T25A 3OKAA 2H3HA 4YRNA 1EM6A 1D4FA 5GONF 5B1HA 4C0HA 4IBOA 4RABA 4ZKCB 1W581 3ORHA 1T13A 5ALVA 3M85A 1F48A 2YUTA 2G3YA 1KNQA 4R3NA 1L9KA 1SXGA 3PF4A 2NYVA 4R7GA 4B45A 3CPJB 3E7XA 1M2VB 5IXYA 2GESA 2O0KA 1XMVA 3FXAA 3HZOA 4U63A 1JYFA 1SKAA 1CUXA 1B15A 2JKVA 1VLHA 3PUIA 5MFZA 2PUVA 4NFSA 2BOSA 4QC2A 4BO0A 3EIHA 4FLMA 3K6JA 1TU3A 1Z0SA 1AQNA 1KS9A 2PQ0A 1X39A 1OFUA 3KKEA 2B8NA 2NZWA 3OHSX 3CVWA 4GLBA 3SEFA 2ZTDA 5IKPA 4YDQA 2QY9A 4DMLA 5L4LA 2F0IA 3OZWA 2OWOA 1RXEA 2B8EA 3E3NA 4PHGA 3UMJA 5KVVA 3PNYA 3BHJA 4UU0A 3WZMA 4EKIA 3L8ZA 1G8FA 2IUFA 4KUEA 3K80C 1P4AA 3JVDA 1PYSB 1X7XB 4I9FA 5HMLA 3LQ4A 1Y1QA 4UTOA 5EPLA 4RMJA 4RK4A 9LDTA 1K6IA 2LGJA 2WU8A 2QRPA 3EFHA 3Q0EA 1Q12A 1OROA 1TMYA 3FPJA 2JCGA 3UJ3X 1FJ2A 1KNXA 2OVFA 3GMTA 4RTPA 1GUFA 1GCGA 1IB0A 1NYLA 4RU1A 3V80A 2BCEA 3ZTYA 1RKNA 4J8QA 4EQ6B 5ELFA 3T3IA 2HXSA 3ZYYX 4CL2A 4URXR 1J0CA 1KYYA 3N52A 3V7NA 2QGNA 1HZAA 1M0TA 1WMDA 2Y0EA 5A02A 2MO0A 4FUQA 5G0SA 3FRPB 5HOEA 2B2TC 3FDZA 4G1EB 3I04M 3CRVA 4HNUA 4BNLA 3UMMA 3E9YA 2A69D 5E4WC 1R27A 4EQ5A 3QA9A 3UMYA 4BB5A 1QF6A 4IFDJ 1WRBA 1WHTB 3MELA 1DLJA 2RDGA 5JEAG 1DVRA 1VSTA 1QJOA 2C82A 2XRFA 3V8BA 5CMLA 3ZDRA 4UD6A 3NUGA 1GKUB 1AGNA 2UXBQ 1L5LA 3OE1A 3LCJA 5HK8A 4IIGA 4U7JA 3SF8A 1J0BA 3JV7A 1VHDA 4O2AF 4S35A 4XYEA 3RQSA 1QKIA 4XDXA 2NO4A 2FSHA 3PDUA 3PI6A 3H05A 4WASA 1JKJB 1UOPA 2GA8A 1SB9A 1HHVA 2OSBA 2KM1A 2RHHA 3ORFA 5FV7A 2X8JA 4JP1A 5C3UA 3WP1B 4PM4A 3GHHA 1S2DA 1E4YA 2E5FA 3GGJA 1XV5A 4DRXB 3LY9A 4HEA1 4Z7JA 4DUYL 2HU8A 1YXMA 1A7KA 3LHSA 3OZVA 4C4TA 2E3JA 3PDIB 5A0TA 3ZJUA 5TX7A 1MAHA 2BI8A 5AJVB 3LBNA 1GJXA 1RBZA 2D1TA 3GRFA 2FJPA 4P58A 1DNPA 1E24A 2BBSA 1R4PB 2R61A 1FEZA 1PJQA 1D9ZA 2QJFA 2ZVDA 2HRRA 1ZKOA 1P74A 5LXTF 4J1SA 2NU6B 3Q87B 4QTXA 3UAXA 1VKNA 4GMGA 2A3NA 2GX6A 3UI2A 3L06A 1V48A 2PBZA 2WHYA 3LC0A 1U3WA 4E4RA 4OX9B 3ANNA 2I5LX 1H5UA 1T3GA 1BD3A 1HOXA 3H17A 1PNQA 2HI0A 2IDJA 1ES9A 5L45A 2WBLC 4W6ZA 4GI3A 4JS0A 4C4YA 2DQSA 2FW6A 2OXCA 3CC2A 4Y7NH 1C3XA 1NBME 3P0RA 4GPBA 3D8BA 1UPFA 4X9XA 4XM0A 3NYRA 1YA4A 1AOXA 5KGUA 2F0PA 1ZSNA 2PVCA 2XLCA 3PA8A 1H9KA 3A6ZA 3A9VA 4QATA 4RQUA 3ZWPA 1V6CA 2P67A 4G8BA 3TW8A 4R4TA 1N6KA 1RAAA 1W85A 1SEBD 2UKDA 3PXEA 2C8JA 2EFDB 1Z5GA 4EGVA 3IHLA 4B3CA 2E4VA 5DAUA 4KFUA 3EZ2A 4N12A 1C80A 1T0IA 1Z36A 3GOQA 1KJNA 2PQ6A 3V4LA 4AX8A 1YF3A 1YJXA 2HQBA 1U3VA 4V0BA 4X64L 2YBEA 2I9KA 1JB1A 2ZBDA 1MH1A 4J16C 2D1QA 3ZU2A 1V7PC 5JRZA 1YB5A 3BH0A 1NASA 5EZYF 1LPPA 2J0VA 3TLCA 2WHQA 5GAEC 3MCWA 3KHTA 3N9IA 4FC7A 2KHSA 3L9AX 4KRYA 3S44A 1XVUA 1NKTA 3EHEA 1BCPF 3K0AA 1K6EA 1XHLA 4DLUA 4NTZA 4X20B 3WQRA 1U3TA 3PQ2A 1DIHA 1CC1S 1A7JA 4KOAA 1XELA 4RQAA 2J3KA 3QM1A 4R8IA 4MUHA 1BW9A 4U8HA 1E5TA 3GDFA 5TPZA 1HYQA 3W6NA 1U1FA 4ER0A 1N9GA 3QJYA 4KXUA 3U31A 2PAFA 1X14A 4OQFA 2ZI9A 1G4UR 4Q3EA 4AULA 2O8VA 1Y6FA 3ENZA 1TR5A 4GS3A 1C1XB 4K1XA 4CCAA 2G5GX 4G0ZA 4I3GA 4QECA 4XAQA 2B2NA 4LV5B 1Y3IA 1A5BB 4HCSA 2EP8A 2VH2A 1V71A 5H3HA 1U2GA 2OZLB 4WLFA 4EENA 3LLOA 4P22A 3JQAA 2QMEA 2W5UA 4NMZA 2R2AA 3C7CB 2VBFA 3NHZA 4OMCA 3TJRA 2PV7A 2O0HA 5J40A 3VVCA 5EBCA 2E18A 3GEHA 5FI1B 3FZGA 2OBYA 2VQFQ 5KYUB 2AFRA 2QUKA 5DBGA 2DNCA 2FTKE 3ZIAD 1SPBS 5LLTA 5HS6A 2VIIA 3RIGA 2KEEA 4H0CA 1BDHA 5DHAA 4BXOB 1GJRA 4R84A 4F8EA 2FUG6 2O23A 1T15A 1V96A 3E5NA 3VR6H 2C2MA 4OSEA 2HSWA 1MC5A 4U8GA 4D4JA 1CSQA 3RV3A 1YNJC 1LFDB 3EQ6A 3S2EA 5HVNA 4RYDA 5E4JA 2ENUA 3CXUA 3NHWA 2Z04A 1DX4A 1NQTA 3S28A 5FFFA 4FMBB 1EWIA 4J6EA 3GP8A 1E7RA 3TB4A 2ZM6L 3O4IA 3WOFA 2ZSBA 3U1TA 3LFUA 3RIEA 1RRKA 3TTUA 4CFZA 3F1LA 4V2IA 5HPYB 1DT3A 2PH5A 4NFHA 3U3DA 2F0FA 5KQGA 2VVTA 3G2PA 3P96A 4WY2A 1W44A 2UAGA 2YOGA 4Z9AA 5BUCA 4HIZA 2V0NA 1JPNA 1C0LA 2XTAA 1GU7A 2JFQA 4DF3A 5B2EA 2B2UA 1CM9A 1N6EA 1DXHA 4PONA 1ZO8A 2DCUA 3PHIA 1JQEA 1Z2CA 4G5SA 1FIUA 4IGEA 4A3FB 4DAYA 1AD2A 4MUEA 4F2WA 3C16C 3DDUA 4M36A 4ENRA 2QL5A 3DL2A 5JWRA 3STTA 4X93A 1E20A 3ZZTA 1ISRA 3R75A 1HNNA 1FA9A 1JSXA 2CNBA 2R7MA 3NIGB 1QCCA 4R1PA 4EBBA 2G72A 1NBWA 3B38A 2V4DA 3ND9A 1U7WA 3GAAA 3NM4A 2C1EA 2Q2OA 3R3WA 4GDMA 1NXOA 1FU8A 2HDMA 3MTGA 4M1YA 4PC3A 2Q6VA 5AKXA 1P1KA 3WDLA 1EUDA 1E2EA 3DV0A 2LCIA 3RLIA 1AZPA 1YU9A 2FQQA 5BYJA 4ALJA 3B1YA 2Q2WA 4ZZ3A 2OQIA 1LWOA 2G04A 1YDEA 4PBSA 4PN7A 2CLKB 3D7KA 4DWVA 4BNNA 1P5ZB 3ASUA 5KQSA 4MRRA 4DV6B 1WNFA 2FXIA 1U4SA 3G82C 3T99A 1U8FO 1ATIA 3HYSA 1SRRA 3GTPB 1Z33A 4XQEA 5A4JA 4CKBA 1UBSB 1SVNA 1UE5A 1BRTA 4L5CA 5IGCA 2JA6B 3CW9A 4XIGS 4XQQA 1FQOA 3IUSA 2IXFA 3FUXA 2EYOA 3NCTA 3FLAA 1UWVA 1Z4KA 3BERA 5BSTA 2ZYGA 4MJ3A 4B75A 3NEMA 3AIIA 1JIIA 3EVAA 4L57A 2YWCA 3KUPA 2VXOA 2WE7A 4LC9A 1OJLA 1ODIA 2WSLA 1SXIA 4GHNA 4L22A 1HZ9A 1G2QA 1Z9FA 3F6YA 4JMLA 4QDTA 5KI6A 3KSAC 3PO3G 1KI1A 3R0IA 5ALXA 3Q7PA 3NLLA 1Y7LA 2IHTA 3OI7A 4EGCB 2FMXA 3X1ZA 1IE3A 3QSYA 1MABA 2XDQB 3U61B 3HB7A 1T1RA 4FZRA 4R4JA 1NUCA 4MWZA 3RS5A 2O8EB 3AWDA 2VDOB 4FGZA 1YNXA 1KSJA 2Z5FA 2QJTA 4D4HA 4KPYA 5EQ0A 2JHAA 3KQVA 4RPIA 4RK1A 1UJMA 3VNVA 4LF7Q 2RGDA 1XLUA 1H69A 4DV7B 1B43A 2C5EA 4UQOA 2VQEQ 1PFKA 4TUYF 1XMSA 4IGIA 3IPAA 4I4NA 2FETA 3V1UA 3VU3A 1RW4A 2GDZA 4QTPA 5CD1A 4F3TA 4C1NI 5D00A 4EOGA 2GEJA 1TW2A 2VTBB 3BXPA 1U3FA 3NOQA 3ML1A 4KRFA 4Y9SA 5JZMA 1SUAA 2ENWA 4OYRA 1US8A 3T3MB 3ZXIA 5I7SA 3T3OA 3VFDA 2BGMA 3JQGB 1PRTF 1AXRA 1C50A 1EWYA 1TFUA 3RZDB 2WPDD 2QLTA 4ZAVA 3VMFA 5U4QA 1I4WA 3KDAA 3IJ5A 5EE9A 4CTMA 2MFIA 5C4XH 3KYIB 4QF4A 5M5XB 4MO9A 1NNEA 4TS9A 1KNAA 5F21A 5H59A 1CX9B 2VJPA 2ZAGA 4E14A 4KQ9A 4YCUA 2Q2HA 1VQ4A 1JLLA 3MSXA 5E95A 4LXIA 4ZT7A 1IPFA 2CLDX 1TJPB 1I5EA 2HWUA 4Q19A 1JDZA 1LI5A 2PRZA 4PBTA 3NC1C 5LQUA 4MV4A 3T53B 5CB6A 2MO1A 1PS8A 5CA0A 1O96A 3BE6A 2R25B 2Z56A 3KV3O 2Z6VA 1UMKA 1OSNA 4CJXA 1U4RA 1NQAO 1W2GA 2BKVA 1E3PA 2B4KA 1IN6A 2A14A 2ZJ5A 1RYEA 4GKVA 4IHKA 1OPRA 3A26A 5T57A 4BNYA 1HRKA 5AK6A 1Q91A 2OC9A 3QU9A 1JHOA 4NYMR 1HQKA 2WM3A 1K88A 4KPFC 4HF7A 2A30A 4ZI3A 1PR1A 4BEJA 3LBHA 3O8OB 3IQGX 3TOVA 2CXTA 5ITSA 2B2XA 2C7GA 3IYLW 4KGXA 1KQNA 1GPAA 5A04A 3W5DA 4RMNA 3N2LA 1Z0FA 3AF4A 4EFDA 2NP6A 3BSYA 3OQ1A 1IZ6A 4PZDA 4CLRB 4E51A 1KY4A 2N42A 1CUBA 4CTNA 5U4XA 4KV7A 3M3HA 2FPPB 1ADBA 4JD5A 3OT4A 2Z2XA 1PK7A 3EGOA 1MAWA 3FYUA 1FSZA 1T9DA 4I7ZC 9ABPA 1XUOA 3OJWA 4BQOA 3F2IA 3FCYA 3MINA 4U5XA 1ZY2A 4KYTA 2O20A 5DLYA 5JCOA 4LWOA 1FTYA 1Y14B 4LK3A 4N47A 4LGCA 2CCJA 4OHMA 4EITA 2O59A 1MC8A 1OF1A 3LIIA 3OTHA 1J0AA 3QYJA 4K7JA 4E32A 4EW2A 2QRQA 2HSEA 2BBOA 1CIPA 4HQ6A 3PX7A 1IJBA 3P2OA 4R1MA 5LMNL 3R8CA 4G8JA 1LX6A 4K6FA 3V4OA 4Z9XA 2IYLD 1MAUA 5F5NA 3T1HB 1F9RA 2XRZA 2COUA 4B6QA 1RBYA 2HBZA 4CODB 1GSIA 2CJXA 4LV6A 3GLVA 5KVSA 1J70A 3V9AA 3RSQA 5A5EA 2JIZA 1V4NA 2QLLA 1OBOA 3HJHA 4PTLA 5E1DA 2BGKA 2DG2A 3WYEA 3JWPA 4Z49A 3KLBA 5K4GA 3BMCB 3OCYA 1E2BA 2Y93A 4NYMQ 1W3SA 2IE8A 1OXTA 3HGMA 4KIJA 3DJFA 4X61A 4YJ3A 4EB8A 3G2HA 2ADOA 3KDFB 3BM5A 1MCZA 4ZYWA 2P35A 4LJ4A 4A3DB 1QC5B 1TEHA 2Q5CA 3WK6A 4C1BA 3K9CA 4O4IF 5D14A 2OYRA 5F4BA 2MR5A 1NU6A 3OG9A 1LABA 2PD3A 4N5LA 5HUHA 1MVNA 2AGVA 2ERXA 4AIIA 2ZSJA 3H5LA 5COBA 1AK9A 3K5IA 1QP0A 3BF8A 3LP8A 3BHMA 2E2WA 2O2GA 5HGTA 3EGDB 3P2KA 4MUMA 5LOVF 3ODGA 3R9WA 3A4LA 1OQAA 1ZA1A 3JR3A 4MIKA 2H1LA 4DKAC 2FVYA 2WVJA 3AU8A 2C5GA 4FN5A 2W2TA 1N75A 2COEA 3SJCA 2TSYB 5T4EA 3ZDZB 2CY0A 2P9BA 5KTNA 4IMRA 3BDIA 4R0MA 3UFBA 5G3YA 4WNYA 1V8OA 1XQXA 1ZNQO 3WBBA 1NW8A 4MRAA 3TZUA 4ZN6A 5CB0A 1YE3A 4DN4M 4RHFA 5JD3A 5JW6A 1L7DA 2PT7A 1JA9A 2HEGA 3G4SA 1SVWA 2ZS7A 2BGIA 2CFRA 1JHDA 2EFJA 2HC9A 2HV9A 3EIXA 1TWGH 4BNXA 4D80A 5C37A 5HKBA 2B0CA 5F9HA 2NZVG 1V1JA 3BJRA 3PA6A 3T6KA 4DDTA 3RR5A 2CQOA 4DXGA 1EVLA 1KY2A 2AN4A 3LUKA 2FHPA 4UDYX 2EZ4A 3ZJYA 3U9OA 1L4MA 2IYNA 3BH7A 4H59A 5DTEA 5CG2A 4Q4AB 3AB3A 5AICA 3CCUA 4HLUA 5AM4A 1SUEA 1WNTA 2A9FA 2R96A 2VAPA 4TT3D 3EIQA 4MKFA 3U39A 4BJ3A 1V6SA 4HC4A 2YUIA 5M3BA 3HY3A 5T7BA 4QHYA 1NR4A 4OAPA 3E18A 2IU3A 3D4DA 3OSZA 4RM3A 2DLNA 2KA5A 2MYTA 5DI3A 2BFBB 1ULUA 2FR8A 2Y0DA 5JEAH 4Z9FA 4PGFA 4D6XA 1ZU5A 5F7ZA 1Y8PB 1SQGA 1DAEA 3SEAA 4PMWA 1IKLA 1VMEA 5JOBA 2SBTA 4CF3A 2B2WC 2VF5X 1QF9A 3BSSA 3BF7A 3L1KA 5JS2A 4YPFA 5BW6B 3UJHA 4BKUA 1OREA 4A2CA 5IBPA 1Y4ZA 3DLIA 5LA6F 3NE5B 1EK1A 2OKGA 1QZZA 5IMSA 4G0PA 3PQDA 5AUPB 4QGUA 1SXHA 2YJZA 3VOSA 2H7XA 3MWDA 4FGKA 4IFBA 1B41A 4PQXA 1PZKD 4Z0HO 4KKVA 4X5OA 4PLCA 1QWOA 3CM0A 2BSAA 2XX3A 1D3AA 4DV6L 4J6HA 1KBOA 1P4HA 2QTVB 1KAAA 4OQMA 3ADKA 4Q18A 1MB3A 1D7OA 3ESRA 1E9BA 3QU4A 4RHYA 5ARCA 4I5GA 1W46A 2PKQO 1JFVA 2Q5HA 5AHWA 4E6IA 1Q7CA 5TGZA 3ONNA 1PZEA 2IFTA 4CNBA 3Q8MA 2WYVA 2BM1A 2AZTA 4FFBB 3RS2A 1CYDA 1Z62A 2W48A 2XDWA 2C2GA 2X9QA 2DAPA 4NMHA 4D3DA 4GBED 1EFVA 1KMQA 2D2CC 4HGPA 2D5IA 4H7BA 1N5LA 3U44A 5C6AA 1CDDA 3M89A 2LSSA 4P4TA 4H35A 2NU9A 3S14B 3LUBA 4AM8A 2UZ4A 5H9VA 2Z3WA 1IK4A 1SVIA 2JLUA 5C8YB 2C5BA 1Q0SA 1MH9A 5AJXA 4F2HA 2XUAA 3MUNA 4BQEA 1WI5A 3PNBA 2Q4BA 4DL9A 3FPCA 1EUYA 2B63B 1X19A 2EGHA 3I6YA 4JBYA 1ZR4A 3TZHA 1UZNA 3D43A 2QQGA 3AESA 1UC9A 4AF8A 4IMPA 3TBKA 3JAKA 1QYRA 2HHJA 3KOZA 4X62L 3Q0IA 4RY9A 4XUEA 3PQ8A 5HYVA 1M2HA 1K7EB 5ITZB 1WB5A 1VQPA 4MKXA 2OGTA 3KJGA 1RQRA 4NMMA 4O2AB 4OHPA 4ZQEA 5EA2A 3UC5A 3IMGA 2I6QA 4PLGA 2B99A 4C4ZA 2QRZA 4WI1A 3DM5A 3DLTA 3LBYA 4ZVQA 1BH2A 2CEKA 3IL8A 3BICA 1I3NA 5TEVA 3HUTA 3A6LA 5LZ7A 1BVSA 1X3FA 3RTGA 3TR6A 3GTQH 3OOHA 4D9FA 3TSAA 5AW3A 4HAYA 5JY1A 3KVVA 5K6AA 2EXDA 1ZD3A 2AQIA 4DJAA 1U90A 5DH9A 5IJ0B 2L55A 1W87A 3GCZA 1ABBA 1PWHA 2R7NA 3F8WA 4MI1A 1LJUA 5BW5A 1XRJA 1PUIA 1ZBQA 2CFCA 2DPLA 5BOVA 3ZK7A 1IKMA 2A1AA 1O1YA 2FJ0A 4FMDB 4L0CA 3DMPA 3UW3A 4BBSB 2R7AA 3DZJA 4KX5A 2ZB3A 4NV3A 5BR4A 1TIID 2VZ8A 1K4KA 1ODCA 5C34B 4E12A 3GRAA 4XGIA 1GTSA 1IBKL 1S96A 3I5AA 4ND8B 3AY3A 3V7WA 1PQYA 3FPFA 2WP8J 3F9RA 2ZIXB 3TGPA 3EK2A 4I7AA 3WLKX 3DNPA 1VBMA 1TS2A 4FHEA 1UANA 3ITKA 4RKWA 4YQEA 5BV8A 1XMOL 4OIJA 2JEAI 5C0XG 3L1HA 4LOIA 4LQLA 2VHWA 3DLAA 4BUZA 4RULA 3WIEA 5CBEE 2C2YA 4JL5A 2I0QA 1JQAA 2JAQA 2L0XA 4Q5IA 5I8ZA 4CTJA 5HUQA 3E4CA 5GP1A 1CNEA 2XB9A 2GHRA 3LRXA 2BHNA 1AE2A 3HJCA 4EEXA 1X9NA 1KFKB 2CKMA 2YWDA 1EH5A 2B4QA 2DTEA 4W9NC 5T67A 1UBGA 3RIYA 4RTOA 4LZNA 1VYVA 5DYWA 1NWHA 4EB6B 4URHA 1PZID 4AMGA 3KJXA 1GL3A 1VQ9A 1XTCD 4HRVA 4KQ1A 4MW5A 4FDLA 3JQAB 3UK1A 4JHXA 3VYSB 1B26A 4A3JH 3SS7X 1PS9A 1YZLA 3AP1A 3DEPA 1SAYA 2X0JA 3P2EA 3OA0A 1QDEA 1WKVA 4HFMA 2XI4A 2AW5A 2VJNA 1PX2A 1JHRA 4GI7A 4WJZA 3R3SA 2QMZA 5JXGA 3F6RA 4UBIA 5KNBD 5HY6A 3PUVA 1L5RA 2O52A 3KHSA 5AHKA 1IBLL 2R48A 3KG2A 4BMVA 2GBCA 1DP4A 4PAMA 2RHTA 1PVVA 2VWQA 2JLSA 2AN1A 4P92A 3VGJA 5AKIA 1OWPA 5KX5F 2HJ9A 1WDWB 3DBRA 1PFMA 4Y1GA 2ZZNA 1RLJA 3IBFA 3OOEA 4J6FA 4ZPJA 1Z4PX 2RGGA 1KARA 3T15A 1XZFA 4R9SA 1HJPA 1L1OB 3ZD8A 3A1EA 1J8VA 2Q99A 3MK31 3I8OA 1V37A 2HV8A 5H8WA 1VQ7A 4X45A 2CNWD 2PMEA 1R0WA 4UTRA 3DDCA 5H70A 5C7IO 1NI4A 2FDXA 2BH9A 4LN1A 4TKUB 2OEPA 3Q5DA 1RJGA 1E3MA 2G9QA 4TSSA 2FPMA 5FNZA 4NAVA 1CERA 3Q22A 1GSOA 2KQ3A 1A2BA 3LOPA 4LHYA 5ALQA 3G5TA 1S3OA 6CHYA 2K6AA 1QGAA 2Q5JA 1SCAA 4F4FA 1PRTC 1S2LA 2FN4A 2OFPA 2IDZA 3C1UA 3TLXA 1I0ZA 3IP5A 1JXMA 1OWOA 4UUMA 1ZVKA 3K2QA 4M87A 4R8LA 1PKXA 4H6WA 5KPDA 5JAPA 2VUSA 1MZVA 4WGFA 1BXRB 2GSWA 1AK2A 1YITA 4LVCA 4PXAA 2R66A 3AEUA 3OF2A 1SUBA 3EQ9A 4JGGA 4U3JB 1E2NA 1I7PA 1DC8A 2FFAA 1K3FA 4OK3A 3N0WA 4GX0A 3FB4A 4FYDA 1N3YA 2SKCA 2JIZD 3ZQUA 3L1IA 2ACWA 4YY3Q 4QJIA 3RASA 1JF8A 4I55F 4D9KA 2QDKA 3SQOA 1H9SB 3BGVA 5DWVA 5FOQA 1V3UA 2NU7A 4KP7A 3A8KE 4JXJA 4Z9YA 3I4OA 3KJOA 4X44A 5CW2A 2PV0A 4UHCA 621PA 3B3GA 4A0SA 1ZLYA 3A6FA 1N6NA 4CETA 2O7QA 4CF6A 1W36D 3UWDA 1R8YA 2G0AA 5EAYA 1UXKA 4XLZA 3U09A 4B7CA 4BKQA 4EJ6A 1GSHA 4CCWA 5BSKA 4O59O 1H0SA 2OBLA 1MHWC 3MTEA 4I46A 1JJ2A 1Y3HA 5E6UB 2VLBA 4J0HA 1OIXA 4UHKA 1FFXB 5FBZA 2G9UA 5LMNB 1VE3A 2NZYA 3UHJA 4YRBA 5GOTA 2AX4A 3RRMA 5K05A 2QVLA 4R16A 3UB2A 3ZLUA 2BEWA 1QRAA 2OTCA 3HXKA 4WEOA 4A3EH 2P9ZA 3Q7SA 4IURA 5I2XA 3EH7A 3JQ9A 3CCVA 4PWYA 2E2DC 3OWXA 1LUAA 1OXVA 1VLVA 3RJ9A 1JSZA 3TI9A 5TC4A 3ZLVA 4BL5A 2Q2TA 4GF5A 3R5HA 3CZ4A 1O9BA 2OCKA 2B8FA 4G5RA 1B1ZA 3IAM6 3WMGA 4QFCA 3S4YA 3WYFA 4D8WA 1SQFA 5E9WA 3WL3A 4IJUA 4ITRC 2QQFA 3C5HA 3M3PA 1EYGA 3SP1A 4C4AA 1Z73A 1MO3A 3NVAA 5DXAA 4OV6B 4QUDA 4XGRA 1DO0A 1U9IC 2JI6A 3ROQA 4XYLA 5K2OA 1PWYE 2HU5A 4DLRA 1L2TA 5IK2A 3A4VA 3G9UA 4G3XA 4IQ4A 5E6RB 1DXQA 1NVVQ 1A50B 3W4KA 1CR2A 4BO1A 3CCSA 2B63H 1A63A 2R7ZH 1SUFA 2I99A 3DQPA 2FZEA 4XX0A 1B0ZA 3DL4A 3ZV6A 2QG9A 2YVAA 3E48A 1UPTA 3LQYA 2Q0HA 1GNQA 2K28A 4RE5A 4DMFA 3BTVA 5L3SB 3D3RA 1P8JA 1CF9A 2PU7A 1P2FA 3SIPA 1S2OA 3HLKA 4MVYA 1UC4B 2ZRCA 3NP9A 4DLNA 4QLBA 1M1ZA 1NYRA 2RQXA 1RC1A 1C1YA 1PYOA 1Z0IA 2GVDC 3BMNB 3HPRA 3HYTA 2GHTA 4KSYA 4YHBA 2AFHB 5HGJA 1SIBE 5AKYA 2PYDA 3WMFA 4EKNB 3CKIB 3T54A 4D4KA 1DOKA 1PR9A 5CLIA 3DBLA 3ETDA 1E18A 3G0BA 121PA 2RHJA 3QYPA 1NDUA 2QUZA 4F5ZA 3A2NA 5FLXc 3I53A 1UFVA 1RIPA 4COKA 3M1YA 3CWCA 1T35A 4BQNA 1PNOA 3DAOA 2MTBA 2PT5A 4BBPA 1INLA 3R7DA 3FHOA 3TEFA 1WCXA 1KZ9A 3CWQA 4OUDA 1AURA 3A28A 1H9CA 1UC8A 4X6XA 2QXYA 5FOTA 1FDTA 5CFNA 5BV0A 1DIRA 3DJAA 2R1TB 3HDHA 4RQTA 2RB4A 4LFBB 3OWFA 4F85A 5JH7A 4ENUA 4QBIA 2PMWB 5F51A 1EFLA 1FNMA 2ZAYA 2ZLBA 3ETNA 4XD2A 5B58C 1M1NA 3HBAA 2UZ1A 4QPCA 3TS2A 1WXFA 3M6VA 3THSA 1ZLXA 4P4SA 1GXSB 3V55A 3GLFE 4UP8A 3EPRA 1KIAA 13PKA 4P7FA 4QCLA 4XI9A 3PUWA 4URFA 1FFHA 1HF3A 4L8FA 4UW9A 1G7SA 1NY5A 4UMFA 4JN6B 1QYWA 4ZXPA 1R6TA 2W2OA 5DYIA 2PUAA 4PPQA 1J25A 4GGOA 3V2UA 3PJFA 1JTFA 4KGVA 2A9JA 4X65Q 1BMTA 1XG5A 4YMGA 4KJNA 4MTCA 4NMLA 4WOPA 4K6HA 4PLFA 3OZBA 5JAQA 3U3OA 4BZXA 4JI8L 3M3YB 2UXBL 4O4HF 4PZPA 3UV7A 5ITWA 3TQOA 5L4SA 4KUGA 1NVAA 1WQ3A 1IN8A 2NN6G 1S8OA 1LTAD 1YNJD 3JQAD 5ESXA 3WL4A 1B6RA 5AM0A 1I2DA 4D9MA 4KPUA 1FJGB 1IZYA 3H86A 2OHGA 1YS6A 3E53A 1QJ4A 4FO2A 4OXRA 1X2BA 2ZWIA 4M8SA 3WWPA 5JWOA 1Z39A 2X1HA 1WCIB 1RQ7A 3SK0A 1VJ0A 3SJAA 4JAVC 3K05A 1H4YA 3NHUA 3PE6A 1T5SA 3PFKA 1E5QA 4U7WA 3ZNQA 3I01M 4YR9A 1RLMA 4TUYA 4OA8A 4BQPA 1LSSA 2ZWMA 3SC6A 2G77B 3BORA 2IPAB 4EPWA 3LDHA 3NYWA 5C4MA 5CA1B 4HZGA 3IMCA 3HFRA 2RAUA 1CQVA 4ZXFA 2HSZA 2W37A 4DR1Q 4TMFA 2IYFA 4OHOA 5IP7H 1HR0L 1WPRA 2FKAA 1KEUA 2JFPA 2XYHA 2HNBA 4RY8A 1UXJA 5B53A 2ZG6A 4URZR 5KTYA 1N36B 4KXVA 2V98A 4EYSA 5LIPA 5ELOA 3JPWA 1TZ2A 4BPRA 3DMTC 4AW9A 5DLEA 2GZ2A 1YVDA 1P2TA 3UATA 1RHPA 2QPOA 1CUVA 3BUSA 3HBLA 4FYYA 4KFTA 3AY0A 5T64A 3AV0B 3HWRA 2WTMA 3O1HB 2BA1A 1L5FA 2NVUA 3ZBTA 4ND5A 4EEKA 1P8LA 2WAQB 3BBPA 3HRHA 4TQAA 4E2ZA 3GFGA 3LKZA 2IHBA 4X3CA 4Z4IA 2JI8A 1Z0DA 1P0PA 1S2NA 3STBD 3NALA 3W6PA 4B9WA 2IY7A 3WGKA 2CE7A 2X69A 5HKAA 3H1FA 1NUSA 5GAJA 4QVIA 2Z2KA 2BFNA 3QVGA 3PGLA 1WABA 4BAGA 1Q2XA 2GASA 3H4IA 3COZA 1ONPA 5DSZA 4CKZA 1B0PA 4C1NA 4MCAA 2JPDA 2PEYA 5REQB 4EGJA 4PZAA 1ZGZA 4YAOA 2IVFA 4BQSA 4KN6A 1XZDA 5JVH3 4K9KA 4LDQA 5D3DA 3AERA 3ENKA 3C3XA 3N5CA 1QHFA 1IHYA 1W5AA 3HCOA 2C54A 4QL3A 3SF8B 3L41A 4HDAA 1NVGA 3RN5A 1U8CB 1SRQA 1N2CA 1Q0UA 2X2OA 4ZREA 3W5SA 3H0KA 2H7VA 3ZY6A 1XZPA 4WL0A 3LL7A 2BM0A 3KSDO 1II9A 3RANA 1M74A 1RI1A 3GDGA 2EX0A 3OFSA 4URWR 4UDXX 2WIIB 4HDMB 1KMCA 1OA0A 1QIMA 2C31A 3E35A 3OCJA 4NPCA 3D02A 2AG0A 2AMJA 4C0WA 3G2NA 3PXAA 1PD1A 1STHA 1OLSA 1H2FA 1HDRA 3INYA 3Q9UA 3M6LA 2X2FA 3TS0A 4FM9A 4US1R 1MT3A 3CV3A 4A8TA 4ULLA 1BEEA 4DRYA 3MAQA 3LKVA 4AWXA 4HZUB 2CE2X 3VDQA 5DM70 1EE2A 2GN8A 5DBEX 4DJJA 3DJYA 1QP8A 1K7XB 5ESDA 3RUAA