4JC0A

Crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
432
structure length
424
Chain Sequence
b'RVGIKVLGCPKNEADCEVLAGVLREGGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSFVDAKDQYGYKLVVKGCLVQRYYEELKKEIPEVDQWIGVADPEEIANAIETDLVPDRYRKRIDLEERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVILEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein S12 methylthiotransferase RimO
publication title Two Fe-S clusters catalyze sulfur insertion by radical-SAM methylthiotransferases.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 124
structure length 424
sequence length 432
chains with identical sequence B
ec nomenclature ec 2.8.4.4: [Ribosomal protein S12] (aspartate(89)-C(3))-methylthiotransferase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00919 UPF0004 Uncharacterized protein family UPF0004
A PF04055 Radical_SAM Radical SAM superfamily
A PF18693 TRAM_2 TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jc0A04
3.30.750.200 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A03
3.30.750.210 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A02
3.40.50.12160 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jc0A01
1JT8A 1TWGH 4DR3L 4DV0Q 2EQSA 4DV3L 3HOZH 1QVFA 1T9HA 1E3PA 1WCMH 4DV4Q 1KXLA 4MZ9A 4YY3L 2B29A 4OO1G 2UU9L 2VQFL 4TVAB 4DV6L 4DR2Q 3M85A 3J7A5 3RN5A 1A8VA 4Y7NH 1A63A 1VQGA 4DKAC 3M4PA 2UXBQ 3S1QH 1O7IA 2VQEQ 1MIUA 3I56A 3RN2A 4K0KQ 1N33L 1MJCA 3DM3A 3HOYG 2RCNA 4P71A 3W1GA 3W5OA 4J15A 3D31A 4GNXA 1KC8C 1PH3A 1VQKA 4X64L 4O2DA 1UEBA 3BZKA 3CCLA 2VUMG 4DR4Q 4UP7A 4HIDA 4X62Q 1VQ5A 2B3GA 4OWWB 4GKJQ 4MNOA 4B3TL 2K5VA 5E7NA 1N32L 2E2JH 5C4JH 3EIVA 1PH9A 1S3OA 1I6HH 2Z6KC 2HHHL 5JJIA 3KF6A 1YNXA 2JA5G 1MKHA 1WYDA 1IYJB 2JE6I 4JI1Q 5C44H 2VZAA 1VQEA 3RNUA 1Q8KA 1CSPA 2K5NA 4JI0Q 1G291 1SRUA 3K0XA 3K7UC 3M3YH 2PI2E 1FGUA 1OXXK 2R7FA 4QIWE 1M1KC 3J81j 4DPGA 4NXMQ 4A3GG 1S72A 2UXCQ 4A3DG 1XMQQ 4A3BG 2F52A 3E9HA 2CKZB 4YWLA 2MQHA 4HJ7A 4L5RC 3HOVG 4LFAQ 2CQOA 2PI2A 4WJ3M 3CCRA 1Q7YC 3PUZA 1VQAA 5IT9c 1UE5A 1EQRA 2JA8G 3S1MH 1QVCA 2UXDL 1Q81C 4LFBL 4HIKA 2B63G 3I4MH 4Y52H 1PVOA 1G51A 4JC0A 2KCMA 3OTOL 4LF5L 1N36Q 1PYBA 3S17H 3S14H 4HJ8A 4LFCQ 3CCVA 2I0QA 5LMUQ 3G6EA 1PH1A 1Q1EA 3STBD 5IY0A 4BY1H 1VQJA 4KI0A 2LXKA 3WWVA 1KHIA 4RG1A 4LF8Q 2WB1G 4QJFA 1YIJA 5AJ3L 3H3VI 4R1JA 4R4TA 1X3FA 2PNHA 3J80i 3HOWH 4OO1I 4B3MQ 4APVA 4IPGA 2ZJQA 2GN5A 2JA6H 1K0RA 4BY7H 3TQYA 3VDYA 1W2BA 1HNZL 4DR1L 3ICEA 2F4VQ 1FJGQ 3JC66 2OCEA 3HFZB 2UUBL 3HKZE 2JA7H 1VQBA 4DV2L 2AWOA 3LGJA 1DGSA 3RLNA 4X66Q 4A3JG 1EIFA 1HZAA 4X65Q 3KJPA 4NXNQ 3NEMA 3PUVA 4R4OA 1VQNA 5C0XG 2IHFA 1N9WA 4P73A 2QEXA 1NJIC 3UE0A 4POFA 1YI2A 1EIYB 4DUZL 2ASBA 3PO3G 4A3MH 3CC7A 4BXXG 5BR8Q 4JYAQ 5C44G 2I5MX 2N49A 3GO5A 5IYBG 4YCUA 2N3SA 5M5XH 2AWNA 4EQ5A 3F2DA 3PF5A 4A75A 4AH6A 4JI5L 2NN6G 5IP7H 3T1YQ 4JI4Q 2ZM6Q 1HR0Q 2A1AA 3MXNB 2KBNA 4LWCA 5GROA 4GKKQ 1UE7A 3A74A 2EIFA 1CKMA 1HH2P 4LF7Q 3ULPA 3S15H 2IY5B 4A3CH 1QZHA 2NVYH 1CKOA 2GVAA 3JAMi 2Y0SG 3E0EA 3KDFA 3KF6B 1KD1C 2NVTH 2IT1A 5J3BA 1AE2A 5LMNW 3RZOH 3H0GG 4YHHQ 4LF9Q 3K8AA 4QY7A 4L5SA 2JQOA 3PV0A 2UUAQ 3HKZG 3UDXA 2ZJRA 2WP8J 1KL9A 1GD7A 2NZHA 1GKHA 2UUCQ 4NPSA 4DAYB 1HZBA 4DR6L 5M5YH 1G6PA 3I4OA 1J5EQ 3I4NH 1WJJA 3STBC 2VY3A 4IO9A 4UY8C 3HKSA 2CWAA 2AMCB 2Q2UA 1Q12A 5FJ8G 1LUZA 2R92H 2Q2HA 1Y1WH 3BU2A 2R93H 3BJUA 3NBHB 4QL5A 1U0LA 1NTGA 2DGYA 4KHPQ 1CSQA 4LUZA 4PZ8A 3AFQA 1VQ8A 3L7ZC 1Y1VG 1GO3E 3PGZA 4DV7L 1K73C 3ER0A 1X9NA 5C3EH 3PUYA 3F8TA 5IP9G 1LTLA 1V9PA 2JA6G 1XNRL 5GAEC 4QGUA 3H3VH 2Q2TA 2R7ZG 1E24A 4LF6L 3PO2G 2OTJA 3F1ZA 4GN3B 3UDGA 3I55A 5FLMH 1KRSA 2BH2A 4IOAA 1YZ6A 4R4CA 4JOIA 3GTPH 5ELOA 3W1BA 3H15A 2D0OA 4JI7L 3ZJYC 3S16H 4A93G 3AQQA 1VQLA 4QQBX 2KHJA 4RMFA 4DUYL 1I94Q 3OYYA 3HOXG 2IHEA 4UP8A 1XMOQ 4JI8Q 4JI3L 4LUOA 4A3IH 4DV1L 1N34L 4B3RQ 1VQ7A 2IX1A 2RF4A 1CUKA 2V1CC 3HOUG 2HIVA 2MO1A 4IPCA 2LSSA 1C7YA 1XNQQ 4BBSG 1I5FA 3CCQA 4JI2Q 4DR5L 3GD7A 4DK6C 3U58A 4JI6L 1EOVA 4GOPA 3CAMA 1EFWA 4LF4Q 5IYDH 4BBRH 1D7QA 3TS2A 2PQAA 1K9MC 1ASYA 4DR3Q 4IOCA 4OONA 1NMFA 4DV3Q 2YTXA 3PUWA 4P72A 1Q46A 1QUQA 4IJHA 4HIMA 2ZTCA 4JBMA 4YY3Q 4GLAC 1Z9FA 2WAQE 4L5QA 4JBJA 4HJ9A 1PV4A 2UU9Q 4YWMA 2VQFQ 1WOCA 4DV6Q 1TWAH 2N8NA 3RLFA 1HNWL 4OX9L 2KHIA 1Q86C 4JV5L 4GNXC 1WI5A 3KF8B 4KHZA 1N33Q 2KENA 3HOZG 1NMGA 1HZCA 3K80C 3M7NA 2CWPA 4A3LH 4FDBA 1WCMG 2ALYB 4X64Q 4A3EH 4EX5A 5M3MH 1YHBA 2ID0A 4P74A 3J7ZC 1IBMQ 1ASZA 4IFDG 2JA9A 1HJPA 3FP9A 2I5LX 4UP9A 5JEAG 1JMCA 5K36G 4B3TQ 4GLXA 2K14A 1KAWA 4ALPA 3T1HL 1N32Q 4DR7L 4C3IH 2HT1A 1X54A 2HHHQ 2R7DA 4BA1I 5LMNL 1SLJA 3K7AH 3BZCA 2QA4A 4AQYL 1V43A 4IJLA 1IBKL 2R6GA 3CD6A 2VNUD 5M3FH 3FHWA 2JEBI 5C4XH 2OQKA 1BVSA 4H02A 4DNIA 1EUJA 3IRBA 1VQFA 4KLKA 4A3FH 3AEVA 1A0IA 1OXTA 1K8GA 3GTLH 1TWCH 1KQSA 4GOPC 3NENA 1IBLL 2WAQG 3M4QA 3OW2A 4A3IG 2E5LL 1X3EA 2QGQA 1IXRA 4HJAA 3A5ZB 1VQMA 2UUAL 2N78A 2KCTA 2RHQB 4DV5L 1PH8A 1OXSC 4ME3A 1L2FA 2YTVA 4JBKA 4PG3A 1JJGA 4XTCS 1J5EL 1UE1A 3AYHB 3PUXA 2XGTA 5IWAL 1MJEA 2JK8A 3CMAA 2YU9H 3PF4A 1YJ9A 4GNXB 1HNXL 1VQIA 3D0FA 4B3SL 3A5UA 3GTQH 4JBWA 1M90C 4PZ6A 3CC4A 3U50C 2UXDQ 2OQ0A 2H5XA 1VQDA 4DV0L 2BA0A 4OXPA 3J81i 1BBUA 2CFMA 3HOYH 3S2HH 4LFBQ 4DV4L 5GQOA 1P16A 1Q1BA 3DLLA 3GTMH 3OTOQ 4LF5Q 4DR2L 1B8AA 4OWXB 1YEZA 5IYCH 3PIOA 1HR0W 2OTLA 2UXBL 1VQ6A 4P75A 2LXJA 2VQEL 4A76A 1XPRA 4K0KL 3TREA 2JA5H 1OXUA 5H1SE 5AJ3Q 1AH9A 1A62A 1VQHA 3I4MG 3KFUA 5JJLA 1VQOA 2WFWA 3GTGH 3CCJA 1PH2A 4DR4L 4DK3C 4X62L 3GTJH 4GKJL 3CPWA 1HNZQ 4A3LG 4GOPB 4A3KH 4BA2I 4A3EG 1SROA 4DR1Q 3S2DH 5M3MG 2YTYA 3RLOA 1Q82C 4BY1G 1TXYA 4DAMA 2UUBQ 4A3GH 3I7FA 1PYSB 1RIPA 3MEFA 4YCWA 2Z6KA 4DV2Q 2ATWA 4A3DH 1K8AC 1QUQB 4A3BH 1RL2A 4JG2A 3PIPA 5ELNA 4JI1L 3HOWG 1JB7A 1C9OA 4BY7G 2K5HA 3UDIA 5GAHC 2PMZE 4DUZQ 3HOVH 4JI0L 3NELA 3PCOB 1GVPA 1X65A 4PZ7A 1PH6A 5M3FG 4TQUS 3KOJA 5FLXc 1XTDA 4NXML 3K81C 2FXQA 2JA7G 1YJWA 2JA8H 2UXCL 5JJKA 4JI5Q 4LF4L 4C2MH 1XMQL 2B63H 3L0OA 3JAMc 2Z0SA 2AKWB 2D0PA 2IX0A 4MTNA 4A3MG 4LFAL 1XPUA 1HZ9A 1E1OA 2E2IH 3CW2C 1AE3A 4A4IA 4IPHA 2I5HA 2NZOA 4IFDJ 2A19A 3CF5A 1NE3A 5JEAJ 1L0WA 2YYZA 5IP7G 1C0AA 3FKIH 3U4ZA 4XIGS 1IZ6A 4GN4B 1N36L 1IL2A 3S24A 2MO0A 4LFCL 4DR6Q 1E22A 2K75A 5LMUL 4A3CG 4WJ4A 1IBML 4LUVA 1QZGA 4GS3A 4LF8L 3UDFA 1PH7A 5IYCG 3TS0A 4X6AH 4IPDA 4A3JH 3CP0A 1EQQA 1I50H 2MFIA 4B3ML 5C0XJ 1W3SA 3PO3H 4BXXH 1BKBA 2VS1A 2F4VL 3I4NG 4DV7Q 1FJGL 2R93G 5IYBH 1I3QH 1TWFH 1H95A 5EAYA 2WB1E 1TWHH 3KLWA 1XNRQ 1YVCA 4AYBE 4A3KG 3CCEA 1FVIA 2BA1A 4X66L 1CKNA 1Y1WG 1L1OA 2VL6A 1XJVA 4LF6Q 4X65L 2R92G 1Y14B 4NXNL 4JOIC 4AIMA 3EBEA 3KDFB 2C35B 2ZJPA 1UWVA 3I2ZA 1Z47A 1B70B 3RR5A 4JI7Q 4JYAL 5BR8L 2ES2A 1X3GA 2D62A 1VQ4A 1NY4A 5C3EG 1J6QA 1GM5A 5DLQE 1PFSA 4DUYQ 1YITA 2HQLA 1K83H 1VQCA 3H0GH 5IE8A 3T1YL 4UPAA 5M5WH 4JI4L 1E7ZA 4OWTB 2ZM6L 2K50A 5FLMG 3KJOA 4DV1Q 1N34Q 1HR0L 4JI3Q 3CXCA 4GKKL 2MNAA 4LF7L 3GTKH 2E2HH 3S1NH 1PA6A 1X6OA 2E8GA 3G4SA 4C3HH 3EN2A 3ERSX 2GVBA 1S40A 2L15A 3G48A 5FJ8H 4LF9L 4YHHL 1P8LA 2BH8A 2Q2IA 4DR5Q 1SFOH 4IFDI 4JI6Q 3AFPA 2HIXA 4PMWA 1UE6A 1JE5A 1NBWA 4AYBG 2UUCL 1Y1VH 1B7YB 3FKIG 1WFQA 2Y0SE 1YHAA 4YWKA 3Q8DA 1PH5A 3TRZA 1XPOA 1X56A 2RHSB 5IP9H 1BBWA 4O0AA 2CCZA 2OWOA 4LNQA 1LM0A 1R9TH 3UE1A 1JJCB 1SN8A 3M9BA 1KIXA 2ZTEA 4R4QA 4GLVB 4POGA 4HJ5A 2R7ZH 3PO2H 1SE8A 3CMEA 4KHPL 1HNWQ 1L1OC 5IYDG 3GTOH 4LW1A 4OX9Q 1V1QA 4BBRG 3E9IA 2F3IA 5GAGC 3CC2A 4A93H 4JV5Q 2VUMH 2XTIA 2AHOB 3CCUA 2NVXH 5C0XI 3KYHC 2A8VA 4L5TA 3TEHB 2JEAI 1LYLA 2YV5A 1VS0A 1PHJA 3J80c 2ZTDA 3HOXH 3GDEA 4HIOA 3RZDH 2NVQH 1D8LA 1N8RC 2K52A 3T1HQ 4DR7Q 3U4VA 1VQPA 2NN6I 4YCVA 1X55A 5LMNQ 1OXVA 3CCSA 4AQYQ 1VCIA 3CCMA 1IBKQ 1E1TA 3HOUH 3B6YA 1SMXA 4BBSH 2PQAB 1I94L 4GN5A 3ULLA 2K4KA 1YJNA 1K3RA 1XMOL 4NB3A 5GADC 1YBYA 4JI8L 3SGIA 1JJ2A 4B3RL 2DUDA 3M4OH 1SR3A 5HGQA 1KRTA 1PH4A 3L2PA 1IBLQ 1EWIA 1OTCA 2E5LQ 1YHQA 3CPFA 5HY6A 4DV5Q 3G71A 2JJQA 1FL0A 1EYGA 1XNQL 1CKNB 1U5KA 1L1OB 4JCVE 4R4IA 3F2CA 5C4XG 4JI2L 5IWAQ 1QVGA 3J81c 2VW9A 4A3FG 4C3JH 3S1RH 1HNXQ 1VQ9A 4B3SQ 3CQZH 2EXDA 3A0JA 3ULJA 3PSIA 3F2BA
chains in the Genus database with same CATH superfamily
2Y05A 3TNYA 3BDVA 2QVYX 3ETHA 1JLRA 2AOTB 2IS6A 3L18A 5D1HA 4W9NA 1H0HA 3VNAA 3HRIA 1NWHA 1XUOA 3L6BA 3O8LA 2YXBA 4MJXA 1UC8A 2ZRMA 1N5RA 4I81A 3Q12A 4R3WA 1XRPA 5JSHA 3WGIA 2NTTA 3LG2A 3IOBA 2F1OA 5E4YA 1UP7A 1QVVA 1WPGA 2WA1A 3MPUA 4DPLA 3E9HA 2PLWA 4G0OA 4RTPA 1SVUA 5F7XA 1A8UA 4KACA 2FX5A 1H6AA 1Z22A 5AVOA 3AEQB 3DCNA 5E3HA 1TECE 4TS1A 1YS2X 4L8VA 3HY3A 3V2HA 3RJZA 3LBYA 2O5EA 1V16B 1JIVA 2XNKA 1RBMA 1WSWA 4ETNA 1YK0A 4YAKA 3OPMA 1Z2EA 1QQ6A 1XCMA 4EUSA 1K27A 3CRQA 4JVSB 1YR1A 2CFCA 5E1MA 1KHHA 1G20B 4JH0A 2C4KA 3EVGA 3AEUB 3DOFA 1GKHA 4FC7A 1KH3A 5T4EA 3SFVA 1IEVA 3PGVA 3HYLA 5DBFA 4GVPA 1WXQA 3NTHA 5T4HA 1X1TA 2BGWA 3TO5A 3OPXA 3UG7A 2XQFA 3IVRA 4QPJC 5TB5A 1I4RA 3DCIA 1D6EC 1N4DA 4P4UA 4MRSA 4C56C 4U2EA 3OECA 2HSGA 4UVEA 2HXSA 2PKQO 5KYKA 1AHNA 2ISQA 4PWYA 2BEJA 1PT6A 2Q7XA 2A88A 5ALPA 1TMGE 5COQA 3BG5A 3LQRA 1X74A 3D64A 4P7KA 1OILA 3RS8A 2EEPA 1NQAO 4XIJA 1PL0A 1VPTA 3TBKA 1LK0A 1L7VC 1NUQA 4Q16A 2I7XA 4JJFA 3PQ4A 3U2QA 1J1IA 2W6JA 3KPJA 3PE6A 5C4XH 5L53A 3JASB 2B7CA 2PPVA 2QL6A 4DGFA 1ACJA 3NWTA 1IXRA 3HDVA 2DFTA 1EFRD 1JHXA 1XT6A 3V1NA 2BA0A 2D1YA 2PT6A 5BV0A 3S2ZA 4FYWA 5K0NA 1TU2B 2AN9A 2X2PA 3KFLA 2O3TA 2EYUA 3ZU4A 1QONA 5AJ3Q 3EFBA 3LDUA 3MWLA 2RSLA 1YJXA 1YH3A 3S0JA 1AKMA 1GYPA 1UFVA 5JARA 1IOVA 5K0CA 4TQUS 3PF9A 1KP9A 4YUXA 3A1UA 2OCPA 3EF0A 4GX0A 3T3PB 3RBXA 3ZYZA 1WXDA 1M75A 3S27A 5F35A 4K8RB 4L4ZA 4UVHA 4D4MA 3UDFA 3K5MA 2FWAA 3LQ2A 3ZK9A 2W5UA 1B93A 1R8XA 1SKAA 2I3BA 4LZOA 2VL6A 4JOIC 1HZJA 1ZA1A 1DJLA 1YZHA 2HHJA 2VPXA 1TZBA 2QTGA 2I1VB 3DUWA 1QOPB 5DPMA 1HL3A 3URYA 1AK2A 3M9XA 4ZZ0A 2UVPB 3KR1A 4C3HH 5C1BA 5JAIA 2ZOAA 3I8SA 2GVBA 2C7PA 5LKRA 4MWTA 1XVAA 3CMEA 4MW4A 2IA5A 4JT4A 4F6RB 2OG1A 3BWBA 4GG1A 1O1YA 1WDMA 1ZKMA 1U9RA 1BJTA 4WKBA 2FE1A 1UEAB 3W9BA 4QXAA 4UHCA 3TJRA 4RE6A 3K9QO 16PKA 4BP1A 3FWNA 2VRWA 3EIEA 4DZRA 3R7WB 1CERA 3CPFA 1ML4A 3C3DA 1AUQA 2FSSA 3VR6D 4L95C 2P3QA 3G2JA 2J4CA 3ULJA 4S2EA 5JE8A 3DKPA 5LZ2A 2F4IA 2NSYA 5DGDA 3FYTA 3B1WA 3FKIB 4PLTA 3J7A5 1OHHA 5EXPA 1O7IA 3H2HA 3R0XA 2EY6A 1RJ9A 4RPGA 1DJNA 2HWYA 3QVMA 4MMZB 3LRTA 2DN8A 3W90A 4ZO8A 1P61B 2CLMB 2VP9A 5BT8A 5EJ8A 3VSEA 1JQ5A 3TWOA 1YS6A 5TJ9A 1Z2PX 3C98A 2OV8A 2ZRDA 5DP2A 2K4MA 1PZHA 2FQWA 1EESA 4ZAIA 4BDTA 3A56A 2J46A 3NDJA 1L8QA 4ZYWA 3TIVA 1TPZA 4OIKA 5AJ3L 3D7KA 1R00A 2HWUA 1EHCA 1W2BA 2NO0A 4BN5A 3KP1A 3SK5A 1CB7A 4IXDA 1DGSA 3QOXA 4GI2A 4N8FA 4YJDA 4LY6A 4MJ7A 3PWKA 3IDFA 3T4UA 1TT5B 3HFSA 2DNEA 4RIEA 2VSOA 4UUQA 1P0CA 2HRDA 3T8YA 2P6NA 1TXGA 3MGLA 3FNRA 2Q2HA 1HQMC 3JAKB 4B32A 3OCJA 2IXAA 4DV3B 2O0MA 3KXKA 2J85A 5TQVA 3REQB 1YV9A 3TQOA 2AKEA 3GEDA 3T4XA 4IIEA 4ZC1A 1E9SA 4FFNA 3FMGA 5BWOA 2ALJA 2EW2A 1X7ZB 3SLGA 4X91A 3LUDA 5EWJB 3ELWA 2G9RA 1SYGA 3ILSA 3QH4A 2LIVA 1BXGA 1L5QA 3T7RA 3ZKAA 2JGDB 1R27A 3IMEA 4CEJA 2JA9A 2GN2A 1JXAA 5KNDA 3HZXA 4MINA 5LQCA 1URPA 3V7YA 1N2CE 3PSHA 4MWBA 1ZN9A 4N1AA 2W98A 3SE7A 2VYCA 1XHFA 2JKVA 1GUGA 4HATA 1SUAA 2F0LA 4URWR 1W0JD 5K0BA 3NT5A 4BTEA 4IDNA 3PIOA 3M6IA 1F8UA 4Q01A 4YJFA 5AFWA 4JI8B 5H1SE 3UTDA 3ZDRA 1RC1A 1JJFA 4JN6B 4JBIA 5FO9B 3ESQA 3WKBA 2VAVA 2Q5HA 4GW3A 2Q3DA 5BV1A 1FYVA 3CZPA 3DVAA 4JVLA 2EZTA 4UEQA 3LC0A 4YV0A 1S8AA 2PMKA 4C01A 1OC4A 4LSGA 1BHQ1 1H0RA 1O80A 3LUPA 5E6UA 4MV0A 4HDSB 2VF2A 5TMEA 5K99A 3E81A 1XNHA 1P1IA 4XIGS 3HG9A 1HQCA 4MHEA 1VMKA 1C7EA 3MJSA 3C46A 2V7XA 4I50A 1E7YA 1ZA2A 3SR4A 3GUVA 1E9DA 1D1QA 4ZVOA 5FO7B 2R92G 2FPIA 1PK9A 2VEOA 1U9IC 3KYDB 5KYLA 5B1DA 2HMVA 3R76A 2W2QA 5JPIA 1EQUA 1BZYA 1XI2A 4HC4A 4DIOA 2OESA 3GIDA 4GD3Q 3TGPA 5HX7A 1RWNA 2V7UA 2GR9A 4U7DA 4OJQA 1E6MA 5BNZA 1T13A 4KMOA 2GHRA 1LTGD 4C0QC 2AI1A 4WZAB 3R75A 4O3FA 1Q0UA 3ZIDA 3PLNA 4A91A 3FMIA 3WO1A 1YVEI 3CX7A 2O0HA 3OCYA 3C39A 3J7YW 1W73A 1SR3A 4YT8A 4HRAA 4OD0A 1SBQA 2OILA 3DWIA 2P8SA 4R1NA 2Q1TA 3QZUA 5THQA 2QG6A 3R7AA 1QRDA 4I50F 3LW7A 1U4OA 5JZOA 1K32A 4G85A 4PNHA 3OI7A 1VHQA 1XAHA 3FSRA 5BUSA 4AJNA 2F6RA 3AKEA 4EPYA 3II6X 2TMPA 3VA7A 1JQKA 3L04A 1M2JA 4NFLA 1PH9A 3ZXNA 3HZRA 4RF5A 4NYIQ 2J07A 1YZKA 3FMVA 3A1DA 1VCMA 4BGVA 2GPBA 1M0EA 1A76A 1KMMA 2FPGB 1IZ0A 2CW0C 4G97A 2OQIA 4GYWA 1Q19A 3FOEC 2ZJ5A 2CXTA 3ZXIA 1Z6HA 2R2AA 1J0CA 2P6MA 4RANA 3M6VA 1V26A 1FFBA 1KVSA 3WGUA 2WZDA 1P72A 1GU7A 2ZRFA 1T9BA 1FDWA 2H00A 4N5DA 1MZVA 4MDHA 1MIOA 4OP2A 3QWHA 3GGOA 3TZUA 1HZAA 1N6KA 4KWIA 4H31A 2BMDA 3P27A 5F21A 3VO2A 1E1MA 5EE0A 1G8GA 3OJLA 2QRUA 3EDRA 4QTPA 4MA4A 1JDTA 5BOSB 3KF8A 5U4QA 4BLVA 2ZSHA 5BWBA 2DBRA 4ENTA 5HM8A 1TWGB 1T5LA 1USWA 4DMHA 2ZJFA 2IV7A 1IZYA 5ELMA 1I3MA 2AQHA 4LFAB 2FRDC 3QE9Y 3MHTA 2FE4A 2B34A 3PR3A 2VOEA 1OFTA 3JAML 4M6WB 1ONSA 4JI8Q 3CO0S 5BN4A 5CC4A 3QKIA 5IAOA 4QJ5A 5LBTA 4RWZA 5LZ8A 2L5TA 1PDWA 4D99A 3ZHSA 4IJHA 4J7AA 1NI3A 3DLBA 4QIHA 4F4DA 3S1AB 3PHJA 4P74A 3L43A 1K3BC 5TGTA 1EEHA 4NOLA 5GMOA 3T9CA 2XT6A 3M6WA 2BRUA 3L8HA 5EQFA 4TM7A 1TWCH 3PNQA 3T3DA 3A5ZB 2A84A 2EGGA 2GPYA 5LXTB 4FFMA 4FDUA 1CX9B 1NXPA 1KO8A 3G0OA 2XITA 4F1KA 1IXSB 5DGXA 8OHMA 4LJLA 2CJPA 4RGOS 4RTNA 1Y82A 4IOKA 3M6UA 1WVLA 1WS6A 2BSAA 3D7NA 4I3FA 1Z17A 3TLAA 2FLWA 2I87A 3AU9A 3OX1A 3S1QB 4P7FA 5JXWA 3F3KA 3HOVH 3B6EA 1L3CA 3AHCA 3OEWA 3QEMB 2JN4A 4DFDA 1J9EA 1JG6A 5CA1B 1PNRA 1NN3A 3WNCA 4PZZA 4B87A 1U4LA 4GMKA 2A58A 4WLUA 4K6GA 2BTOA 2FPPB 3CF5A 3FWPA 3FNFA 4QELA 2XAAA 4LWZA 4YJ3A 1ZM2A 4INJA 3DWQA 4M60A 3H86A 3RUHA 2QY6A 1E0AA 4KY5A 1AEXA 2PQMA 3RK4A 4H3SA 3EIHA 1AS2A 2FXVA 1O9HA 4CR7A 4YXWA 3HJCA 5A3VA 2P5SA 3DPSA 1ZGCA 2WKSA 3IBGA 4ZN6A 3AZPA 5GY7A 3INRA 3QDQA 2BKVA 5A6VA 4E6IA 5A6SA 1R0SA 1R16A 1K83H 4A2WA 4UPAA 1CDEA 1OZHA 4YO7A 2VYVA 4YUYA 2DY7A 3UHPA 5LYYA 3DDOA 2V9PA 4ENUA 1BDIA 1P8LA 1O7LA 4DMMA 1KAGA 1H4TA 1HYGA 3R3VA 5FR2A 2QMUA 4ODGA 2R8YA 2BHTA 2W2TA 3D4IA 2PR2A 2XSZD 1D6MA 4JGBA 5JNTA 1G60A 2C2ZA 2VHJA 5B3AA 2G1AA 2R8ZA 1KP2A 4YCSA 4D8TA 3EG5A 4Y2GA 3AG5A 4JI8L 4LW8A 2L1BA 2G4CA 2GAOA 4YJ3F 3W79A 4DGSA 4DV7B 4ZOLA 4C14A 4FKZA 3DMUA 3WGVA 4IFDH 1DEXA 4I4NA 3Q6SA 1FR3A 2V4MA 2JBAB 2R68A 4RM3A 3S1SA 2A68C 5BVGA 1X14A 3QWAA 1QB5D 2XUHA 4CF4A 3KF6A 2A92A 1KYZA 3VVMA 4LYAA 5HRCA 5J63A 2PUEA 3DDHA 4PCVA 1GPMA 4EO9A 1YSCA 5MN4A 3D3NA 1NDQA 2MQHA 1NV8A 2JARA 4LFAQ 3HG7A 2NVWA 3AETA 3QVUA 3MFGA 2RHDA 3UHOA 3GOHA 4K6MA 5HKAA 1NIPA 4UOZA 2Z1NA 4Z9YA 3ICPA 2RVLA 1P77A 3RHTA 5AKLA 3WB2A 4MPDA 4IJQA 4NP5A 3CXRA 3G2NA 4ENWA 1PRTB 1DJOA 2HCJB 2WWRA 3PQEA 1DKRA 3R7NA 3HKZE 4RD2A 3VR2D 1MB9A 4LHVA 3QPDA 1PL7A 3NEMA 3QPWA 4RA9A 2R00A 4MWGA 1QLWA 4D46A 1IG0A 2CD7A 1PR1A 4MWEA 5IEJA 4ZOLF 3D7SA 5LL6P 1HTTA 4UU7A 3VMFA 3WAKA 1EUCB 3H7AA 4B3BA 3ZW7A 5FOTA 1ZG3A 3TZHA 2X6RA 4PLCA 5LBIA 2Q8NA 4U02A 3UFBA 1AGRA 3O8RA 3TD9A 3CRMA 3UDXA 1C0IA 1UDRA 4HGNA 4YIKA 1J20A 3OMLA 1XMQB 2ORED 3M7GA 1HG1A 1NZFA 1GSIA 2YMQA 4AZWA 4FGJA 5DWDA 2BUCA 1A9PA 5ELOA 4DG9A 5E2AA 1VQLA 1KKLA 5K3FA 4D4JA 1BCSA 3RYFB 4GEGA 5C44B 4F3KA 5JJCA 3BULA 2NTEA 1BWPA 4BJHB 3FTDA 1W7AA 3TSYA 4MAAA 3H0GB 1UDCA 5F9FA 1ZJ6A 2QX9A 1LQUA 3EG9A 4MTCA 4CR8A 2XOEA 1PV4A 3LKBA 4PYLA 1KIMA 3GPIA 3LYAA 5I9TA 4PYIA 3U9SA 4OOFA 4BFLA 5JAOA 4MVJP 4E32A 2NXNA 4L9WA 4NDZA 3BCHA 1FSSA 3CVWA 4C3IH 3ROEA 4KTTE 4G3XA 4U2DA 5A0VA 4F06A 2CLEB 1E2IA 5IC5A 5EUUA 3UT5B 5AI5A 2CZGA 3FRPB 2YJ6A 2YTVA 4L74A 1MABB 5KI6A 5KVAA 1JEEA 5LD2C 2CLCX 4YXFA 2W70A 3G8BA 2AS0A 4DXFA 1E0JA 1TZ2A 2ZG6A 1AKNA 5HF6A 1JQJC 5DBHX 1A62A 5E4FA 1Z7BA 1Y3DE 1CTQA 4XSGA 3MTBA 4GS5A 4BCDA 3I91A 4AYXA 4A3DH 3HDGA 1JB7A 1GWNA 2Q0SA 3SF8A 1WXFA 4WJWA 1DELA 3W9SA 3B52X 4XQGA 1BHO1 4RIIA 3OZEA 2PUTA 2R4TA 1AKTA 3UAOA 4TKLA 2MU1A 5CUQA 5JECA 3SXHA 2H54A 4LFAL 4BNIA 1NF3A 1YL6A 1WEKA 2OUKA 4R1PA 3RGWS 1KOFA 2DJGC 1X1QA 1V1MA 3CZRA 4EKYA 2X4DA 5ALRA 1CQFA 4EJSC 1ZIDA 3GFSA 1YNJD 1RQ2A 5BVHA 3BWCA 2HSJA 5TC4A 1KSFX 4DV7Q 1CVLA 2Y0CA 3DXFA 4PSKA 2CW5A 3I2JA 2ZDHA 4NLLA 5FBWB 5G1PA 2AE2A 3BUSA 3OCVA 4XASA 3EHEA 1K98A 1Z4OA 2PYIA 2L0XA 5IT9L 2WWWA 2GPAA 3EN2A 3MD9A 3KQQA 5EZQA 4ADSG 2IXTA 3RAEC 9ATCA 4RV5A 2UZ4A 2BFCB 3G9UA 1JKMA 1VLLA 3H8VA 5KYIA 2BPOA 5A62A 1BXRA 3F46A 1MRSA 1L7DA 3BMCB 4DVJA 3L84A 3EUFA 1RHQA 2PW5A 3QOYA 3CFYA 2A30A 1H2ZA 2AXNA 4NEHB 4J49A 2RK6A 3K3PA 4D4HA 1PJZA 4ZU1X 3LHDA 3QUAA 4OL7A 2W22A 3KQHA 1IDN1 1ZIPA 4Z7JA 1T8TA 2Q4TA 1VKNA 4KSBA 3MXPA 4BUZA 1GITA 4ZCTA 3HVHA 1NN0A 3PD0A 4UP7A 2WJZB 3HMKA 5C4JH 1A3VA 2X76A 1DC7A 2I8LA 2VZAA 2BDTA 4DJDC 1T9ZA 3J81j 2CL0X 2IOHA 1XMQQ 3RPEA 3TW6A 2FPMA 3MILA 3T4EA 3FVRA 2XCOA 3OIDA 5F23A 4OK5A 1RHRA 1PVOA 4LHWA 3C7AA 4AG3A 1M5RA 1RI1A 3SBDA 3ZCPA 5FI1B 2EYQA 1I36A 3FY4A 2YMLA 4OJKA 3C3AA 2IXGA 1NXOA 4WLNA 1U8ZA 1A9TA 2IPOA 1XTRA 3GZTB 5L3QB 4JT8A 2NVQB 2OPHA 2JA5B 821PA 3U7GA 3K31A 2HQSA 1JEDA 2G77B 2HM7A 4NBWA 3RCBA 1EK0A 4QRHA 3UJAA 4B75A 4YCLA 5L4SA 1JPUA 2A9RA 2F0SA 4FZVA 4MIKA 1D5ZC 4XGQA 3I2HA 4IO9A 1G5QA 1LUZA 2ZT6A 2Z57A 3H9GA 4DV7L 2R8RA 2BW0A 2VA8A 3ZWAA 5IAAA 2HQRA 3NATA 4LBZA 4QULA 2JDID 4ZDWA 4BFUA 2W2XA 3RB8A 1PDQA 3L8DA 2IYUA 2W2OA 4EO4A 4C4RA 4A23A 5B3JC 2WZBA 5IT4A 3DAHA 1KYWA 1FTWA 4YRJA 1N1DA 2ZSJA 2XT9A 2HSDA 1WCWA 4XPIA 4C6SA 3GLHB 2C5SA 5AO9A 3EPHA 2MYUA 5IABA 4II3A 1A4XA 1HZCA 4B5LA 4FZ5A 1P6QA 1XXHE 3KB8A 4RZXA 2PS9A 1V35A 2DP4E 4WD3A 3UWOA 3LKDA 3ANNA 5C8ZA 1OXBB 5LDDC 4V2IA 4BZWA 2AOXA 5F51A 4YIHA 5E9QA 3I28A 1UM9B 4J07A 2VSYA 5E1OA 3QWNA 1QH0A 2F8LA 4JHXA 3HY6A 1G6HA 1U9CA 5GQOA 2MSDB 1I3NA 3L40A 3EEYA 1B8AA 1YR7A 5ESDA 4IXTA 5TPWB 1JG3A 4EF4A 2CYAA 2XHEA 5IVPA 2WFWA 1NW3A 3K9HA 1CFMA 1E61A 1M8PA 1E7QA 1C1DA 1RRCA 2J5QA 2BKXA 1NUHA 3EXG2 1XMQL 3OO1A 4M54A 1CQZA 4HGQA 2XJ9A 1R4NB 1B8NA 3O83A 4DPMA 1CS0B 1ZOOA 1WDTA 2QNIA 3CINA 4Q3NA 5L3ZA 3I3CA 2WPDD 4D0NA 4Q4JB 4FINA 4FF1A 1KI4A 1TCUA 4ALIA 1J0DA 3W2TA 4KUHA 1T15A 3DAFA 3QLEA 3I9NA 3F3SA 2OBBA 2QJTA 5JO9A 3U1TA 1A97A 1FFWA 2JLYA 3HO1A 3B8HA 4G01B 3UQYS 1WWKA 3AF5A 2RH9B 4RX1A 3PVCA 3FAZA 4NBSA 1PT8A 2HJWA 1AO0A 4DR1B 5C34B 4TLBA 2PNRC 5EE5B 2F1HA 1SE2A 3OA2A 2IP4A 1MSGA 2OC9A 4FDAA 2GZDA 2ZPUA 1GD1O 1JJCB 2Q27A 2OZVA 5HUJA 4Q1AA 1I2MA 4E5NA 3EXHA 4COKA 2H5EA 1OX6A 3L07A 4C4XA 4F9TA 4WK6A 1GUYA 3LK6A 3K0CA 4B08A 4KGXA 2WJ4A 3EYAA 1ZLYA 4LVCA 3LY7A 3C14C 1EDEA 1QF9A 4FSXA 4WTOA 3GBSA 2PQAB 2ZSUA 1OWOA 5ECDA 2P65A 2C82A 3ROXA 3KHTA 3E0QA 2JJQA 5MFZA 2FG7C 3A4YA 3BL5A 5CBPB 1VTKA 1A50B 3DHVA 5AJVB 2H1EA 3U4QA 5TMDA 2A3NA 3BG3A 2H8KA 3OU6A 5K3EA 1LVHA 2GHTA 4BV2A 3M85A 2YWXA 1JPVA 1X80A 4B3JA 1ZH0A 3I05A 2E2JH 1I6HH 3SXUB 5H68A 3VV3A 1ILEA 5C0XH 2EIHA 4GZYC 1K6XA 1T1GA 3K7UC 2V9ZA 4ZGBA 4A0RA 2JGMA 4ER5A 4X54A 5BMVA 3AIOA 1H69A 1OC2A 4PFKA 1APBA 1LSUA 4M46A 3V1LA 3RIYA 1KEWA 5ITWA 1HE4A 4GWLA 5DE3A 3F6YA 2ATIA 1F2UA 3I12A 1J09A 2YY7A 4HYYA 4RADA 2ZSEA 3G2LA 2QE6A 2EY5A 1ZYRC 4S35A 1VE5A 4GECA 1VQNA 5HW0A 1SKYB 2EKPA 1R5BA 3TZLA 1KRWA 2QN3A 3TSSA 3ANMA 5NULA 4NE2A 3MXNB 3DE7X 1EFRA 5B6IA 4QO7A 2K7VA 3IIJA 1NJ8A 3H3FA 3PNMA 4Z9XA 4HAOA 4CKZA 2VN8A 4C3JB 2WYIA 4OUDA 4RKQA 1UK8A 4HQLA 3RJ5A 2IS2A 3D5TA 4A6DA 5INTA 2ZS9A 1PSWA 3DVLA 1ECBA 4QQNA 3KLMX 2XLCA 3W04A 3S16H 5BMVF 4A93G 1MT0A 4O2AF 5IVIA 4ID6A 3B2NA 2JA1A 3O82A 1V0JA 1N0HA 4OYYA 2PMFA 2GHQA 4PFSA 4BHTA 2CLKB 3TXYA 3MJVA 3GLIE 4IDHA 4LZZA 3QVJA 1T6RA 3PGMA 1Z0KA 2QN8A 1T9CA 1JP7A 5BQPA 3OZIA 1FMCA 3T1YB 4Q1DA 4MLCA 4IZ8A 3INYA 2ID0A 4BB6A 1RYZA 2BF7A 1P8JA 3G1TA 2G04A 5AKEA 4RK1A 4UDNA 1P19A 2IW3A 2IS4A 3REOA 3N7TA 4BX0A 4JJKA 4FHDA 5AVXA 1C2TA 2JJ2D 3I6BA 2JK1A 4WACA 1QC5A 2RHQB 5JDIC 2NPIA 4LRSB 4GP6A 3AYHB 3HKBB 1JR2A 2YASA 4O0LA 4DJFC 2V74B 3HDQA 1QS0A 5DGCA 3DSRA 2W2KA 2DFDA 2GPTA 1JQEA 4DWOA 2Z2JA 5HRAA 3OOCA 3LOUA 5A4DA 1AH9A 4W82A 5C3MA 1RMQA 4BMOB 4LYYA 4DR1Q 3SEFA 3UENA 3OZWA 4OYHA 3GDFA 1C4KA 2GYUA 3VFDA 1YR9A 1RXUA 4JLBA 3TYXA 2VDWB 3WLOA 5KSPA 3GT4A 3VR6A 4LNHA 1I8TA 2ZI9A 5TSSA 4L0CA 3D7RA 2XUJA 2L0CA 2BTQA 1KI3A 4YV1A 3T3GA 1E94E 2AMJA 2DSTA 3BIWA 4E3ZA 1FXWA 2H0QA 4DMRA 1GRCA 4IFEA 3E9DA 5KTSA 3KBXA 5EGSA 5IYBH 2NACA 1MVNA 1JZTA 1JR0D 3I2ZA 1MB3A 5IVHA 1YL5A 5G40A 3JYHA 2OC4A 2WB2A 1G6ZA 4OB7A 4LTNA 4CMBA 5JNRA 2GEKA 2RFLA 1B0UA 4G5YA 1GADO 3KUXA 3N2IA 4UJ5A 5B36A 3HKCA 2A9FA 4JUCA 1IATA 3AP2A 3IELA 1ZONA 4B47A 1T1SA 3QX8A 3FROA 1BA3A 1XU7A 2P1ZA 5IYDG 2AB0A 1SXJC 4PIMA 5A1JA 1LNQA 2BN4A 5ER6A 4L15A 3FPJA 1M2VA 3K7EA 1BOSA 1VBNA 2VRNA 3UCEA 2IUFA 4AZTA 4BAUA 4FP5D 3CCSA 4LXQA 3PRKE 1AURA 3TRDA 3CEPB 4UNPA 5AQEA 5EPOA 4X1YA 3HRHA 2OB2A 2JA8B 3WHLA 3MS7A 2J7KA 3F43A 5J23A 2QQFA 3KJZA 4F3NA 2WR8A 3R44A 4FMDF 2QSZA 3GGSA 4CG1A 4JJEA 1L5RA 1WTCA 1LDGA 1YOVA 1ZK4A 2C7OA 5AKIA 1OLOA 1E1DA 1UPCA 3IUNA 2RAVA 1I5OA 3ITPA 4O2DA 4OEHA 5ICCA 1IHXA 4IUTA 1YB4A 2K5VA 1GTSA 1C1XA 3B7PA 1S02A 4YFVA 3FUUA 2A9JA 1P9RA 4H1WA 4NV3A 3IVXA 1CSPA 4CM7A 3WZ2A 2FZCA 4QU5A 4G0VA 3DZGA 3HI4A 1J42A 4P4GA 1E3JA 1PNVA 2ANCA 8ABPA 5LWQA 5JHHB 4JJ4A 2C57A 5K4GA 4N54A 4MYCA 3JD0A 3SZGA 2OAQ1 4KI0A 3G1UA 3RVNA 1SXTA 3RS2A 4CM4B 4G5RA 3LJKA 1VGQA 4HHEA 4DR1L 3P2OA 2XWJI 1ADFA 3V1TC 2VQ3A 2I7TA 4LZAA 5AW4A 3KK0A 3ON5A 3O90A 5TGZA 3PQDA 4D97A 4DR2B 3D5EA 3T1YQ 2C84A 2YXEA 3BM5A 3R3ZA 3DEAA 3BAFA 5GONB 3QFRA 1X2BA 4NBVA 2R8OA 3SC2B 4QY7A 2GCNA 3N6RA 5ALMA 3QSGA 4ND4A 2B2WC 1W0JA 2WDZA 4K9DA 4NPSA 2JBHA 1JLMA 3ED5A 1AO3A 1II9A 2C7VA 2PS1A 3WMRA 5D7BA 2B2XA 4PY2A 3M4JA 4B48A 4JDUA 3A6LA 4RCOA 3O0DA 3BD9A 3HKEB 2XZPA 3GCDA 4QATA 3H15A 3DTYA 2VNHA 3C2PA 2OFPA 2Y0EA 2FR8C 2LNDA 5LMUB 4FMCF 4UP8A 5ESRA 4JROA 2HLHA 3R2IA 8MHTA 2HFKA 3ZOZA 3WYEA 1AJEA 2MO1A 2LSSA 3X2FA 4TWIA 5I2YA 4BE7B 5AESA 4LHYA 2KOLA 4HIMA 1JKFA 1Z4NA 2NSDA 2EP7A 3UOAB 3RS5A 1B41A 3L01A 2H4FA 3HOZG 5C8DA 3SSOA 1VI6A 2IPMA 3CUVA 4Z6KA 3C8HA 3D43A 1OBCA 3GBVA 1BXZA 4NCNA 1ZSNA 2YCBA 4PR3A 2G70A 1VIYA 1YL7A 5KVVA 3VNQA 4E5SA 2IZ1A 3TPZA 3VUEA 3AVYA 1D0SA 1W8DA 2NZVG 4P80A 2QDLA 5C5IA 4AJ9A 3CUUA 2VOJA 4W4TA 1C0KA 3I5UA 3DHWC 1BUZA 3C3CA 3BPSA 1UPBA 1Y9AA 2D9UA 4LC1A 2LRHA 4LK1C 2EBFX 4ENVA 4GOPB 1M1XB 4X3UA 5IWCA 2I3ZA 3QELB 1SGWA 4RWEA 3A2NA 5JISA 1TAQA 2AZTA 2OY0A 4YAEA 1P5ZB 2OXFA 1JE0A 1P6XA 2Z56A 3ICWA 2VBFA 3KQPA 3A11A 2YS7A 1UIRA 2FAXA 1SUDA 4RH0A 1RC0A 3ROPA 4WN9A 4ZCKA 2O9JA 4F4UA 2CVOA 4I1VA 3U7QA 4G26A 2L55A 3PDIB 4TYYA 2F3SA 5JD5A 5KHOC 4EVQA 1EFCA 5LU9A 3GUUA 4KXNA 2Q7OE 3NDBB 4AIMA 1AD2A 1PW5A 4PE5B 3QFFA 1V5IA 2J0SA 5C3EG 3WFJA 1PFQA 3P96A 2ZUSA 2D0DA 3T1YL 2MR5A 2E74C 1L7BA 1N3BA 2ILTA 4XT3B 3O4JA 4J7UA 4RV9A 3LQYA 3OP1A 1XXGA 2V4DA 2WHYA 3DV0A 5H3LA 4B6FA 2A5JA 1PO7A 3EUAA 1ZK0A 1I7NA 1Q20A 4XSHA 3NHBA 2AVDA 5IAJA 4PRYA 1FSZA 4IUBS 2FJ0A 4KY7A 3O9VA 2XAUA 4QJ3A 3VYVA 1TFUA 3FWHA 4CMKA 2Z4HA 1V4BA 4B6SA 2IZ5A 2NWGA 1ZXBA 4LGCA 3NEJA 3RVRA 4N0MA 3CLUC 3GNTA 4CV0A 1VG9B 1RQNA 2OV4A 4KFRA 2O2LD 1DBPA 1IULA 3ABRB 5CIYA 5C8YF 1SOVA 1EEID 1QQ7A 3ZWDA 3ZHYA 2O8VA 4XWWA 2X41A 3F9CA 3WOHA 2QGFA 1ZWKA 4XZ3A 4DR2Q 2KMLA 3GK3A 1NQUA 1QORA 3ES9A 4AK9A 4ESHA 2RAFA 4GPD1 4YQYA 4MRMB 1DX6A 1VBMA 2WEKA 3B6IA 1SM4A 3BAZA 1WZNA 3MWYW 1WTPA 3PHHA 1WKCA 3UMYA 2PZBA 3R4CA 3K5NA 4W5JA 4AULA 2QY9A 4H1VA 1CK1A 2P6OA 3W77A 3Q8LA 1R37A 1QVCA 3O1IC 1SELA 5IDWA 1GTMA 1L0XB 1I9GA 5LMUQ 1WG8A 2PL3A 4EFLA 4Z7QB 1U2QA 3LQKA 1ZXTA 1O2DA 4R4TA 2Y1FA 4RM2A 4U2GA 1TAGA 3ICEA 4EHBA 4WWHA 3SEQA 4ZPJA 1AKRA 1FQJA 1QRAA 3DWFA 3PO3G 3CF2A 4A3MH 3LD9A 4LWOA 1SVIA 3I64A 1HTWA 3WSTA 3NIGB 3USCS 5JD4A 3TF5A 4K0KB 4FP9A 1FUEA 4OKSA 4EMBA 4UDUC 3UJ9A 3R41A 3FN4A 4KITB 4MHSA 2ZJ0A 2CDAA 1XZJA 2R65A 3TIIA 4OK3A 5GGYA 1N2JA 3QQPA 2O8FB 4OXYA 2DGYA 3X3MA 3OP4A 1YF3A 1UKCA 3CW9A 1GQQA 3THXA 3BDIA 3WGZA 2FQYA 2OHJA 3O1HB 3I0MA 3E9RA 5CB6A 3DVRX 4HGPA 3TX6A 4GZ3A 5J5AA 2A4MA 5LLSA 3O8OB 4PRKA 2CNOA 3IJRA 4N03A 2FEKA 1GFWA 5NUCA 1KVTA 1GPWB 3KB2A 1J1ZA 4D4KA 4BBJA 5A7HA 3M8KA 4IUNA 2AD1A 5E7MA 1M1YA 2DFVA 4GL2A 1S5CD 3S44A 1YUMA 4KKVA 1Y7HA 4CRWB 3RNOA 4ZARA 4UDYX 4HTFB 3I83A 3BHIA 4LK2A 4ZI2A 4XUEA 3BF8A 2BLNA 4GNXC 1CF2O 4B6GA 1NM5C 1P9OA 2BGJA 1JMCA 3K6JA 4B2LA 2Z6BA 1EWQA 3IAAA 4NAUA 5LJIA 3X1JA 2R6GA 5EOVA 3ACDA 3K20A 4ZVTA 4HVCA 3AH8A 1UXIA 2VF4X 3SC6A 3EGCA 3PXXA 4AKEA 4Q4AB 1KJ9A 3P45A 4EPRA 3EROA 4A0SA 2XUKA 1MX3A 1NSFA 1IEWA 5CX1B 2Z9CA 3K9LA 1AKVA 1DPFA 4NDNE 4LV5B 4DR2L 2PHZA 4PC6A 4UTRA 2CV1A 2J6IA 2Q8PA 4DDTA 4X20B 3NBIA 2F0GA 1ABBA 1W19A 2XSZA 3BOSA 4DN4M 1SROA 3DWAA 1GPLA 4UTNA 4NAHA 3DDUA 5L6LB 1NQWA 1QDLB 3ZK8A 1ZJYA 1K0SA 4RVCA 3GJ5A 3OU2A 2JAHA 4CNBA 3KOJA 4X45A 1YRHA 3P19A 3RUIA 2UUOA 3L1UA 3UV7A 3PIIA 1L9KA 4HFRA 1OFUA 4LPSA 1K06A 3FKIH 3Q0EA 1NONA 5B2EA 5AH0A 1EDBA 5CYOA 5LMUL 4C7BA 3I6QA 2J09A 2WHPA 2H2HA 3TS0A 4F2HA 1RDPD 3KXIA 1C3OA 1KOGA 1IB0A 5IMBA 4RD6A 2QLJA 1UEIA 3JQ8B 1MNAA 1V1RA 1TS2A 1AGXA 3NVMB 4D79A 3DMGA 4LFBB 3P7JA 4M0DA 1WP9A 521PA 1G1AA 2X22A 2J7ZA 3QEAZ 5BWNA 3DVQX 3WLAA 5J39A 1A5AB 3UJPA 5BN3B 1VE9A 1XHEA 4HSGA 1CFZA 1JVSA 1DEHA 4KJNA 4NZMA 4GF5A 4WXPA 1JE5A 3IS3A 4W63A 3B36A 5KQRA 2FQQA 1B8VA 3EZFA 1L1OC 5T7BA 4CTNA 2MJLA 3FIUA 3QHQA 5I45A 2OGZA 3L8FA 5BMOA 5KYXA 1A8HA 3QBEA 3VR2A 1B15A 5BWMA 3TW8B 3T1HQ 3OLVA 3PJDA 4FCTA 1IKMA 1SMXA 4MW1A 1HT3A 4RLQA 2OLJA 2CW0D 1Z3CA 3L2PA 3OJ0A 1LBTA 5LHY1 3S2SA 2M6KA 3CSUA 3Q22A 1Z26A 1OLSA 2OZPA 4XVHA 3FR8A 3GAMA 1JEOA 4LF6B 3TLEA 4ZO6A 2OCIA 5TQ2B 1FYEA 5JOBA 3WSWA 4FB4A 4F6LA 1D2RA 4TVAB 1DPGA 3P0EA 4ZYVA 2ZIVB 4K0KQ 1Z8FA 1ZVKA 2R66A 4S0ZA 2BGGA 4FSDA 1HDIA 4HWTA 1T5BA 3K9CA 1CSEE 1D09A 2P41A 2H65A 3AJ8A 4Q0FA 2VCYA 2Z6AA 4P2GA 3PQ2A 4MWOA 3WDKA 2P75A 2JAPA 4TMWA 3BJZA 2E2HB 2ZUVA 4H18A 1BXKA 3WE7A 2H4XA 3LVRE 3VC7A 3CONA 5JVH3 3FG9A 2C3PA 5A05A 5JQGA 1P4SA 2V9CA 3COWA 3U19A 4M3NA 3S2YA 1SE4A 1YJBA 3VGPA 1ZU5A 4Q1EA 5CFRA 4PPGA 5CM2Z 3VUFA 3ORSA 4GE3A 1YB2A 4I7EA 3QOLA 2WG1A 3A9CA 4YRBA 2HA6A 4IUQA 3LQQA 4K1XA 1BOOA 1FX0A 5A7FA 3BERA 2IOQA 3FLEA 4D0SA 1VL1A 1TLFA 2EKQA 5TS2A 4NL4H 3GVXA 3AFQA 3DUFB 2C4HA 4Z86A 5FV4A 4O5OA 3UOGA 4FUQA 1YZ6A 4FR0A 4NP6A 4MB0A 3N8GA 3NGXA 2ZJ2A 2A9VA 2J9YB 4K3UA 1NTRA 5EXEA 3GAZA 2NU8A 4IVQA 4LDAA 4OJMX 1GARA 5TQ0B 1L5OA 5EIFA 3AUXA 5LN1A 1HT2E 5JQGF 2F4VB 4H08A 3KJGA 3BYTB 4TXHA 3V8PA 6GPBA 3LFUA 3C3EA 3W9YA 1QYDA 4TL9A 3UPDA 3D2LA 3VZSA 1SFOB 4XE5A 1IFXA 2AFIA 1D2CA 4UHVA 2K14A 3T1HL 2HT1A 1U5AA 4YP1A 4G5OA 1G18A 3GTOB 3GRUA 3IV9A 3FHWA 1ISMA 1U5BA 1XGKA 3N0TA 5DHAA 2X9NA 3PJGA 3EQ6A 2JIBA 4L8WB 3RQSA 1NLUA 1OFHA 4UTPA 4RH1A 3ZHXA 2GYVA 1VQDA 3NVKI 5KU1A 4LFBQ 4TZTA 2WJYA 4BJ1A 3TEFA 1EWRA 3AIMA 4WINA 4D9HA 4K0KL 4BP8A 2GOYA 1T10A 3ZHRA 1FYFA 3ACBA 3BDAA 1PH2A 4D9GA 1JDBC 5JG7A 2A7XA 5AW7A 5JSUA 5CV6A 4U2KA 1GUOA 3N2EA 1U9JA 4OVKA 1B2RA 2F0OA 1V1PA 4IDPA 4ZDIA 4O4LF 3O4GA 4KNWA 5KU7A 4I19A 4DA7A 2G4VA 5DX8A 1ZEMA 1MA0A 4AX4A 5DFAA 2IYWA 3VBCA 3RRJA 4LF6Q 1WLSA 4NFHA 4KQEA 3SHLA 3KQTA 5JRZA 1HETA 1Y5LA 1T2UA 4LQLA 4V3CA 1S2IA 2M6LA 1E0DA 2L69A 4G8DA 1FUIA 2HDOA 4X90A 4RGYA 4KAAA 3L2OB 3DDZX 2FSVA 2ZGVA 2PZMA 1EU3A 3NHJA 2OCLA 1WPXA 2HD4A 3Q3VA 4LDJA 4RH6A 3AMVA 4CLEA 1ZSVA 4POGA 4HJ5A 1EIHA 1L4NA 5EE3A 4OQFA 1PXUA 3A9VA 2A68D 1Z34A 3DBLA 1UC5B 4HOYA 3HZZA 4HIOA 5EAIA 3KJQA 3DMNA 1DB3A 1UBFA 5FYDA 4ZTBA 4KQ6A 3NUCA 1Z6AA 1XTVA 3Q3GE 4DEYA 1WDLA 1RBYA 2VDJA 5LVAA 2I6SA 4DDKA 2QMYA 4S1WA 4P7GA 2ZRBA 1NNEA 3PDJA 3DQQA 2AG0A 1TWGH 3F5SA 1VRVA 3S5JA 3IAEA 3CNQS 4JCCA 4OAQA 3DM3A 4DF3A 2OENG 3AVWA 3JQEA 1S1CA 1HFNA 4MQEA 1A4UA 2JDIA 1O6ZA 4JBYA 4H15A 5A1TA 3VKHA 1IYJB 2GCOA 2JGFA 4LUCA 2H08A 1S5ED 3DL4A 3N2KB 3GROA 2H51A 4FYVA 3CISA 3ZCSA 4H7HA 4QQRA 4LFBL 1H8HD 1P31A 1SB8A 3LPCA 3SEBA 1K97A 4N5IX 5T3UA 1HYQA 3E7DA 3J80i 2ZTSA 2IEZA 3VDYA 2NUTA 2F4VQ 1JE1A 1XWEA 1MQ8B 1RSZA 2JA7H 2HYDA 2VP4A 4HDOB 3ABSB 4P73A 1YI2A 3IFTA 4MW7A 3IKLA 4C3ZA 2X2OA 5M2QA 1THZA 1RBZA 1C0LA 1YU9A 3O6VA 3S81A 2ACKA 3WGQA 1F9PA 4ZAVA 3G0HA 3MT0A 4BYMA 1V25A 2Z4SA 4GL4A 2A5LA 2JP1A 3HGBA 3K5IA 1Z6XA 1F38A 3TMAA 4JX8A 5D01A 2O8CA 2IXBA 2JH9A 1NBEA 2W37A 1EX7A 4LF6L 1EM6A 2PUWA 2JANA 3NPPA 1XRSB 1JWMD 2Z43A 4RVSA 4WW0A 3VC3A 2R1ZA 4I4CA 3IMCA 4LFCB 2IHEA 1CUWA 1CUKA 1XD9A 5K7SA 1AFPA 5DASA 4IX9A 2WRZA 4BO2A 3EZ9A 1RAAA 1T6YA 3AC0A 5G3YA 5ISRA 4BN0A 1JSXA 3IBSA 5D5HA 1SQ5A 4OQ4A 2X0JA 1XMPA 1SC9A 2WPDA 1L3BA 2MYTA 2GVDC 3DR3A 2WWVD 3VZPA 4FDBA 3GVLA 3F71A 3CYFA 3RVDA 2WAXA 5DISB 1X54A 4LF9B 2PMEA 5DB4A 3X1YA 1EVEA 4R1UA 1T6XA 2IIPA 1EQTA 5AK6A 2ZUCA 5DRYA 3J81i 1D6JA 2RJOA 1ZS9A 1R3DA 1HR0W 1HWYA 1VQ6A 2LXJA 4NU5A 3U37A 1LTTD 2Y3IA 2WHEA 3GTGH 4ZTUB 2D8MA 1MNQA 3IUQA 4TTVA 4BY1G 1UK7A 3HCAA 4HZUA 4C4TA 3HJFA 3UGTA 1GL7A 5JXHA 3NONA 2H2WA 3D0RA 4N8DA 4F11A 4YV7A 2WVHA 3B1XA 1X6VA 2RGRA 4EH1A 4EHNA 3IP6A 3OZRA 3CW2C 3KTAB 2VA9A 1E8DA 1KZGB 5ARDA 3WJ2A 9MHTA 2F0QA 4NMZA 3VOSA 2DULA 2MO0A 4HUQB 4AW9A 3EEQA 2WTAA 4HX5A 3J80A 1TVKA 3T0IA 3ROMA 2F4VL 3KQOA 1ACLA 3G9XA 4RK0A 3QHPA 4Y9SA 2JLWA 3S8EA 4E5UA 4DBLC 4H7DA 3UUFA 1XEWY 2VB2X 4ZVUA 5E4WC 2XGOA 1ECGA 2X5XA 4CKEB 3FZNA 5B3KA 3IERA 2PS3A 1KP3A 5HF8A 3KLNA 4ECEA 1LH0A 2AD5A 2C92A 5KS2A 3BFPA 4CDMA 3EZ6A 4J7CA 3E9IA 1ZITA 5LZ7A 4QFCA 2P9TA 1T5OA 1KXJA 1TNDA 4MQUA 4US0R 3AF4A 1XVIA 1ZD9A 4JD5A 3OPYB 4BZQA 1U0EA 1T8RA 5EKSA 1WMAA 2HMAA 1U3UA 5I6YA 1E2FA 1XLTA 4RVUA 3GEPA 4O33A 3I01A 5EQTA 1Z5PA 1QPGA 3GIWA 1XNRB 2PT9A 3SU8A 4V0MA 3PDWA 4CI9A 2E0IA 3RVOA 3ELDA 1ZUNB 2B2TA 4BASA 3WDNA 2OUIA 5DWVA 1G20E 2G5TA 2YV1A 1ODKA 3S2UA 3ZI7A 3EVAA 3AF1A 2QXTA 4ZMSA 1TJ5A 1WTWA 1CUZA 3H4VA 4MNOA 2P77A 4XA8A 5L3SB 4YP5A 3KO8A 3D6JA 5IW8A 4HKTA 5JVG3 1GSHA 5C44H 5EIHA 1SKBA 5DP1A 3O4VA 1IAQA 1T3SA 3RVPA 2P9YA 1C14A 4AJPA 4HXYA 2DQ4A 1W36B 3GCXA 4JL8A 1UMCA 4XYGA 3T1OA 4MS1B 1EVLA 1CCWA 4LFCQ 1F5SA 2G9HD 1NLFA 1E1LA 5IHPA 1EUYA 1OA0A 2DKFA 3F6EX 3L82B 4U63A 4OO1I 1US8B 4D25A 3A06A 3W5CA 1S3IA 1PG2A 1KMNA 2CVPA 4IDGA 1NQVA 5FL3A 2YDXA 4FGZA 4QASA 5LLTA 2JJ2A 5JAZA 4C5AA 5IN5A 4WOKA 1E3QA 2GN8A 4DF7A 3RS7A 2J9RA 2C4MA 1NCVA 3SY8A 3K5LA 3IP8A 4LF9Q 1KQOA 1JAYA 3KG2A 4PX2A 4W5QA 1G3UA 1QM5A 2VHXA 3DZCA 8ATCA 3OURA 3BGSA 2HLDA 1XEXB 2UXCB 1FVOA 2O3SA 4HWKA 1Y4ZA 5IJAA 4BQSA 1LKZA 5JAPA 3BYYB 1K63A 5E3IA 1AKUA 3QFHA 2IUYA 3FWYA 5M3BA 3VYWA 4CF6A 1XZPA 2XQGA 1E32A 3DPUA 1XXLA 3TVYA 4JLMA 5KC9A 3CB4A 5LCXA 3ZE6A 4N7JA 4AP5A 4YP0A 1SEPA 1A71A 2SHKA 3JQFC 4RFSA 3CZ4A 1I7QB 4OMUA 1U8TA 2HQEA 2CNLA 5IN4A 4OXRA 3TRJA 3ERCA 4RSRA 1COZA 2G28A 2V7BA 5KNBH 1VPWA 3F90A 4QICA 4FC6A 4KW7A 3B5IA 2UUCB 2RBEA 4PO8A 1YBMA 1Q17A 3ZGVA 3H11B 1LZKA 2PLNA 3GGGA 2YVLA 1MJEA 1HK7A 1Z62A 3N2YA 2J0EA 3N2GA 3RU2A 1NP6A 3NWPA 4DDVA 4KN9S 2JH3A 2ODTX 3BMQA 4BJ3A 8ADHA 2P2LA 3G02A 5FI0B 5C31A 1PLKA 4EG5A 3HUEA 1ZCFA 5IJ9B 2B2UC 1A82A 1PZEA 4UEJA 4OIFA 4KSCA 4JZKA 4U9IS 1UBRS 1OYYA 1RYFA 4NC9A 3MUOA 3BH7A 4MITA 1BQ3A 2Z8YM 4EJ6A 2I78A 3A32A 4LFCL 4BBRB 5JU6A 2O2SA 1I3CA 1CI3M 3BBLA 2IHTA 2NV0A 4BVAA 3ZDEA 1W59A 3PTZA 2ZQZA 5IF3A 1XNRQ 3ZW9A 1TUBB 1NPDA 1Q5PA 3JAME 2W2NA 1DBWA 1U8EA 4MKGA 3DUZA 3M6AA 4OXXA 1B26A 2RE8A 5IE8A 1M6HA 2GLUA 2ZB7A 2C9BA 1KI2A 1BVHA 4LF9L 2X2FA 1MHPA 1TU3A 3FYUB 4MUIA 2W6QA 1ZN2A 5DCWA 5IP9H 2QNBA 5GM1A 1T6NA 4TT3D 5G4KA 2NV2B 4L5TA 2QTLA 2ZWIA 2FWBA 1D0VA 2NVQH 5KPDA 3L3BA 4G81A 2MR6A 3SOPA 2G8NA 4UOQA 5AVSA 2G9UA 2VUIB 3UC5A 1SWVA 2BJVA 3ASYA 3TVTA 1KAOA 1KHTA 4R1SA 3U0VA 4GZ6A 2G7ZA 1NQOA 1Z0AA 4RC9A 3Q3IA 5CBEE 4IF4A 3RFXA 1SBNE 4JBXA 4LCEA 1Y0BA 4BRZA 2ZB2A 4MV1A 3Q1KA 2FZEA 2Q5IA 1QO7A 4Q9JA 4U4AA 4XR9A 2LDBA 3MLAA 1WULS 4DLPA 2QTZA 3Q5DA 1H6CA 4EB0A 1ZYRD 5AW8A 1YMUA 3N52A 2YKGA 4PAQA 3MTJA 1HEIA 2G36A 4P86A 4GI7A 4DAYA 2EV9A 1C1YA 2UXCQ 2GZAA 4MR7A 5JPMC 1M2NA 2CQOA 3D6MA 1WUYA 4IVPA 1EJ2A 3L6DA 1QAOA 4MAFA 2HK7A 2VKQA 4KRGA 4DRXA 1Q1EA 2AG5A 3NAZA 2OO7A 1DBRA 2HLPA 3EDYA 2JGJA 2LBPA 3SIPA 3C8UA 4NJMA 2IHVA 5TV2A 5TEWA 3T1TA 4Y30A 2QU8A 1L4MA 3QXXA 5KVSA 4YQZA 3ZCUA 2CV0A 2IHFA 1QGUB 3FYHA 3PGJA 2BM0A 3TDKA 3VZQA 2YC2C 2RHOA 1VRWA 2ACWA 4M76B 4TROA 1RXCA 1ZGJA 1E66A 2GMWA 2GAAA 4GPTA 5JNVA 3PX2A 1RXEA 3I72A 2UUCQ 3IAS1 4HEQA 2YRWA 2JW5A 4DCVA 1DINA 3R6WA 1S7GA 2C98A 3OCXA 2PUBA 3KVYA 3KKPA 3MJTA 5IFLA 3B3FA 1XNRL 2GJAA 3BDCA 2R7ZG 3RRYA 4GRIA 1XCJA 3I55A 2YWCA 4QUBA 4IOAA 1RWPA 4JOIA 3MWFA 2PX4A 2HW8A 1SIUA 4DSAA 1V8BA 1U8FO 1U2PA 4MDEA 3NIDB 4EMTA 4ERXA 2N1BA 1IJEA 4N3NA 3IULA 1IHPA 1EFVA 3V8QA 3B1ZA 4MCJA 1ASYA 4H0LC 1ZJ4A 2P4QA 4PAMA 3S17B 1QAQA 4X60A 1R0ZA 2OCKA 1PR0A 1OIWA 4WI1A 1HR0B 2I6UA 1X38A 3IUBA 2CXXA 1ORVA 2I66A 2R7DA 1XD2B 3IX7A 1V7CA 3EC1A 4BWGA 4KLKA 2QP9X 2EVBA 2GJ8A 3DCJA 4XDHA 3MUEA 3N86A 4WE3A 5TVKA 4ITRC 4TLMB 3PUXA 1QCBD 2WD9A 3LGXA 5HKOA 2JLSA 3K2BA 5C4HA 3C8ZA 1L5HB 3VHXA 2N3ZA 2Y9MB 2O8EA 5E9WA 2G5PA 3NORA 3OX4A 2XMBA 3Q2OA 1RP1A 4M8LA 4I3HA 3QFCA 4HR7A 1GQSA 5A5GA 1K89A 4LWQA 3PCTA 3ZWNA 4KPYA 3EJ6A 3TNLA 4AZSA 1R4AA 4Z0TA 1E7MA 4F2DA 1M6NA 3LL4A 3AU7A 4HQNA 2WV7A 3WBBA 4KFSA 2O0JA 2Q5OA 3I53A 2ZEJA 4RYLA 4WZAE 1DAFA 4Z2YA 1TQ4A 4YY3B 1XZGA 2I67A 2UXCL 1KR2A 1IMJA 2WSLA 3PVZA 4AECA 3ZWQA 4LZJA 3EVFA 3LIPA 2JNWA 1ZC3A 2BFPA 4KPFC 3IDSA 1UK9A 3TI9A 2PCLA 4MWZA 2R25B 1ZGGA 5T1GA 2NX2A 3OCCA 2UVDA 3QM1A 4HVAA 1UQRA 4RENA 1E3IA 1MVLA 3GQBA 1HDEA 1Y69U 4QCLA 1SXJD 3GEBA 3INGA 4GOOD 3K92A 1L1OA 2I2CA 3Q7EA 4RU1A 1N9GA 4KK3A 1KETA 1OFVA 4IQ4A 4H4EA 4O2AA 4QJ4A 5K4AA 1EOTA 5U9CA 5B3LA 3KM0A 1MR3F 1AW7A 5HCUA 1J9ZA 1Z35A 4V1CB 4ZQHA 2UUCL 3RADC 2GXUA 1ESCA 1AUZA 2P7IA 4UBNA 1YQ9A 2IY9A 1HHVA 3UE1A 4CN9A 1G8SA 4B4DA 1MB4A 2H16A 3CCUA 1T24A 4BO3A 5BSEA 5DSZA 4FBMA 1A1VA 3PJRA 1VQPA 4J3NA 4RKWA 4EYKA 2HC9A 3ZUGA 2LGJA 1GUSA 4A0GA 3TAUA 4GC9A 4UBJA 1TA4A 4RYDA 3PHCA 2X3UA 3DZIA 5CIWA 3NH6A 3NIFB 1ISSA 3FUXA 4PG4A 1J8FA 4C3JH 5AW5A 2EXDA 1OU4A 5BOVA 5C9ZA 5K0FA 1EA7A 1IVNA 1I80A 4CMHA 5F1KA 2ZJ6A 3T5AA 1KH2A 3L0IB 4EGJA 2D59A 2I1WA 5KYUB 1AHIA 4E5MA 4KVZA 2K5DA 2ZANA 1QHHB 4J0FA 3WGGA 4UHFA 2QQEA 3GDWA 1VQ5A 1ML0D 3CX4A 2NB0A 1DCKA 5FA8A 3IP9A 4PQXA 1I1HA 4XFKA 2FEMA 1SCAA 1SRUA 3FPPA 1MRZA 4UVIA 3RVSA 5AJXA 3NHFA 3BIXA 4P4SB 2BOSA 4EGVA 4GX1A 4N0EA 3I76A 2H4HA 5EHZA 3HBFA 3P9YA 1K3FA 4A3FB 2COUA 1Q77A 4NHOA 4EA6A 5KJFA 2P40A 1ORDA 5CCEA 1Z8HA 3FMFA 2JZCA 3HOWH 2UZ1A 4CL8A 3AP3A 4WFIA 1Q6ZA 1TUIA 2IYTA 1UDWA 1E7WA 2JFOA 1N6DA 1BFUA 4MIYA 3K09C 3NC1C 4BNWA 2ZYWX 4RQAA 1NVUQ 1GTJ1 1YAHA 1Y42X 4OV6B 4JXJA 3GO5A 4QXPA 3I09A 3TL6A 2A7QA 5MDHA 3DJFA 1MHTA 2QDKA 5IT9E 4HH1A 1HR0Q 1NV9A 3ER8A 3Q7RA 3G5AA 3ECAA 2XRFA 2HLDD 1F4VA 4HJRA 4BV3A 4D98A 3RT9A 2IPLA 5FJ8G 1VL0A 4YASA 2RGWA 2REOA 1Z08A 3JD1A 5JYEA 3Q8KA 1P3JA 5JCPA 3NPAA 4J2OA 5TNXA 1TLLA 2DERA 1U9IA 2D0OA 3DFKA 5BW8A 4J4TA 3KTOA 1V3TA 1KYYA 3VOBA 1GKUB 8AT1A 1L7PA 2LS01 3QLUC 5LQSA 4A8TA 2OK7A 2M00A 1M5TA 3UMGA 1M6YA 1R64A 3SS8A 2QW0X 3HS3A 4WNIA 1XEFA 4YY3Q 4GLAC 1TY0A 1IN5A 2GBLC 3CB2A 5KTRA 3ZE7A 2M9VA 3BTUA 4BFZA 3K80C 5SY6A 4IKEA 2FCRA 5T57A 4TL7A 3AJEA 1JDPA 1UR5A 3TEJA 1B8UA 4MRRA 4LZLA 2RGDA 4KDCA 3TLBA 1JI0A 3WDLA 3IAXA 5B4VA 2PX3A 4L8FA 2J3EA 4FE4A 3MLBA 2LCQA 1WMFA 3V7FA 3X2SA 4E51A 4C7VA 2J9XB 5KEEA 3FRIA 4V0SA 2JVJA 3EXIA 1XLUA 4YR7A 2PUAA 2GNPA 2W8ZA 3BTSA 4Z4CA 1BX1A 1TCAA 4C7OA 3U80A 2B4AA 4A3LG 4NCHA 1ODLA 2H31A 5JXJA 4S24A 4Q7MB 3P0HA 4HPXB 3U7HB 4C4ZA 5EJ9A 2XBLA 1FDRA 2OWEA 3L9AX 4DIDA 1FFGA 4DR3B 2BFFA 3PCRB 1NW9B 2JA8H 4NU0A 4EDHA 5I7SA 3E3LA 3QVXA 3OPOA 4PGHA 2ZRJA 1E99A 5C4ZA 3D8HA 1YACA 3R9XB 1WOYA 1G38A 1VL6A 4EAAA 3ZYCA 5AUQA 4AZ0A 2R4QA 3KEOA 4NNPA 4O2RA 4A8PA 3AF2A 3KNZA 2FW9A 1LK5A 1W6JA 5K3CA 2C94A 1G4HA 3DOHA 4OHYA 4G36A 1UWVA 2EVWX 3C4JA 4YALA 3SGLA 3CLUD 2B39A 1H1LB 5HMMA 1E1NA 1WTQA 3K4HA 3EFOB 1HR0L 1V37A 1JYFA 3P9IA 4LGVA 1F12A 1AUXA 1HC7A 4V0NA 1UZAA 2ZR9A 3ZY5A 4M1YA 3AQ4A 5ALFA 4QO8A 4KIJA 1VIAA 1LQTA 2VB3X 2R97A 3LCVB 1VSUA 1CRZA 2XTIA 1EE1A 4AUKA 4TMFA 2PIDA 4KODA 3THWA 1DT3A 2FRDA 1E1RD 4UHJA 3EZGA 3I90A 1X55A 4TWAA 1VCIA 1NKTA 1TO2E 5DM4A 2YXLA 1L5FA 1EL0A 1OV6A 4GPZA 3DQZA 4AZ3A 4R4JA 1DFHA 4OG2A 1GGJA 3B5JA 5H59A 3ORRA 5HCNA 4GMGA 4JLVA 4YY3L 3RRXA 3ZY6A 4PG7A 1W93A 4TTRA 1T8WA 4U8GA 2VJKA 2DHDA 1N5DA 5EN4A 4N6OA 5JJIA 2WU3A 1RWWA 4RHRA 2DHQA 4F92B 1KGSA 5DRTA 2NN6H 3SZUA 4JEMA 5JNLA 2XWQA 3CWQA 1DC3A 1Q16A 2HPZA 4BV9A 5KOJB 3ABQB 1IMOA 3C5WP 5EKKA 5DTJA 2PRKA 1L1FA 3BJRA 3NGMA 1DJMA 3VISA 3FPHA 3OETA 1VMPA 3F6SA 2D5LA 2D0PB 2V65A 2XVAA 4P81A 3ZY3A 1RJTA 421PA 1ENYA 4U7TB 1B7GO 1JQAA 5LA6B 3WO0A 1JX6A 2ZTHA 4JLKA 1KK0A 1BCRA 4E03A 1E59A 1JI3A 2Y1LA 4MQFA 2IDJA 3D1JA 4CF7A 4XVQA 3LUCA 1E2GA 4MW9A 1LD3A 1WJJA 4AY4A 3OPNA 1Y37A 1WCMB 2H4JA 4GQAA 1PHRA 4Y7NB 4JGIA 1QHIA 1JIQA 3FFWA 3PUYA 3SMQA 3OMWA 1EUZA 3WK6A 4MR8A 1E6UA 1ATZA 1KOLA 1REQB 4FQ8A 1K08A 1XNJA 5TEVA 1CT1D 3KDPA 3DBRA 1DXHA 3LI2A 1W6RA 4P98A 2BJHA 5C8YA 3LAWA 2GARA 5CTJA 4DR3Q 3A3NA 3T3NA 3PUWA 1CQIA 2OTCA 3KR0A 2DUNA 3QKSB 1FP1D 4QDXA 3I3SR 2YICA 1R1DA 1WKVA 3Q10A 5ANRB 1IBMQ 2BBSA 1LUAA 3CUKA 5CEJA 1WUKS 5D2CA 3VU0A 4C08A 5AVVA 1PJLA 3EH1A 4YAWA 4J0EA 1XAIA 4IGAA 4B4UA 4TUYB 2CB0A 5ULLA 2IPNA 1CXZA 1IPEA 4PZ6A 4E46A 1C7JA 5A4AA 4REOA 3DHNA 1M2FA 5SZHB 5G1NA 4OQZA 3USES 2IYPA 2UZ0A 4OWXB 5K4HA 1YJAA 1I6MA 4JJ6A 3MIIA 2F17A 4TTTS 1VQHA 1FRFS 3IRUA 3COPA 2HZBA 4HEJA 3UW1A 4ZGGA 1JPJA 1K66A 2TMKA 4JLAA 5AM0A 3U1VA 2ISCA 3MJEA 1C3LA 2IEYA 4YFYA 5AVYA 1D2GA 1V8OA 2D1SA 2ZVJA 5D14A 3OOEA 4X8OA 1GCGA 4JXZA 1HA6A 4TV8B 1QYVA 1ZIXA 3EXG1 1Z0SA 3QENA 5A3QA 1JR3D 1C0AA 1KORA 2QBYB 3PC6A 2EW8A 2GWHA 4U7FA 2HCCA 1N2IA 2V3VA 2HPAA 1PH7A 4M9QA 1S2OA 1SXHA 4DUPA 4IDBA 1NUAA 2IKQA 3IIIA 1WD7A 3IDOA 1CKNA 1L8AA 2B25A 3K1AB 4TRJA 2IYVA 2BTEA 1UAAA 3BE8A 5KTYA 4M0CA 1KWGA 4Y2TA 5FLMG 3CXCA 3T1HB 5CV8A 2R1UA 4FJ1A 1KZ4A 5IIFA 1B1CA 5B6PA 2BH8A 1VKJA 1IN8A 4AFNA 5IM5A 1H8HA 1ZD5A 3EQ2A 3F1KA 1B7YB 1HY3A 2YUIA 3TRZA 3T52A 3ADCA 3MYRA 4CCSA 3SDSA 1MSHA 1PFMA 1XQ6A 4B71A 3PHBE 3WTBA 5IG2A 1C1HA 1TQOA 3TEHB 1VS0A 4ZA2A 1GV0A 3HJTA 1N8NA 1EWTA 4GN5A 3EVDA 3RU9A 4OLHA 1FMJA 1XZAA 1G19A 4BP9A 2K6AA 2XF8A 4AMZA 5IOCA 2ZWOA 3L3OC 2Q28A 4LIPD 4NCXA 2LDXA 1U4RA 3SZOA 1UOPA 2N88A 4YUVA 4KXLA 4DR3L 1MT3A 1WETA 2WB1B 1V5EA 1S0UA 3EEOA 2ZYGA 1PBTA 4OHPA 1BDOA 1SCNE 4U2CA 2ZYAA 4R40A 4QOSA 3A8IE 5COAA 4DV1B 3UBTA 2WKWA 2CSXA 1M7GA 1JOKA 5I3ZA 2Z6KC 1WYDA 4KGZA 3MVEA 2K1BA 4Q3KA 2FWRA 3EULA 5A3JA 4ARZB 1U11A 3W5DA 2GGSA 4LRXA 5DCLA 3GCZA 3R23A 3KX2A 1LS6A 2IW1A 3UI2A 2B63G 3VYSB 1IZ9A 3R09A 3NALA 1DOAA 1U0JA 3E9CA 3WRWA 1DVRA 2HHLA 4J1MA 1N2SA 4QODA 2QZSA 4KTVE 2HIMA 1D1TA 1CY7A 4KLCA 3Q15C 3AYXB 4XUDA 3D6TB 3GLHE 3OIYA 4G07A 1R6TA 3ANTA 1ENAA 4A3JG 4B9AA 4G7HC 3PFGA 5FPYA 4YIJA 2BCGY 2QW8A 4A5OA 3L0SA 5E4XA 3NTLA 4KO8A 3H94A 3GFPA 4HADA 2IZ6A 2O8DB 2YN4A 1GCOA 2YWRA 5KREA 1XJ0A 3D9QX 1P4HA 1HEYA 1X86B 3CHYA 2A73B 3EMVA 4EJSA 3L9WA 3H84A 1SYBA 3NWSA 1YC5A 3ROGA 1ZW6A 5LPNA 1C4XA 2VUHB 3I2FA 2EWWA 4K5XA 2P2GA 1I4TD 5BORA 4QT0A 2WJVA 4RMFA 2M2IA 1VBFA 3WK5A 1PK7A 4DA2A 1V4VA 3PT5A 5FKJA 1EZ4A 2OGSA 3MZ0A 1D7QA 2O2CA 4OFWA 4YJHB 3PD1A 3ZD9A 1VP9A 3QJ5A 2I4OA 2RKOA 3T5PA 5K5PA 4CTJA 1ZD3A 3AR9A 2P2CA 3RNLA 2B30A 3ILVA 5KYGA 5BNWA 2HNKA 3AB9A 5DTRA 2W8BA 1PV1A 4Q7QA 3QUBA 4TLAA 4DCTA 5LUAA 2GKOA 2QMHA 4PC2A 5KEIA 3AKYA 4FJ2A 2DG2A 1I2AA 1M8FA 1E4YA 1G3QA 1GGHA 1TIKA 5ADVA 3JZMA 3NEYA 4UBKA 4AN0A 2F0EA 4U6QA 3AEKB 1M90C 1W4RA 1SN7A 4OP1A 5ALWA 4JVNA 3CLKA 5FWNA 4NENA 1E5QA 3E9QA 4C2AA 1RLOA 2Q3BA 3C2QA 1ZQ1A 1C0EA 1CF9A 1CZWA 3U6KA 3BEDA 2HBRA 5I7RA 4R9SA 4RHCA 2IGTA 5BW4A 1I4QA 1NP3A 2R8PA 4L6IA 3O73A 4AVYA 2VDPB 4XLZA 1TKBA 4GE0A 2XYRA 1PS0A 1PHPA 3EXFA 4CQMD 3ICQB 4X64B 4DAEA 2VR1A 2QT9A 3NYQA 1XF1A 1RAHA 3OY7A 2PUCA 3JYQA 3U4ZA 3NPMA 4BQPA 1BS2A 2RBKA 2AQ8A 4ARVA 2VFAA 5AHRA 3QVOA 1RKNA 3S6JA 3E6ZX 1IG3A 3ONWA 5KKAA 3QYFA 4NJEA 2BR4A 1OPXA 1D04A 2EKBA 4BNUA 2WT4A 1POWA 2K5UA 1PD1A 2DAPA 2IDZA 2LP4Y 1WEHA 1HQYE 2CGEA 4L8KA 4A10A 2G6BA 4DV1Q 3ILXA 2ORIA 4QMGA 2MNAA 2E2HH 3ILHA 4I1RA 5CBKA 4E4TA 5A9SB 1PR9A 2CMHA 2NZJA 5B7PA 1QGAA 4A8HA 2Z4TA 4DJTA 1E7RA 3LUBA 2OFXA 2ODWA 4HDQB 1HG0A 3DF9A 5BN5A 3UWKA 4U6SA 3UK0A 2N55A 4M1UB 5HIJA 2FPOA 2HAEA 2OZLB 2DGDA 4MS3A 4YR9A 3NTXA 4P4NA 1GSOA 3F0TA 4O8ZA 1FYWA 3F5DA 3ZVRA 1YONA 4TSKA 2H4YA 3C6QA 3H5IA 1ENZA 5B3JA 4R4IA 3F2CA 1NUUA 4PTLA 1SKYE 1RYBA 1S6YA 2WNSA 1E3PA 5BWCA 1KXLA 1N2XA 4ITUA 1W5TA 1C3VA 3ZU3A 1DRKA 3HEBA 3GJRA 3M4PA 2GLXA 3SYLA 4DT1B 4DM3A 1SYCA 4FEYA 1NKSA 4OQXA 1XOIA 5FO1A 4KKTA 2C5HA 4OHBA 2QUIA 4Q05A 1STAA 1OXMA 4GDMA 1X7XB 3FTFA 1ZU4A 1V0EA 1S5FD 1Y5IA 4CDGA 3RNUA 1JYSA 1BVRA 2YY5A 2FI1A 2PEYA 5ER9A 2E2WA 1M1NA 5DYTA 3Q0AA 5DCUA 2ZTUA 2AX4A 4O4LA 2BMEA 1USUA 2UAGA 3DZBA 3BSFA 4HJ8A 4HPJB 3MQFA 3QEJA 5E3JA 5FPQA 2XNJA 5A4IS 5KOHB 4FIDA 4R1JA 4RMJA 2DX7A 2XKBA 2JLAA 5J4LA 2BE5C 4DXGA 4NXNQ 4RD3A 2F1IA 3QG5A 1EIYB 2M32A 2FWPA 5DN9A 2NU9A 4WBNB 4H60A 5HF5A 2H2GA 4MDFA 2EX1A 2PH7A 3P97A 2VUTA 2GERA 5K8LA 4B76A 4CLXA 1TY2A 5CCDA 4JHLA 5KYYA 2F55A 4Z4QA 3HKSA 2HD3A 1TCCA 3DT8A 4M86A 5CDFE 3W1VA 1PTOB 1BDJA 4H6XA 4ETMA 2WMDA 4QQBX 4UTVA 4F4IA 2AEFA 3RYIB 2L2QA 4CLOB 4B6QA 3KZ1E 4DV1L 5FUQA 3AI2A 3W7VA 4OLFA 2BC9A 4BBSG 1ZDMA 4A9AA 2PO4A 2NU7B 2KVMA 3KFVA 2G80A 3CQ9A 2I4MA 1WOCA 4BEVA 4A6EA 2JHCA 4QGBA 2JAUA 3L05A 4X64Q 4AJ4A 1I3KA 1Q7BA 5K3BA 3G8YA 4UC0A 1FNBA 4GKBA 3GLSA 4UMFA 3WTCA 1FP2A 3DTTA 5AHXA 1VQMA 3BXFA 1G5IA 4NNJA 4M9XA 3C3XA 1KS2A 2VTDA 1YJ8A 1HI9A 3SYNA 1TVXA 2NVTB 1TX4B 3NJRA 5FWXB 5BSWA 4TT3A 4WJKB 1DEKA 3GVJA 3ENVA 2ZB3A 3RC9A 4B3DA 3SVTA 3O95A 4PPQA 5ALDA 4F56A 1CA6A 3BRQA 5JSKA 2JD0A 4N9PA 3MCAA 3RHFA 3PNPA 4HDNA 3DLHA 3UJHA 5F7OA 1BE6A 3W4KA 3FUTA 1EB9A 4MTNA 3K05A 4ZVPA 5GJWC 3LZ6A 2F1KA 4B3TB 1N5IA 4G4SP 1SJED 3QF7A 4FF2A 4MVWA 2BFOA 2J9FA 3EJWA 5G1OA 2HDHA 3I2IA 4EGCB 3KZNA 3B9BA 3E6AA 2C8VA 2LR0A 5ALUA 2FB9A 1TA0A 2AQ2B 3K0FA 4NK5A 4PX5A 1SCIA