4JC0A

Crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
432
structure length
424
Chain Sequence
RVGIKVLGCPKNEADCEVLAGVLREGGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSFVDAKDQYGYKLVVKGCLVQRYYEELKKEIPEVDQWIGVADPEEIANAIETDLVPDRYRKRIDLEERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Fe-S clusters catalyze sulfur insertion by radical-SAM methylthiotransferases.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Ribosomal protein S12 methylthiotransferase RimO
total genus 124
structure length 424
sequence length 432
chains with identical sequence B
ec nomenclature ec 2.8.4.4: [Ribosomal protein S12] (aspartate(89)-C(3))-methylthiotransferase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00919 UPF0004 Uncharacterized protein family UPF0004
A PF04055 Radical_SAM Radical SAM superfamily
A PF18693 TRAM_2 TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jc0A04
3.30.750.200 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A03
3.30.750.210 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A02
3.40.50.12160 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jc0A01
3PUXA 4DV1Q 5IWAL 1R9TH 3HOYG 4DR6L 1JT8A 1UE1A 1KD1C 3J80i 1RIPA 1XPUA 2N78A 4JI2L 1MIUA 1WCMH 5H1SE 2MFIA 3PV0A 3D31A 4A3IH 3K8AA 5GAEC 5C44H 4A3EH 3T1YL 2VUMH 3M4QA 3L7ZC 2E5LL 4XTCS 1X3EA 1JMCA 4AYBE 5JEAJ 3HOUG 5K36G 4DUZL 4MZ9A 4LF5L 1XNRL 1IBKL 1L1OB 1PH5A 1SRUA 2MO0A 1VQFA 3J81c 1PH6A 3CF5A 3UDFA 4LFAL 5GROA 3AFPA 2RHSB 3M85A 1SLJA 4LF7L 3JC66 3RN5A 3EBEA 1VQEA 1LYLA 2E8GA 2EIFA 4P75A 3NELA 2Z6KA 5DLQE 5EAYA 3J81j 4A75A 3CCRA 4DAMA 2JEBI 2E2IH 1B8AA 2ASBA 1IXRA 2UXCQ 4DV1L 1KQSA 2MQHA 3STBD 3PO2H 2I0QA 5C0XG 3G6EA 1HNWL 2K5HA 4YHHQ 1E24A 2PQAA 4TQUS 2YTYA 4DV7Q 1WYDA 2YTVA 2ES2A 5FLMG 3CW2C 2R7DA 4OWWB 3JAMi 3K0XA 2B3GA 4GOPC 3UDGA 3HOWG 2IY5B 4UP8A 2ID0A 4MTNA 4DK6C 1BKBA 1UE6A 1YEZA 4X65Q 1Q86C 1Z47A 1VQ5A 2E2HH 3ULLA 1PVOA 5M3MH 2Q2HA 2ZJQA 2VY3A 1PH9A 2NVXH 4BY1G 1XMQQ 2GVBA 1IYJB 1FGUA 1N32L 3PO3G 2LXKA 1S40A 4C2MH 5HGQA 3GO5A 1QVCA 1WJJA 3I2ZA 3I4MH 4BBSH 4H02A 3MXNB 4X66Q 4UPAA 2PNHA 1VQDA 3FKIH 1XNQL 4JI7L 4O0AA 5LMNL 4HJ8A 1E1OA 2NVTH 3PUWA 2CKZB 1L1OA 2F3IA 4LF8Q 4AQYL 4A93H 1I6HH 4KHZA 4NXNL 3ERSX 1KRSA 1Q1BA 1VQPA 2Q2TA 4JBMA 4GOPA 2FXQA 3PGZA 4JYAL 4GNXA 3CD6A 3S1RH 1N34L 2CQOA 2PI2A 1OXTA 1TWHH 1X54A 5IP7G 2JA8H 1I94Q 1TWCH 3NENA 1SR3A 2ZTCA 4JI1L 3F2CA 4DV4L 4DR1L 1YI2A 2OWOA 1VQOA 3J80c 2VUMG 1G6PA 1CUKA 5IYBG 4B3RQ 1NMGA 2Q2IA 1EIFA 1IZ6A 2Z6KC 1JJ2A 4JI3Q 1D8LA 1E1TA 1BBWA 1CSPA 2YYZA 5ELOA 5GAGC 2Z0SA 4JV5L 2EXDA 3CPWA 4GNXC 1N33L 1KIXA 4LFBQ 3U4ZA 1NTGA 4Y7NH 4JI4Q 2NVQH 1VQKA 3AQQA 4FDBA 3KF8B 4BXXH 1GO3E 1IBMQ 3AYHB 4DV2L 4POGA 4JYAQ 4GKJL 4C3JH 1UE7A 1CKOA 3TEHB 3ICEA 4EQ5A 4LF9Q 4X6AH 3CCUA 1VQHA 3F1ZA 4AIMA 3WWVA 1C9OA 4RMFA 3RLOA 1TWFH 4R4QA 2ZJPA 4JI0Q 1PH4A 4DAYB 3HOVG 5FLMH 1XNQQ 5IT9c 1KXLA 3E9HA 1MKHA 5C4JH 2R7ZH 4P74A 4LF4L 2R93H 5LMUQ 4IOCA 1XTDA 2EQSA 2UUAL 5IE8A 2F4VQ 3OYYA 3CP0A 1A0IA 3A0JA 3E0EA 3A5UA 1B70B 5IYDH 3HOXH 4B3ML 3RNUA 2Y0SE 2PI2E 2F4VL 1VQMA 3M4PA 2JQOA 3T1HQ 3I4MG 3S1NH 1U0LA 4BBSG 4JV5Q 4A3LH 3L0OA 2NVYH 4OWTB 2UXDQ 1LTLA 4DV4Q 2VQEL 4DUYL 2NN6G 3A74A 3PIPA 4IFDJ 1YBYA 4J15A 4LFCL 1M90C 4L5RC 4IFDG 2E2JH 2Y0SG 4A93G 4JI1Q 2OTLA 3TREA 3HKZG 1LUZA 1SFOH 3CC2A 3EN2A 4B3SQ 4OX9Q 4P72A 1VQNA 4GLXA 1VQLA 3G71A 4A4IA 4JI0L 1K8AC 3HOWH 1V1QA 4B3TL 3M4OH 2CCZA 5GADC 3CMEA 4JI7Q 5IP7H 2V1CC 2AWNA 1EUJA 1PH2A 2JA5G 2UUCQ 1K8GA 4A3BH 3SGIA 4PMWA 3OW2A 4A3CG 3NBHB 1HNWQ 1PYBA 1VQJA 4R4CA 4PZ6A 4LUOA 3STBC 2LSSA 1I94L 4A3FH 1K0RA 1WOCA 3DM3A 4YY3Q 3CCQA 4DR3L 1N36L 4DR4Q 4OWXB 3I4NH 4JOIC 1GVPA 1Q8KA 4QIWE 3KOJA 3F2BA 3CC7A 4DV0Q 2B29A 2UUAQ 2HT1A 1CKMA 3F8TA 4BXXG 4A76A 1SMXA 1C7YA 1EQQA 4B3SL 4OX9L 3FP9A 1K3RA 1WFQA 3KJOA 1J5EL 4DR6Q 4AYBG 1PH8A 4DV6Q 1GKHA 3KDFA 4K0KL 1CKNB 3J7ZC 1I50H 4GN3B 5C4XH 4DV7L 4OO1I 3PCOB 1H95A 2K5VA 1DGSA 5JJKA 4R4TA 1KRTA 4IOAA 1J6QA 2R7ZG 4HJ5A 1IL2A 4NPSA 5GAHC 2HHHL 2NZOA 3ER0A 1GD7A 2IX1A 4YY3L 1N36Q 1OTCA 4A3JG 3PUYA 4LF7Q 2ZM6Q 4KLKA 1FVIA 4JOIA 3H3VI 3GDEA 3ZJYC 1PH3A 4JI6L 2Q2UA 4Y52H 1VQAA 2RF4A 1Q46A 2OQ0A 5FLXc 1KL9A 3PUZA 1XMQL 3T1YQ 2VQFL 1SROA 3CMAA 4QL5A 1EWIA 4JI8Q 1PA6A 4HIMA 1C0AA 3K7UC 3AFQA 5M3FG 1YJWA 2JEAI 5C3EG 1IBLQ 3OTOQ 1XMOQ 2A1AA 4A3GH 4HJ7A 1I3QH 1PYSB 2K14A 2CFMA 1J5EQ 4K0KQ 1QUQB 1EOVA 5IWAQ 2L15A 1W3SA 1OXUA 2NZHA 1BBUA 4GNXB 2UXDL 2K52A 1MJEA 3GTQH 2ALYB 2B63G 4JI8L 2MNAA 3CCVA 3TS2A 2CWPA 2I5HA 4LW1A 4JBKA 2OCEA 1Q82C 1N33Q 4WJ3M 4HJ9A 4P73A 4POFA 1VQ9A 4DUZQ 3K7AH 2KHIA 4A3CH 2JA7H 3I4OA 2ZM6L 5IY0A 4YCWA 3CAMA 2BA1A 1FJGL 2E5LQ 2I5MX 3BU2A 1AE2A 3CCLA 4OONA 1L2FA 4YWKA 2AKWB 4YCVA 1FL0A 2RCNA 4LF6Q 3CC4A 2KCTA 1G291 3TQYA 4QGUA 2AHOB 2C35B 4LF4Q 2BH2A 4QQBX 3AEVA 4GKJQ 4LWCA 4JC0A 5ELNA 3A5ZB 5J3BA 4LF6L 3PSIA 5C4XG 1AH9A 4GS3A 4JI5Q 1VQ7A 2HIXA 4PZ8A 1SN8A 1VQIA 4A3IG 3GTMH 4A3DH 1VQ8A 5C44G 2VQEQ 3U50C 4DUYQ 2PQAB 4DV5Q 3ULPA 4A3EG 4BY7G 3H15A 4BBRG 4LFCQ 1EYGA 2K5NA 4XIGS 1TXYA 4APVA 4JI3L 2R92G 2JA5H 4A3BG 1PHJA 3S24A 2UXBQ 1X6OA 2A8VA 2H5XA 1Q12A 4LFBL 4LFAQ 3DLLA 1Q1EA 5IP9H 1HR0W 4UP7A 1K9MC 4GKKQ 1X3GA 2N49A 2UXBL 3UDIA 3BZKA 3GTPH 3TS0A 3I4NG 5BR8L 2D0PA 1XPOA 4GN4B 4YWLA 1Q81C 5FJ8G 4OXPA 4JBWA 3OTOL 1XMOL 2R6GA 1YHQA 5M3FH 1K83H 3K80C 5C3EH 4YHHL 4IPHA 5M5YH 2NN6I 1XJVA 3E9IA 3G48A 4O2DA 2VQFQ 1EQRA 1Y1VH 1YJNA 1B7YB 3W1BA 3CXCA 3RZOH 4IJLA 2YTXA 1EIYB 2WAQE 2R7FA 3LGJA 3U4VA 3CCEA 1HNZL 1N8RC 3F2DA 1ASZA 3J7A5 3TRZA 4JI4L 2AWOA 3IRBA 4DPGA 1NY4A 4R4IA 4X62Q 3NEMA 4GLVB 3HKZE 1X3FA 2QGQA 2IX0A 3HFZB 4A3MH 1JJGA 4NXML 1Y1WG 1TWGH 4IPGA 1T9HA 1FJGQ 4PG3A 1YVCA 5E7NA 3K81C 1VQGA 2WP8J 5BR8Q 2IHEA 1A8VA 3CCJA 1X9NA 2YU9H 4QJFA 2ATWA 1YHAA 3MEFA 4A3KG 4DR1Q 2JA6H 1E3PA 4GKKL 1Q7YC 3I56A 1X65A 1HZAA 3ULJA 4B3RL 3GTLH 3FHWA 1D7QA 5LMUL 4IO9A 5JJLA 2WAQG 5AJ3L 3W5OA 3HOZH 1P8LA 2IHFA 4NXNQ 1MJCA 1N9WA 1OXSC 3H0GH 3PF4A 3M3YH 2HQLA 3S2DH 4A3GG 2UXCL 1HR0Q 2WB1G 3CCSA 2ZTEA 1VQ6A 1Z9FA 4A3DG 3KF6B 5LMNQ 2UUBQ 4LF9L 1I5FA 2LXJA 1PH1A 3GTOH 2I5LX 3GTGH 4X66L 4AH6A 1HZCA 4LF8L 2B63H 3HOVH 3VDYA 4JBJA 1QUQA 1AE3A 3BZCA 3CPFA 5JEAG 4BBRH 1VQ4A 1YJ9A 1XPRA 1HNXQ 3GTKH 3G4SA 2R93G 4X64Q 1M1KC 1KAWA 1UWVA 1XNRQ 4DR2Q 1P16A 1JE5A 3H3VH 2JA7G 5IP9G 3HOXG 1UE5A 4R1JA 2HIVA 5M5WH 4X65L 2K50A 1TWAH 2HHHQ 4IPDA 4B3TQ 3M7NA 1JJCB 3B6YA 4HJAA 1W2BA 4UP9A 1HNXL 4LF5Q 2KHJA 1BVSA 1HZ9A 2WFWA 1PH7A 2BH8A 5IYCG 1HNZQ 4X64L 2RHQB 1NBWA 2OQKA 1EFWA 5LMNW 4KHPQ 3U58A 1Y1VG 1L1OC 1X56A 4DKAC 5GQOA 1HR0L 1VS0A 1YNXA 1OXVA 2UUBL 2CWAA 1QZHA 4BY7H 2QEXA 4PZ7A 4MNOA 1IBLL 1CKNA 4LUZA 4P71A 3KDFB 4A3MG 1ASYA 4KHPL 1E22A 2R92H 1YZ6A 3CQZH 1S3OA 1UEBA 4JG2A 5IYDG 4C3HH 2JA9A 3HKSA 4ME3A 2VW9A 4A3KH 3S1MH 2JA6G 3S17H 1PFSA 3GTJH 4A3LG 5JJIA 3RLNA 2UUCL 3UE1A 4DR7Q 2D62A 3S2HH 5HY6A 4IFDI 2JJQA 1NMFA 2D0OA 2VZAA 3EIVA 3RR5A 4X62L 4HIKA 4A3FG 5FJ8H 1VQBA 1X55A 2JE6I 2OTJA 3H0GG 1U5KA 4C3IH 2A19A 3KFUA 2F52A 2VS1A 4BA1I 3KJPA 1GM5A 3HOZG 4LUVA 1IBML 4L5QA 4JCVE 2K75A 2K4KA 4NB3A 1K73C 1WCMG 3HOYH 1YITA 1QZGA 5AJ3Q 4IPCA 5C0XI 2VL6A 2XGTA 2ZTDA 4DV6L 2N8NA 2DUDA 2MO1A 3J81i 4DV3Q 4QY7A 3PIOA 3HOUH 3KLWA 2QA4A 3I7FA 1Y1WH 4HIOA 1YIJA 3RZDH 3S14H 4DV0L 4WJ4A 3T1HL 4NXMQ 1HH2P 3S1QH 2JK8A 4DR3Q 4DR4L 2KCMA 4A3JH 4LNQA 4YWMA 4TVAB 4DR5L 1IBKQ 4DR2L 3I55A 3PUVA 1LM0A 5M5XH 5IYCH 2UU9Q 1A62A 1S72A 2YV5A 1E7ZA 3FKIG 3JAMc 5C0XJ 4DV5L 4AQYQ 4DK3C 3CCMA 4L5SA 1L0WA 3W1GA 3S15H 4JI5L 3PO2G 3RLFA 4BA2I 3RN2A 2PMZE 4OO1G 1G51A 2N3SA 4EX5A 1V9PA 4R4OA 3Q8DA 3BJUA 4JI2Q 2VNUD 1V43A 2GN5A 3S16H 3KF6A 1Y14B 1KHIA 4DV2Q 2UU9L 4GLAC 3M9BA 2ZJRA 2DGYA 4RG1A 4YCUA 4DR7L 4GN5A 2JA8G 2GVAA 1WI5A 4ALPA 4JI6Q 1N32Q 5M3MG 4IJHA 2KBNA 3D0FA 2KENA 2IT1A 3UE0A 5IYBH 2AMCB 3L2PA 4BY1H 4DR5Q 1QVGA 1QVFA 1HZBA 1PV4A 1NJIC 1A63A 4HIDA 4UY8C 2WB1E 3PO3H 1VCIA 1OXXK 3UDXA 4DV3L 1O7IA 1SE8A 4GOPB 3KYHC 1HJPA 1YHBA 1VQCA 4B3MQ 2XTIA 1NE3A 4KI0A 2BA0A 3GD7A 4L5TA 1KC8C 1RL2A 3PF5A 1JB7A 4DNIA 1N34Q 1CSQA
chains in the Genus database with same CATH superfamily
1DC8A 1F2UA 3T51B 4HAVA 4WNAB 2ZIFA 3LUKA 4MLCA 3OBBA 2C94A 3EFOB 2CDAA 4MRSA 3J81A 1IY8A 2QSZA 5CURA 1RAIA 3PD1A 4U9UA 4IMIB 1A9SA 5ELMA 3S1LA 4GT1A 3RC8A 4JR0A 4TLMB 5EKTA 4ND6A 4CDNA 1A2OA 1ULSA 3IE2A 3NANA 4OQMA 1PHPA 3M4QA 3OHMA 3A6EA 4G5GA 3WGTA 5JC1A 3PCTA 3AF3A 3ETEA 3T53B 4M46A 3I90A 3A9CA 1JR3D 3TG8A 3R3UA 2VL7A 4ER7A 4N48A 1L1OB 1VPVA 2NTTA 5K8UA 4RNCA 1ZCFA 2XX3A 1UF9A 4L6AA 1EY9A 5JADA 4Q4JA 3TBIB 3A1UA 4AUMA 3K6OA 1ISFA 1XDDA 4FQ5A 1LYLA 3ZGNA 2AEEA 3NELA 4RM2A 1SEBD 1L7XA 2PV7A 1A7UA 3BWCA 5HK8A 4X65B 5DO9A 4NJEA 2YFQA 2ASBA 2PXAA 5F2DA 3O95A 3OX1A 2I29A 2A68D 4N9PA 2W9XA 3NYWA 3GRFA 1QRAA 4BNMA 1GOZA 5KNDA 2A9RA 1HUNA 4PLGA 5LD2C 1AS2A 1IDOA 3E3OA 3IVRA 3MWDB 2ETXA 4OWWB 4CDEC 2QNRA 4PRLA 4DQXA 4HAOA 3GLFB 4KR7A 3NS7A 4CCAA 1RI2A 3UDGA 2SBTA 3IBTA 1KRXA 4RGYA 4I65A 3AHJA 3OAAA 1XHEA 2QTZA 4F45A 4OLAA 2RK4A 2C98A 1F2TB 3W2FA 3S3TA 4CI0B 1UXIA 4B4VA 3DW3X 4KPGA 2H9YA 1AKRA 4EDFA 4DIFA 3OLYA 1RMQA 2BJHA 4BFYA 4F96A 1BJKA 3D7NA 3GEHA 3MJEA 2R65A 5EHIA 3S2DB 3QPWA 2OFPA 1PW7A 1D4AA 1ZYRD 1P9WA 2CMGA 2NPIA 3HNPA 1FMLA 3B20A 3H7IA 3VSCA 1FDVA 1XUOA 2F0NA 2PGOA 4P4LA 4UAVA 5EPUA 3UAOA 4O0AA 4RTJA 1WPGA 3N0XA 1YB5A 2GPTA 2ST1A 1XTPA 4DCNA 4C4TA 2FEAA 4AQYL 2NLOA 4N6GA 3OC6A 3R7BA 4E09A 1SC6A 4FNGA 4PLYA 5ER9A 3PGZA 1ZGHA 3C24A 2BGMA 4KG7A 2ENUA 1E9CA 3A9UA 2XRSD 4G09A 4WZBE 2FP4B 2X13A 521PA 3TW4A 2X0IA 1NVFA 3EXFA 4PQRA 1YFKA 5FOXA 2ZE6A 4N18A 3TINA 1KNEA 3P9ZA 2XUHA 2VJCA 2IL8A 2UDPA 1C8BA 1CUCA 4LOIA 5DSTA 1P6UA 1N2CE 4AKHA 1CUKA 4IDCA 2YN2A 3CNOA 5ADVA 4Q9IA 1ONNA 4E88A 1Z6QA 3OLWA 4OK5A 2EXXA 2CE2X 3WL5A 3OE1A 2H2WA 4MYCA 2O2CA 2HUPA 1VRWA 1CUIA 3USES 1CZRA 1PVVA 2FOXA 2Z6VA 1M34B 1Z4OA 2AQ8A 3PF9A 4FJ2A 1D03A 4A91A 5K3OA 5LMCA 3CLUC 4DR2B 3I62A 4LXUA 5M5YB 1V48A 1Z16A 3U3RA 2BFWA 3U4ZA 2RHGB 3HB7A 4FJ1A 1Q0LA 5JG7A 1O9HA 4C06A 5CCBA 8ATCA 2BTEA 1H4VB 1DC5A 2FPSA 1ADBA 4XDZA 1GRNA 1KO4A 4ZVUA 3AYHB 3OCVA 1Z6HA 3ULKA 3TTUA 1MBZA 1JHOA 2GLXA 2Q6TA 3K2BA 1EFRA 2ID4A 2HMAA 2YTZA 1BTOA 1TECE 3IJ5A 4BZWA 2CV1A 4UU8A 1UP4A 2XTJA 4R4QA 3USCS 1E6LA 1U2SA 4MS1B 4QEDA 4CDDC 3R3VA 5H59A 1XNQQ 4PTYA 5JS1A 4PGGA 4X91A 5F4BA 1UBHS 1NIPA 1ZQ1A 2R97A 4NEQA 1FTQA 3GZJA 5JS2A 1DSSG 1LQUA 4N8EA 2UVDA 2JLVA 2NB0A 3ORRA 3WA7A 1H9RA 3GJXC 1QQBA 4G07A 3E0EA 3UWSA 3FUTA 3MEHA 2E5LB 3O8OA 2G0NA 1J22A 4UCQA 4ZVVA 4JGBA 5D1HA 4QATA 4W5QA 4EQOA 5ALDA 2NSDA 4XXEA 4A3LH 4P4SA 1ET9A 1A0OA 1J5XA 5FYDA 4L76A 1NHWA 2QG4A 4RTMA 3AJ9A 2AC4A 1TAHA 3HXKA 4MXDA 1UBCA 3GTKB 2OCYC 1K66A 4J29A 4WK0B 3O47A 5FEMA 5K8IA 1XEFA 3DXXA 2MSNA 1G41A 1Y3AA 2K5QA 2OAGA 4RQUA 3E3XA 4N0DA 3EFXD 2ZTUA 3ZHTA 1QVAA 4HUJA 4RD3A 3WNVA 1E2BA 2R4QA 1SMYD 3I53A 3HKZG 2NU6A 4PGFA 1YFZA 1N2IA 2UZAA 3VR4D 4B5KA 3WLKX 1XC7A 2FFKB 4UBMA 1MC8A 4Q4CA 1MPXA 4MIOA 3IKVA 3PQDA 2DH6A 3WMFA 4JT2A 4QUIA 5F2KA 4BO1A 2IZ6A 1V45E 3HFSA 1HDCA 1PJ4A 2J09A 3DQPA 3LKDA 3Q1KA 1PGJA 2B6HA 4M38A 1KEEA 1EUJA 1UMKA 4O59O 1T1SA 5K09A 3VR5H 4QULA 1K8GA 1JU4A 1QJCA 1CR1A 2V9CA 5BY2A 2K7FA 1EVQA 1MDFA 2O5IC 1OYVA 4X3UA 1Z13A 2JIMA 2Y3IA 4QDXA 4LDQA 4R54A 3TW0A 2W6PA 1KSJA 3PQCA 3GUHA 1STNA 1K0RA 1NC1A 2ORIA 3D6TB 4RV9A 3LX4A 4WINA 1EFPB 1E2PA 1GGKA 2HDLA 2TMPA 1WUIS 2BOSA 3LA6A 3LC2O 3L7AA 4MW9A 4PIVA 5CU7A 5FQNA 3PEVA 2HYDA 1LTTD 3F8TA 5EUUA 1BOOA 2R8ZA 4OJNA 4Q3CA 3EASA 1XLWA 2F3TA 2PUFA 3EVZA 3K0AA 4B3SL 1F9RA 1DYQA 4CKCA 1X92A 2FLWA 4KV6A 3GLHA 4XUEA 1VYHA 3ILSA 4EIWA 4G5OA 4WTOA 5LP6A 3WK8A 3ZVMA 5ELDA 1HOXA 4OQQA 3BMQA 4MOWA 3BRQA 3QPVA 2WM3A 4BO0A 3PQIA 2NM0A 3LUJA 1Q50A 2DWQA 1ZEMA 1SUEA 3ZE6A 1GRCA 5A9SB 4UHFA 1UWKA 1ZVQA 3T3DA 4RW0A 1F2ZA 3TSWA 1TIID 3K73O 3WK4A 2HHHB 1DNPA 2OP1A 4N5IX 4D4KA 1SNDA 4RDIA 2EQAA 2MU1A 1E5XA 2HBQA 4LX0A 3UA3A 2F3RA 3JVDA 4C3VA 7AT1A 1NW5A 4RK7A 4KO8A 4XZ3A 1RLUA 5DBHX 4KWHA 3V7FA 3RFCA 1W0JA 3FCXA 2ZJ3A 1ZW1A 3GDEA 4RSHA 4WBSA 2BHNA 3SXHA 3FDTA 4ZC1A 2BJVA 3MZ0A 4KEAA 3NHJA 4G0PA 3FX2A 4L3OA 4LMPA 1ORVA 2KECA 2DY0A 1EWIA 1A5BB 3BXXA 1PNOA 3E5RA 1XZLA 4WT7A 3RMHA 2YJGA 2XTNA 3IKMB 2GEDA 3M6UA 2A1AA 1AS3A 1RQXA 2E4YA 1AIPA 2CFMA 3LLSA 3SLKA 4ZQHA 4HADA 2L15A 3NGMA 3VA5A 1MTOA 1FC0A 4BQRA 4EB6B 5HIAA 1HE4A 2JBAB 1X8JA 3Q9UA 3U7EB 2XUOA 3U19A 3ZGXA 1NYRA 1XAHA 3WB2A 3U5ZB 1NLYA 2NAFA 1EB9A 2DBYA 1FC7A 3VYTA 4BKMA 4LW1A 1NQ5A 1B15A 1L3BA 1L4HA 1TK2A 3EXHB 4Q9HA 1HFGA 2FQXA 4ZAYA 3RBZA 3TFWA 2B2YA 3ESAA 2ZIUB 1K4MA 3MINA 4J9VA 3UWKA 5I7SA 1ABBA 3ODPA 2IE8A 5IC6A 1LTGD 3P0RA 1UKAA 3COSA 4PO9A 3PEYA 4H0NA 4IHJF 3LX8A 5IY0A 4C21A 4CLOB 4WXRA 1FW6A 1W6KA 4EBFA 1TX4B 1EA7A 4RETA 5EJ5A 1OJ7A 2F4VB 1N33B 2FPIB 3X1ZA 4ASUD 4H3HB 3UJ7A 2BEUA 1AS0A 3MTAA 1QUFA 2F3PA 1YHNA 2F3UA 3H0CA 5T64A 2ICEC 1QGUA 4DEVA 2C35B 1XLTC 1I2CA 3A3OA 4X6YA 4BWYA 4DFAA 2Q6VA 2HLHA 5J3JA 5EMMA 2P4UA 3K9QO 5AXAA 2EW8A 4GS3A 1C1YA 2HSWA 2XMDA 4GU5A 4DXDA 4AY6A 3C4QA 5IBRA 1CUHA 1ETUA 1U3TA 2VCEA 4HO1X 2I65A 3TZQA 4EENA 3PYXA 5EJEA 3H15A 4BBRG 3TTSA 1ZGGA 4D44A 4CODB 4B4OA 2J7ZA 1F3LA 2AG5A 2JFWA 2QT0A 1JQEA 4Y9TA 1SXHA 3OEHD 1YRQA 1BE6A 2GAJA 4EMBA 3EVDA 5JQGF 1X6OA 4CETA 4ZCIA 2A8VA 4NV1A 3CXUA 5HDBB 3B1KA 1I6WA 5EOVA 1M8FA 1LT4D 2WB1B 4R01A 3RF6A 4C9BA 3ZZ1A 5ICGA 1VE9A 2JGMA 2O2IA 3VPCA 4QA9A 3QY9A 4INJA 4QNMA 1MA3A 4BQNA 3DWPA 1PV2A 2XUGA 3YASA 1U0BB 3C5WP 3KU1A 4LDZA 2FYTA 4NQZA 2QG9A 1P2TA 4P53A 1JH9A 2ZTHA 5J5VA 5CM8B 2ZXFA 4NCXA 3GTGB 5BWMA 2O05A 1WJGA 3JD0A 4KR9A 3QE3A 1GTL1 4AJEA 1DOZA 3Q7EA 3R9XA 3WJ7A 5DX0A 1ZO8A 1TYBE 2H4JA 2VXYA 2FPMA 2JGDA 5ELCA 2VQ6A 3L05A 3QI2A 4AJ1A 2Q2NA 4DG5A 3L43A 2KMLA 1GSHA 1ODJA 3H94A 5BQXA 3N70A 4GXQA 2AWOA 1USIA 2V7GA 1M54A 1RABA 5AHKA 3ZBUA 3OFND 1JBQA 2FSIA 3FSGA 3P2OA 1E4EA 1Y1WG 1TWGH 3HEJA 1FJGQ 3JD3A 3L1HA 3T5CA 1KI9A 2YHBA 3QVGB 2HJHA 4HNRA 1R10A 3TMKA 1VQGA 1NKVA 1P2UA 3AG6A 2PNFA 2I9PA 2FMXA 1U8ZA 4IGAA 2QL7A 4FDAA 4ZEMA 3TGPA 4OI0A 1I6HB 1P61B 1XJWA 2VNAA 2A0UA 4LZOA 2J3LA 1XQ9A 5KYNA 3ZR4B 1HK7A 1FDRA 4WFIA 2MUYA 3RVOA 4PN3A 2JK1A 4KVGA 3DUFA 3RWBA 1L6IA 1QOHA 5CEEA 5LYJF 4QTTB 3OFKA 3RG2A 3I5MA 2FLKA 1WXDA 3MOSA 4L63B 3NYRA 2YJ5A 2CFCA 1EEHA 3OECA 2XF8A 2VRCD 4OM7A 1FB5A 1EY4A 2WU4A 4LYFA 4MJXA 4R9SA 4WCFA 1VL1A 3TECE 1VLMA 3C3DA 1T29A 4WLNA 4XPIA 3GGSA 1VQ6A 3V7YA 3SC2B 2HNKA 1C3OB 2EY1A 1W5EA 2OLKA 2E2JB 2R8YA 4XRGA 3GTGH 1WL8A 1K83B 4WKGA 3KSMA 3LLCA 2O07A 5I9BA 3TOCA 2GSDA 1QLHA 2BCOA 1PO7A 4C87A 2XKAA 4IDBA 4R84A 2C2HA 4RPCA 2FDCA 5KJCA 1M1KC 5ALQA 2EHDA 3HDTA 3PK0A 2GF0A 3OMGA 2XUFA 1G7SA 3MG9A 1GT91 1QDEA 3HJHA 3LQ4A 3O4GA 4IINA 4DWJA 3IVXA 3GFFA 4J1QA 1SZDA 5LB4A 5DZSA 3VR3A 1XWIA 1N3IA 2EAUA 1GL9B 2NXEA 2XWJB 3FOCA 1RPZA 1E9FA 2LGJA 1K7FB 2M2IA 1OA0A 3BK7A 2Q0XA 3MGGA 2O2HA 3QBDA 4INZA 3IBCA 4LGYA 3JD2A 1NXSA 3I5AA 4OX9Y 1HGXA 4CV1A 1U04A 5EMLA 3TUJC 1PT9A 1EZZA 2GJ8A 4KN9S 1SKYE 2BBWA 2FX3A 3A4NA 3D4WA 3IJRA 3ZIAA 1WUHS 4PLVA 1WPXA 2QENA 4KRXA 5H81A 4PQYA 3RHFA 5KHLB 1MB0A 3F96A 4BNTA 3D2AA 1EE2A 3G0GA 5DYGA 1BCPF 1ZRNA 1PJCA 2RSOA 1GPKA 2C88A 1KQNA 1PZMA 5FI1B 4R2JA 4LJZC 1E1DA 4TS1A 1E22A 4HCJA 3UUEA 1GV0A 3HI4A 3CQZH 5F9HA 5IW8A 1GEEA 3NTHA 5CV5A 1SA0A 2VDOB 2WPDA 3AEQB 3DM9B 5D1NA 5KYVA 4DNRB 1GU7A 4KFRA 1UXHA 4OJKA 5AJZA 1YL7A 3OOHA 5DXFA 4ZCRA 1BF4A 3DO8A 2EGHA 2ORYA 3JALB 4N0EA 1B0PA 1YT5A 2DY1A 4URYR 4BZXA 3OTGA 3CLSC 4N7MA 1P19A 4F3RA 2CEKA 2VDMB 2QW0X 3NY7A 4PX5A 2ZT9C 4U2KA 4DMGA 3DBHB 4U2EA 4MQUA 4JK1C 3UB4A 1JDVA 2J7PA 1MRNA 3T5AA 3E2IA 3KSBC 1YZFA 3I76A 2YVLA 5CNIA 4B2LA 3ZU3A 2G7ZA 2O1WA 1II3A 5TY0A 3ZIDA 4K2HA 5EP4A 5U1PA 4M4SA 3VYSB 2ZUEA 4OFBA 4PMCA 1U2GA 4YRQA 1T36B 2WPNA 4FEYA 4Z2AA 5EHXA 1D1QA 4WLFA 1JQJC 3C2PA 4HH3C 3WRVA 2DUDA 2NVTB 1K97A 3MJCA 1YBMA 5E7IA 4BFSA 3I39X 1N0UA 4YRFA 4AKEA 1P29A 1YRAA 1RMYA 2O8NA 4D4JA 3KLWA 4RHSA 1NI4A 2VT3A 4J0DA 4Q00A 2DQSA 3D2BA 1D2NA 2CMDA 2FWJA 3LUFA 4IXWA 3QFFA 4JN6B 1PJ2A 1RAAA 1T2EA 5FO9B 3T1HL 4NXMQ 2C84A 3IERA 4JJFA 1F6BA 4M7PA 4BTEA 2P11A 4A0GA 2KCMA 3QUTA 4GWKA 4TS3A 4AJ2A 3GXOA 5GGXA 3I55A 1I9CA 2P6NA 3P2JA 3NRJA 2RJ3A 3DWFA 2BP7A 1G5RA 3ZHUA 3GA5A 5CLFA 1J06A 3NQ41 1GAEO 3HWSA 3TAUA 2R8BA 3BXPA 3FNQA 5ECYA 1GQRA 3NXKA 1RXCA 2CJPA 4MYRA 3TRKA 3LVQE 1E18A 2EJCA 1HUQA 1ZLXA 3IUPA 4FKZA 4CQMD 1CRQA 1Q3KA 1QTNA 1V47A 3DDWA 3NDJA 4DY6A 4TYQA 5F77A 2O57A 3L4EA 5CVEA 4JI2Q 4BFUA 1SHZA 2O23A 5BMOA 5A62A 4Q3EA 5KVSA 5C53B 2HRRA 1JXAA 1PTOH 1E77A 1W85A 1Y4AE 5HKLA 1DIHA 1Y98A 2I71A 2Y8EA 5KTOA 3DPIA 3EEIA 4JC5A 4UFNA 3FZQA 1J25A 1I4EB 4Y2YA 2TSSA 4JI6Q 1T43A 3O26A 2JI6A 2GKOA 2XZPA 3A27A 4HNHA 4HQLA 4YPVA 5BN4A 2AA3A 1QVFA 1KARA 3G7UA 4C1NA 1JTFA 2CLEB 3TZEA 1M2GA 2XCIA 4OBEA 4PINA 2PUHA 2ERCA 1B3BA 3CF2A 3BXZA 3TFQA 1FZQA 3T16A 3RSFA 1Z25A 1TQDA 4JLUA 1OXXK 4LXHA 3P20A 2P1DA 3KAJA 3OWXA 4LOHA 4ZCSA 5HF9A 4YJ3A 4ZHQF 1Q7RA 2W0MA 3HQ4O 3PNLA 2JI9A 3ESQA 2BA0A 5C44B 2FSGA 2GSWA 4YA6A 3KXPA 5BT9A 5TS2A 3H99A 2B5WA 1T9BA 4PNHA 2ZI4A 4TV9F 2PLNA 1FD7D 3AB3A 3SK0A 3U4MA 1G8GA 3SX0A 3QEBZ 1TR5A 4LE0A 4LYHA 3I2GA 2GTPA 5DX8A 1FVXA 3OLVA 2QM7A 2VAMA 2FG6C 1WCMH 1M6HA 1H6CA 2EEPA 3TQQA 4B33A 4QU9A 5LNK6 3LC7O 1EU3A 4OAOA 3WGIA 2AYZA 1M2WA 2FP4A 4G37A 3E7PA 2FF5A 3JQ8A 4IVNA 4M8KA 4PYKA 4RXUA 4WCVA 3VOAA 1DDOA 2CD7A 3B8HA 2QP4A 3T61A 4MWGA 1LBTA 5IODA 1VJGA 3H2ZA 4YROA 1ISHA 5HCUA 5K5EA 5H3HA 5CXUA 4JFAA 4YX9A 1XNRL 3J80L 2GOYA 2QYHA 3HKZB 1QIEA 4MVJF 4AULA 4EY8A 2QG6A 2PJDA 1KF0A 1YNND 1E9VA 2CH4A 2ZWMA 4A0FA 5K7SA 2NWQA 2WSMA 2FHPA 5A2GA 1SYCA 1D7AA 1EK6A 2F0DA 3HA7A 4DMHA 1GTRA 1OWOA 2HIMA 2HJGA 5EQTA 1SBQA 3QNMA 4B09A 2CLOB 3TRFA 3GA7A 5DLQE 3UMVA 3NDBB 2WJIA 1UMDB 1RLMA 1MC5A 1JG4A 2YW2A 3KPUA 1IXRA 2ZYVX 1T9KA 5JZOA 5HP4A 4Z9CB 1YAJA 2F8LA 4MUBA 1LRJA 1E2HA 1BDBA 3NW9A 3O7MA 3U7JA 2MQHA 4O1NA 1I36A 1KOFA 4WXYB 4K0KB 1SYDA 1C0AA 3WWDA 5FUXA 2FRXA 1NR4A 3RHSA 1PBNA 2JKYA 4EFLA 2I1WA 2FMIA 3K0XA 1DQPA 1F9AA 3A11A 1G38A 1Z4QA 1EJ0A 1YULA 1S8FA 3MBIA 1KDAA 4D4GA 4RSMA 1QHEA 3PRKE 2V0NA 1ZNZA 2YZMA 3K53A 3OE7A 1YJXA 3RYCA 1UIRA 3V4SA 5H7XA 1VHLA 3GJSA 3TTXA 5IGBA 1PH9A 3BDIA 3EVGA 5ISMA 1ZN8A 4H6PA 2GVBA 3K5NA 2J59A 2Y2VA 4KOEC 4Q24A 1CZLA 3PO3G 4K9PA 3WX0A 4ETMA 5HKKD 1DRKA 2EF0A 4C4YA 3TLMA 1GN8A 2MSLA 3KV3O 5BQ5A 3MEQA 3RRXA 5BW4A 2NT4A 1C9MA 3OMWA 4FDUA 1U9YA 1TIDB 4HQKA 1IIRA 1D8AA 5ALOA 4HJ8A 1P60A 2FNAA 4ZXPA 4YRRA 3DMHA 4QIHA 4B7AA 1OMOA 4LF8Q 1E6WA 1HNNA 1P33A 5E3JA 4Z54A 1WHSB 4FP5D 3PHJA 3TLCA 2IIVA 4ARCA 3U56A 2QDBA 1SCJA 3GFRA 2EFDB 3QLVA 5B36A 3QV1A 4BO9A 4MVJP 2D8AA 2P4HX 1RKVA 1CK4A 4MAMA 4PGHA 1TTTA 1JILA 1TWHH 1G66A 1MXFA 1SXGA 3O0TA 2YC4C 2XNDD 4M1EA 3PQ7A 5DF1A 1T5BA 5JOQA 1TWCH 3NENA 2WWTA 4FEAA 3EULA 1NQUA 3EFOA 3GLFE 1DEAA 2EG5A 3K5HA 3L2OB 5A0FA 2WFAA 3F4LA 3RC9A 4Z5XA 5IZCC 2BLNA 2V4UA 3GDHA 4C5BA 5LPNA 1W85B 2DT5A 4FOOA 5A05A 4JV5L 3L9XA 1N33L 3B82A 3AR8A 2VJLA 4JQOA 1C7IA 2R92B 4FX5A 4NR0A 1AGXA 3DVLA 2QJWA 1O96A 1ISSA 2ZBQA 3E53A 3I6QA 4DMMA 4FDBA 1STYA 3T13A 1AUXA 3NI2A 3TRDA 1AO3A 1JIJA 1AMNA 1C50A 4DV2L 4JIMA 2JSOA 3I28A 5TC4A 1FSSA 2ZETA 3KUPA 3CO5A 4MB2A 1QYIA 2NUBA 4GP6A 3ZYZA 2BP7B 4FU0A 1IULA 4TSSA 4FOPA 4QNNA 4ZCLA 1KDVA 5JW6A 3F6RA 2MHCA 3UBMA 1M2JA 2ZI5A 4Z3KA 1M6EX 2QNBA 1ZOIA 4QAJA 2VBFA 3NR2A 5TMDA 4FNMA 3WL3A 2JLWA 2J0UA 3FRIA 1T10A 1AKWA 3K8OE 3S5JA 2WNSA 4ZYWA 1I4TD 1EL0A 1Z6TA 3V7NA 3ET5A 5FO8B 4DQDA 2GZ1A 2CCKA 3P9PA 4DSAA 1ZBQA 1A0IA 2OF1A 2DWOA 2J41A 2PMDA 3FB4A 1UBEA 2BSAA 5IT4A 4B3ML 2GAFA 2RHCA 1SUFA 4LBZA 3DM1A 1DE0A 2Y0SE 2H9AA 2F4VL 1W4AA 2QLJA 2XXJA 4J3JA 4ZAWA 1CRPA 3MMPA 4AROA 1J21A 4V38A 5CVDA 1V3TA 1B3AA 1F5SA 2F48A 2JGKA 3ONVA 4H3SA 5DISB 4QU8A 1DHRA 1EVEA 3S5UA 3OJWA 1EEXB 2Z6AA 4WEQA 4EPXA 1A2BA 2VUUA 2B2WC 3AUYA 3TGLA 1W5TA 4CEHB 5DSXA 4JJGA 1XXGA 1RT9A 5E9QA 4A3IB 4U6SA 5IKMA 2ZI7A 3CLRC 2GZSA 1SFOH 3PNYA 1MH9A 1XU4A 4GYYA 3KBGA 3U5TA 4P72A 1NW9B 2MYUA 2D1YA 4GLXA 5AUNB 4MTCA 1UZUA 2OGSA 3BXOA 1H0SA 4KLCA 3MTQA 4MMXB 2Y4NA 1N7HA 1TCAA 1R8YA 2GN8A 3JALA 1KI2A 3B1XA 1XTCD 4XM0A 4XQ0A 3UMMA 3QI7A 2OTCA 5E6SB 2ADFA 3RS3A 1N8NA 2M1XA 1GZSA 4F12A 3NBHA 4NH4A 1N2SA 1I33A 4YJKA 1LPBB 2YY7A 1O6ZA 3H09A 2VNSA 3EY4A 3H7AA 4Z4HA 3P2IA 5L7YA 5JH7A 2P9GA 2YBEA 2FR1A 1K5GA 4D96A 4DRZA 5BXYA 2WMDA 1Q7EA 3ZU6A 4GDFA 1A2UA 2IHJA 1PJRA 5FTWA 3BVPA 4JOIC 2B78A 1HA3A 4TOIA 4OU5A 1U5BA 2LE0A 3GLIA 4CXMA 3JQAA 2X0KA 4CL3A 4AYTA 1XNRB 2JHAA 3ZV6A 1QPGA 2CLKB 4C2MB 2RH9B 1EQQA 1GUSA 4GAEA 4FYDA 3VR2A 5KWSA 4DR6Q 4UVEA 1JTEA 4UXIA 4C7XA 10MHA 3T1NA 4PXYA 5AHWA 2H7CA 3TQHA 2GCIA 4DV7L 6PFKA 1PEKE 4G0QA 4FNFA 4R9RA 2C4KA 4EI8A 1H95A 4BP8A 3AR9A 1X15A 4GPBA 4Y6PA 5IGGA 2H06A 4ZT5A 1AOXA 1DKLA 5BW6B 4AMVA 4YV1A 1E0JA 5JQGB 2HMWA 2LDXA 4Y3UA 1IG0A 5KTYA 1KBQA 2HHHL 4LK3A 1EE1A 2MSWA 3ZLUA 5E3IA 3LYLA 4ZAFA 4GVXA 1WG8A 4RBNA 1SXJC 1EQAA 2G63A 3OKAA 3WLIA 3GLGE 3K9NA 4DR5B 2AW3A 3PLRA 3NHZA 1JFTA 3ZJYC 2Z6BA 3K59A 4V0LA 1EBFA 2OHGA 3OCYA 3ED5A 3HOUB 4MITA 2OE2A 4CT4B 1HFEL 3BUSA 4G86A 4TTAA 2E3JA 3I0MA 1QCZA 4B3CA 5C2JB 4K8OA 1PJ3A 5JARA 3R9IA 3MTBA 4ZGWA 5AOVA 2VHUA 5J23A 1IWPB 2EY6A 1EVIA 1CY4A 2BCJQ 4QIWB 5G3LD 1NE2A 1WMFA 1TEHA 2BKAA 2Q5CA 4Q3AA 3V33A 3DUFB 5LMNB 3TP5A 2V6FA 4AXBA 2WWHA 2Z9HA 4M1UB 4KCGA 3PIIA 1RWPA 5EWJB 4MB6A 1JWBB 3I2IA 3G2LA 2NUAB 1INLA 1NPDA 3N3BC 2B63G 2A59A 4S0XA 4WBNF 4Z4IA 3CLUD 3A37A 3N8NA 2OGZA 5ERYA 4GICA 4RV5A 4TLLB 1SHTX 4F2PA 4CU2A 4Q01A 2GN6A 2GVZC 3V3TA 4O4LA 1IZ0A 4POFA 1DL5A 1ZMOA 2X8WA 1BJRE 2QRHA 3G2NA 4N9WA 3WGYA 4CM4B 1GPDG 2WQZA 1ODIA 3D6WA 2BRUA 2OZPA 1BC5A 4PCVA 5JZSA 4FLFA 4JSRA 3KVNA 5ARCA 4KXFB 2JI7A 2CLCX 5J47A 5KQGA 1WV1A 1UCFA 4PAQA 2RCYA 3RGGA 1HORA 1WF3A 1H94A 3DUPA 2PZGA 4RY0A 3FDXA 1L2FA 4OP1A 4AL4A 1AZSC 4AUNA 4BC1A 2VT6A 4KO4S 2JL1A 1RD4A 4DLNA 2W6IA 4LF6Q 3CC4A 2F1IA 3AM4A 3N9IA 3QLJA 5G4LA 3CTPA 3K70C 3C3XA 5HSGA 1NNI1 4PYRA 4LWCA 5IN4A 4ALKA 2PXHA 1V8QA 1W9MA 3ZWNA 4QBIA 1NAPA 4QOFA 1JPUA 4GQAA 2VK4A 5GPBA 1SN8A 5J5AA 3L7NA 1RJWA 4Q16A 3EFEA 3V2IA 4JB3A 1RP1A 4RXTA 3W5SA 1I4RA 2J5XA 3N8KA 1FLVA 3WLTA 1QAOA 1OREA 2YS7A 1TEVA 1Q95A 1ZSNA 2Z30A 4PZEA 4QREA 1AGRA 3JAWA 1KERA 1RWBA 3ETLA 2G4CA 3QQPA 1TKBA 4C1NI 4H7KA 4R3UC 3B3JA 3ICPA 2BBTA 4XWOA 1PHJA 2R2AA 1TWFB 3H2YA 1JDNA 1OC4A 5FL7A 5FDFA 3KUDA 4S35A 3I05A 3GJ4A 5JRJA 4YJHA 1WULS 3K50A 4KLAA 5C32A 2J4XA 1IK4A 2JIRA 2D06A 4R1OA 3NORA 2VZEA 1STOA 4U7GA 4DA4A 2Y05A 3TW8B 3ITKA 1H6DA 3PI7A 4UBLA 4GDMA 2XA1A 4W82A 2R6GA 2QVXX 2RKSA 3K80C 3UQYS 2I2DA 1ULTA 4A3JB 2NN6I 3FDFA 4HN9A 2HPAA 4Y2QA 1FX0B 1OBOA 1QFYA 2FPIA 2FFRA 2OCPA 1N0WA 1U9IA 3CPJB 4ROSA 3LUGA 2YQ5A 3MWLA 2QDLA 3IE0A 3D81A 1BZYA 7MHTA 3IOBA 3SDSA 2FMUA 3ANSA 3THXA 5AKZA 1F9EA 3U4AA 4CM8B 2RFLA 3WYBA 3NWTA 4NP5A 3ENZA 4MKIA 4N8DA 2BKVA 5AJYA 2JEZA 3CRVA 3LX6A 2EU8A 2H1EA 1NMQA 2QW8A 4NBTA 4LJ7A 4PG3A 2JAPA 3MMSA 4IJ6A 3K81C 3LA8A 4IQ0A 3HZHA 5I9LA 1KDBA 3CCJA 4XGNA 1I01A 1TC1A 2JBAA 3DR5A 3OY2A 4B34A 4ARUA 3WMRA 4OUDB 1ADCA 3WXMA 3U48A 3HCCA 3VDQA 3WGLA 1KC1A 1RWMA 4QGSA 4HYQA 1N75A 2AV6A 3FHWA 4XVUA 1ZD2P 2B2XA 1SU8A 3A3NA 2FK8A 1QS0B 5AJ3L 2ABWA 1ZIOA 3AR6A 3HNRA 3IVGA 3KLNA 3NASA 3NJ4A 1M1YA 5T1IA 4JCCA 1A9QA 4WHMA 1N9WA 2OWEA 3UMCA 3WFJA 4CLRB 1ISPA 4LHXA 4RABA 2PGXA 2A74C 4BMZA 2YXLA 1J4AA 1POXA 4NECA 3VA7A 1CQIA 3PHIA 2UUBQ 4K9DA 2X5JO 2CLFB 3AUSA 4AB1A 1FFCA 2JK0A 2OORA 1TM3E 4RGNA 2B5VA 1OX4A 3QYPA 1KYVA 3CW2A 2XA9A 3QU7A 1D5XC 1B6SA 2X2FA 3A1TA 3BZCA 3CPFA 1V0EA 1UOQA 3G5UA 3KBOA 2R1VB 3M6WA 2PX8A 2CXOA 5HMLA 4K2KA 4BX9A 2QRLA 3HXQA 4UMDA 4XIYA 2ZTVA 3QVMA 4XTRA 1OFHA 1XVAA 4TXHA 4EO4A 3PKZA 1POWA 1WZUA 1X1CA 2IODA 5HZHA 1UC8A 2Y6VA 3GBSA 3HOXG 3LW7A 4MYDA 4QDKA 1SKUA 3QWNA 3EGWA 3DDCA 1E1RA 4UTXA 1NFFA 2A9FA 4WD3A 5HF8A 5JWOA 4G0UA 1TWAH 2K50A 4A8HA 4G23A 1Q14A 2YXDA 4NARA 4QECA 2KQUA 3B7GA 5DYTA 1A9YA 4XQNA 4ZZIA 2GHQA 3QRWA 4DDVA 4KAFA 3UFXB 5JVDF 1UEAB 5IYCG 2B3TA 1BR9A 1XRQA 2CNLA 2X7JA 4AI6A 2DNCA 4XA8A 1ISJA 1BAPA 4OO1H 2PKRA 1F1BA 4JVSB 1LVGA 3AEYA 2XMRA 1DJQA 1UT5A 4KGXA 2YHAA 3HLTA 5FUVA 3X1JA 3IS3A 1B0AA 2CUZA 3JQAD 4M53A 4Y2TA 2K5DA 2RRLA 2UUBL 1J2UA 1YACA 1QG0A 5JAOA 3M6AA 1S5FD 1UM9B 1HRKA 4KW7A 4NNJA 5LOVB 3HLYA 1ECPA 1YJ5A 4KRGA 1BFUA 3LFUA 5EVJA 1LDEA 3H83A 2RGXA 3G85A 3TK1A 3ZDYB 3IX7A 4BTVA 4ZGBA 2GK6A 2VT2A 1V4VA 1ZK2A 2HZ7A 4FOSA 3NYIA 4RXMA 5A06A 2FXIA 5FHQA 1OLUB 1WE2A 3FF4A 5MN4A 1AHIA 2FFAA 4LECA 2JVIA 5I9IA 3SKVA 2UUCL 1DIOB 1DIBA 5C5EA 1A7JA 2K28A 1MORA 3FYUC 2DF8A 1Y5LA 1EM8B 4X64B 4GI7A 2V6JA 1U11A 1A88A 1LGYA 3HYSA 1VDZA 1GPAA 3OIDA 4L5CA 4Q48A 3M3DA 3TI7A 4V39A 2XNKA 2BPOA 3KLMX 4GLJA 3OG9A 3Q15C 3WWZA 5JMOA 4OL0A 1WTXA 1G2QA 2WTBA 1EAMA 2DQKA 3FBTA 4NOJA 4BNGA 2ZCJA 4M9SA 3RLIA 3IJEB 3M82A 4PAWA 4CMHA 2GK4A 5LOVA 3G5LA 5I48A 3AVYA 2X6GA 3UG6A 5CV7A 1TKCA 3GJ3A 2Q5EA 3CH5A 2F1RA 3PNBA 1ODFA 3RSOA 1VKOA 4QFCA 2R7AA 4RCOA 4Y9SA 1TE2A 1HHVA 2EIXA 3I3SR 2A6HC 1P1FA 3VZRA 3ZGOA 4QT4A 1IY9A 5C7IO 5M29A 3RZDH 1Y1VB 1CUJA 4G9EA 3FSRA 4MROA 4Q6BA 5ECDA 3CHYA 1ZGAA 4HNUA 4Q1AA 2BE5C 1JEYB 4PHCA 4TVAB 2XE4A 3VGPA 4DR5L 1WKBA 3FNHA 4N3GA 3VVCA 4YP0A 3ZU4A 4YRBA 3LQKA 2X2EA 3TEFA 3ZDQA 2PE5A 3BQMB 3MBOA 4RV4A 3LW8A 3RRJA 4LYAA 3C85A 4OHFA 3AR7A 5LVAA 1PTKA 3M5CA 1U0EA 1JJ7A 2IHZA 5JZMA 4DK3C 3TLEA 4UUOA 4N65A 4RJIA 3VDMA 2IU4A 2P27A 4X45A 1VXRA 3OCZA 3WLEA 4YHHB 3RKRA 1A9OA 5AQ1A 1Z0JA 4UTPA 4C0SA 2HXYA 3I9MA 2GO7A 1CBUA 5KWEA 4TRNA 2VNUD 1V43A 1B8UA 1NFRA 2OSVA 4NBNA 3WO0A 4BRZA 1Y14B 1YL5A 4KQCA 1J97A 2QN1A 1S1MA 3BA1A 3NHPA 3DJYA 4O4HA 1GVHA 2XQGA 3GQVA 4P38A 4PWZA 2GERA 3T3MB 1KQ3A 3DMNA 1P8JA 1NVKA 3ELUA 4BV9A 4WZBB 3LY7A 1TQ4A 1M1YB 4AK9A 1H2XA 1ST3A 3EA0A 4L4XA 4WNYA 1X19A 4EA7A 1V8PA 4HTAA 4L8WB 2DFTA 3URKA 2WJ6A 3L6CA 4I3HA 3WMXA 1W0JD 1SN7A 4AAYA 2XBMA 1XB2A 4UY8C 4HX9A 3LHDA 2O2LD 2DLCX 1C0KA 3KG2A 1IN1A 2L17A 4S0ZA 4D6YA 3WDNA 1SHJA 3FPAA 3OTIA 3DXFA 3GMFA 2XTIA 1KC8C 4AZSA 4EL5A 1B8OA 1HKUA 2QXTA 3C1UA 2UYQA 1IHUA 1T1IA 3DT8A 1WXEA 1LSSA 1UBLS 3KXIA 1AMOA 1YQEA 3LGXA 4LDPA 4NOKA 1EAYA 1N25A 3PUXA 3HOYG 2D5LA 3AQIA 4LBYA 1NJ8A 2J6BA 4A8TA 1SCAA 4RD2A 2YL2A 5AW7A 3GTJB 3MVEA 3S1MB 2PG3A 2WRZA 4AMGA 2OCLA 2H18A 1H4TA 1PT6A 9GPBA 3T7SA 2OBNA 3R3SA 2FW6A 4F5WA 3L7CA 5TMBA 5EBDA 3ZN2A 4ZZ3A 2C2WA 3T9BA 2O8DB 4HZUB 1T2AA 2JIDA 1LDNA 3BKWA 4YDRA 3BB1A 5JJZA 1F2TA 1VLQA 3AK4A 2NVYB 1ZJYA 1UUPA 1LI7A 5I8ZA 4NC9A 2H2IA 2XE8A 5I4BA 1QE3A 1SRUA 2MO0A 4M89A 3CF5A 2VEOA 2PKQP 3N2IA 3IV7A 1IKMA 3CN9A 1XMQB 4LYJA 1JXOA 3HKCA 2CWWA 1PT7A 3OX2A 2XTZA 3TSAA 4F8MA 4IFIA 4DBLC 3CCRA 2QRZA 2JEBI 4BJ6A 2JLQA 1QH9A 2QZ9A 1QNKA 4IDHA 3BFXA 1YCDA 1FE8A 1K86A 4BAZA 3PWZA 2H4OA 4OH1A 2A5YB 3KDAA 5LCXA 1JDTA 4LRSB 3OKFA 4TLAA 3T9CA 5M5WB 4PYIA 3A2NA 4AP5A 2PQAA 2XWBB 2DECA 2PHZA 1X8XA 4L4UA 2O8EB 2V4MA 4HB4A 3SJBA 2XT6A 4DJFC 5IOCA 3ZTBA 2FU5C 3TF5A 4IUCS 1SCQA 4P31A 4CGYB 4QX6A 3DJFA 4U3JA 4R0MA 5JNUA 3BB4A 3FNEA 5EJ2A 4UTOA 4XI9A 1O8CA 1X7DA 3ZCVA 1F5NA 2PLWA 4KIGA 1EU4A 1DUSA 4G4JA 3BCSA 4J0FA 4N7RA 3BHIA 2YWDA 1E6MA 2ZO9B 4RMJA 3UAVA 2UZ4A 4GOKA 3VKWA 5JUWA 2A7QA 3L7BA 4M21A 3I2ZA 5ELEA 1UT8A 1S5DD 3I73A 3MXNB 1THNB 1GTZA 2E37A 1KI8A 2OP0A 3D6UA 3KYCB 3SZLA 2V7BA 1E1RD 2CNNA 3OHXC 2PGLA 3HUEA 3MTEA 4MP6A 4EGCB 4O4LB 3PNKA 5K0ZA 4MVCA 1TQ6A 3JX9A 3W34A 2QMZA 4XYQA 4BN0A 3X1YA 1MC1A 1XDUA 2FWAA 4Q9AA 4PHGA 4TWBA 3AWDA 4TT3A 4V0SA 4ERXA 5CDUA 1TCUA 1Z4JA 2CLHB 3I01A 5TLSA 2GD2A 2YU9B 1TMGE 3F46A 3KXKA 4JJAA 3MXPA 1RP7A 3TCNA 1C8LA 2AKAB 4I6JA 3DEKA 1UBUS 3O4JA 1Y8QB 3UAXA 2H52A 1JWUD 2XVSA 4B74A 5IXSA 4D9BA 2HR1A 3J7AF 2WOOA 3BVZA 2ONCA 4KNVA 5BMVB 1QRSA 1SR3A 1QZZA 2R6ZA 3FKIB 3CWZA 3L6UA 3K58A 5LQSA 3U4QB 1QTQA 1XL0A 3UTCA 3TNJA 4S1VA 1M8AA 2G5GX 1B2TA 1RYNA 2R84A 3GN1A 2DWUA 2A73B 4US1R 3W6PA 2X9NA 3F9RA 4OHJA 2BFMA 2EJBA 5EPEA 1QQTA 1I2ZA 2J0EA 2MDTA 1KEVA 4ASUA 1BQEA 3R0XA 2I3GA 1UK7A 3GJRA 1Z2DA 4GOND 1GTG1 5ALMA 3D6NB 4EJSB 1N32B 4IMJB 3VNBA 3UKDA 2UVPB 1QCBD 3ROZA 4JYAQ 1DRJA 4LKOA 3TN2A 1CHQD 1UE7A 1L5VA 3G7SA 1J09A 3IVAA 3P0JA 4IG4A 4NE2A 3JR3A 3KYBA 2JCVA 1L0XB 2AQ1B 3HCAA 3N2ZB 4M1YA 4P4NA 3IQHX 4AX8A 1OWLA 4DLYA 3H87A 5D3IB 4NMHA 4MQBA 2IQIA 3Q8KA 2G09A 4JI0Q 3HB4X 4XKJA 1PH4A 4R2XA 5EJIA 4FMDB 3PC3A 1M2OA 4EF4A 5E1FA 4KQEA 1ZGZA 3WJAA 5L4SA 5GIPE 4PSKA 2C2MA 1UK8A 3LZCA 1RYDA 3UC5A 4RGMA 3CP0A 1JHYA 3AEUA 1U5BB 2D0DA 2PIDA 3GLIB 2YN0A 2Z1NA 3L02A 4J3FA 4F6CA 1FXWA 2C4TA 3GY0A 4YUWA 4RKWA 3UWDA 5A5VA 1ICIA 1F6WA 3S1NH 4IFTA 3T3IA 4IFEA 2GPWA 4JV5Q 2XE7A 4G9BA 1KWGA 2JFFA 1PJZA 4KJOA 1JAHA 2P9HA 2UXDQ 2G28A 1X2BA 2W48A 3M6LA 1C0LA 4PC1A 1S2LA 4Y2RA 5EHGA 1RXVA 9LDTA 1EDZA 1ZBDA 1EXDA 4J15A 1Y1SA 3I30X 4BP3A 4PYMA 1FP7A 1NX9A 3W8RA 1FQKA 2AR0A 2JEYA 6REQB 3T0FA 3BMOA 1K08A 1PL8A 2BEJA 2R8PA 3TREA 3MSXA 2GHRA 1C7EA 4OX9Q 4I5DA 2C2KA 3GYBA 2IOFK 2EHJA 4JVNA 4IUYA 3T12A 5CV8A 1X1RA 3CPEA 2OM6A 1F14A 5CHEA 5EPJA 4AZ0A 5TDHA 1NVAA 2F4IA 4S3SA 1ESCA 4TXMA 3WIUA 5EBCA 4EP1A 4P4TA 1MHWC 3QWAA 4WA7A 4X1YA 2JKVA 2YASA 3AHDA 1RZVA 5IDYA 5IP7H 3RJ5A 4Q9DA 1I2DA 1PT5A 1CB7A 1RRFA 4AF6A 2QD3A 4DILA 4FTWA 3PQ4A 3VHQA 2PUGA 5LC1A 1TPZA 1P2BA 3ZEAA 4RVSA 4FXOA 5C1OA 1RE1A 3IF5A 1WB4A 1URPA 3EF0A 1L1QA 3ZHSA 4B80A 4ZJUA 1Z6AA 1KA9H 1PDVA 3ZD8A 4E4RA 4MPRA 4DZTA 4LUOA 2IP1A 4PNEA 1NTOA 2JGNA 1P5RA 1WOCA 3AUKA 3A1VA 3B6IA 1ZITA 4DA2A 1XZCA 3SBXA 3NZEA 2DFPA 2EFHB 4J16C 2R6AA 3W3AH 4Y2HA 4MGEA 4DRXA 3G2HA 3UAYA 4DQUA 1PSDA 1TUBB 2FOIA 2HNAA 2Q99A 3ETHA 1CKMA 1FUKA 3PHCA 5JSYA 4XIIA 1JKFA 4DLTA 4DTCA 1GQSA 4H13C 3NK9A 1D2CA 3L1UA 1X1AA 5L95A 3KJOA 1L5WA 2J0UB 4QCLA 4Y18A 2RARA 1U5AA 2OV3A 1L4NA 3NTUA 4LNHA 4J3NA 2JLCA 1I50H 1J2YA 2Z08A 5JO0A 1KTIA 3Q8MA 2OASA 1KH2A 3D3WB 3VU0A 2BGGA 1P91A 3DMUA 3MNFA 1ZDMA 5C3UA 1FDTA 1UFQA 1WCXA 2EFYA 3K96A 4KN5A 4KP7A 5DBGA 3ZQ6A 4FCCA 3TO5A 4U2CA 1R3UA 5IUKC 2G4LA 4HJ5A 2X22A 2ZITA 1TVKA 3L40A 1N2BA 1O7LA 5L53A 4M0KA 2NP7A 1Z5ZA 1BXRB 3U7FB 4XDHA 1O96B 1UINA 5CNJA 1IYZA 3SLGA 4E11A 4WORA 3C8ZA 2PWPA 4ZQEA 2J3KA 2ODWA 1Z12A 2Q49A 3BEDA 3BCUA 4N0QA 1TM4E 2PX4A 4G1BA 5FLXc 2X15A 3C3MA 3MPUA 1PFVA 3OPYB 3SOZA 1GDDA 2CNBA 2ORVA 4IH9A 3UJCA 5K0EA 3T34A 4JYBA 5HS4A 5BNIA 3NHKA 1BMFA 4HDKB 5CB4F 2QBYB 2Z4IA 3E22A 3IP6A 1YJWA 1B2LA 2W93A 2QXYA 3LCUA 3STYA 4DC9A 4Q19A 4MRRA 5JS7A 5HJEA 4LF6B 4PX9A 3TP8A 3FBGA 4WVLA 3TSZA 4B75A 2BGIA 3FNRA 2MNAA 5JXJA 4B35A 2PX5A 1NATA 1WHSA 3VZPA 4UCXA 3GNLA 4ZEVA 4IBOA 2B2TC 5KGUA 1K06A 4YLGA 5EJFA 4Q7MB 1TMOA 1Z7YA 4Z6KA 1F0KA 4DDWA 4PHFA 1E63A 2X7XA 2C04A 3I4OA 3UTDA 5BR8B 4BFVA 1MABB 1WOMA 1CG6A 2GZRA 2Z4TA 4F6RA 1PQWA 3CCLA 1G3UA 2ODBA 2AOUB 2J7PD 2E1PA 3A32A 4MR7B 3SDBA 1OLOA 4KIJA 5KEEA 2X1HA 1KP2A 1UKYA 2X2OA 1Q0PA 2DVMA 5EG5A 1GA4A 5HE8A 3ED1A 4M54A 3QVUA 3UBTA 4TMWA 2VBIA 1G291 5EJWA 1Q6YA 1WKCA 1DTWB 3NBMA 2AW5A 4J0KA 1LQTA 2DRIA 2WJYA 1P3JA 4OU4A 4REQB 5AT1A 1U8AA 1EDOA 4TUYA 5TQJA 5K8LA 1RPAA 2FZKA 4R71A 1SXJB 2WJ3A 2ECPA 3GTMH 2JI8A 1ZIYA 4H60A 4LXTA 3FWZA 4EY6A 3U50C 1NNLA 5KWVA 2IYQA 2P0YA 2NUTB 3JVEA 1JEQB 1H42A 4S1OA 4HCEA 1MBYA 2FINB 1UKVY 2N88A 4GFDA 5F51A 4APVA 2B30A 4W7SA 3OPOA 1QVRA 2OAP1 2ZYRA 3H1AA 2DCMA 4H3VA 5KOYA 1DPFA 3K92A 1BYUA 4WY8A 5COYA 2GD0A 1AZTA 2EE1A 3PQEA 3EZXA 2QZPA 3TBKA 3HYCA 3I1IA 4E2XA 4HNAA 5FBQB 4DSOA 2ZLBA 1V9CA 2COUA 1P81A 2VP5A 1NBAA 4LZLA 3T5MA 2ONKA 4ZFNA 3FPJA 2ASEA 5A7FA 1RJFA 1KLGD 4NY1A 4ER6A 4UOEA 4A0HA 2N1BA 1EFRD 1XT6A 1OFTA 4Q7LA 1L8LA 2I1VB 2LCFA 3EARA 1MGSA 2I8CA 4CFSA 3K6SB 4BLQA 2VDLB 1T4DA 1GO2A 2FQ1A 1SYEA 1PD1A 2J3EA 3EZLA 3T56B 2OBXA 3OF5A 3M1YA 5IVDA 2X0EA 4DCSA 1AA6A 1B7YB 1EFCA 4UBOA 4W1QA 1Y7IA 3H0EA 4WZZA 1NTRA 2Y1OA 5L45A 5G4KB 2FPKA 3QKSA 1CEXA 1XN1A 4JJZA 4NTZA 1Z4PX 5B6JA 3W78A 4FLMA 4L51A 1EZ8A 4CDGA 5LJIA 3AGDA 2JS7A 2P2CA 2P4EA 2V0GA 2ZIZA 4LK1C 1CJTC 2ZRFA 2VYND 1NSTA 2H3HA 2XCQA 3KOMA 4HGYA 1BEZA 1TNDA 1OROA 3WGZA 3HOYB 1HFJA 2ZUDA 3TVDA 1X9HA 2W2MA 4DQ0A 5K20A 4L8YA 3L4KA 3UICA 4N8X1 3MLEA 2XTMA 4MR8B 3D0OA 1EP2B 3OEHA 3CVWA 1PS0A 3DNPA 4FYXA 3G5AA 2REOA 1F20A 2CW5A 4D0RA 3BSFA 1GTMA 2E7ZA 4TV8A 4DNOA 2FRDA 3EGCA 4E5DA 3FUCA 1YJAA 5BMVF 3REGA 1GCIA 1ADYA 1T0HB 1P8LA 1XX8A 1U7DA 3AVOA 1B0ZA 3IYLW 2HTFA 4D8WA 4EQ6A 1GG9A 5ILOA 1OYYA 4F46A 2X4IA 2GCPA 4LJ8A 1UBOS 2FB9A 4GX5A 1K32A 2AQKA 4XCQA 2B2NA 4XLZA 5A6SA 2PJZA 5T57A 4RTKA 1T6XA 1G5QA 2IEAA 1XNGA 1L7AA 5M3MB 1EGMB 1W6JA 1H9SB 1HZCA 1P2VA 3EMKA 1C4OA 1SE4A 1H0KA 1JYFA 2J31A 2XCOA 3IMKA 2EPBA 3CV3A 1YJ9A 4FUTA 2OPHA 4DC0A 3OX4A 4M37A 1KO5A 2F0WA 2JHFA 3BA6A 3NTKA 2ZVQX 4F1WA 3ND5A 4CG2A 4GWGA 1XV5A 2JA7G 2E18A 4KWEA 2UZ1B 1K7SN 4R1JA 5L9AA 5ICEA 4OI2A 4XS5A 1R6VA 2O6HA 3LDFA 1KI3A 3L0BA 4F8JA 5C52B 3X1XA 2B8FA 1QBGA 1KAQA 1LF0A 1M8JA 2F3VA 1Y63A 1ZESA 2ID7A 2PX6A 2WYWA 3DL2A 1PH7A 2VKQA 3KJNA 3PQFA 2XPCA 3FJ1A 4I46A 4OAPA 4IO0A 4WLOA 3GEMA 3UK7A 3DLHA 4YV2A 3KJGA 1JJBA 2ZOSA 3S9WA 1AEXA 5LMNW 3NM4A 3PR2B 4QOGA 2CFRA 3FHCB 3ORYA 4PZCA 4CF5A 2C7VA 3ET4A 1Y7LA 1CSEE 3DWIA 3OSZA 3LCCA 4FYPA 1K3UB 1MD9A 3AJ8A 1RIIA 3WKCA 3ZWOA 1CZWA 4AP6A 4RC9A 3KUCA 1TIKA 3HCWA 3EIQA 2HIHA 5DASA 4F3CA 1U63A 5BRAA 5EUXA 3HBAA 4NCIA 1OE0A 3AL3A 5IASA 3IXLA 4QXMA 4AMUA 2PZMA 3SYRA 1M66A 1S3OA 2ZB3A 1GQFA 1ZXXA 4HWRA 4AS2A 5A4DA 5BSUA 2YCLA 2PBRA 1QO9A 4F85A 1GYQA 1CQJB 3H11B 5GONA 4Q47A 4FUQA 1HG0A 4HDRA 3E05A 4UDYX 2WKRA 3O2SB 2PMKA 9MHTA 4A3FG 1EFDN 1GPMA 1Q8IA 1QNLA 1ZUNA 1X55A 1MN6A 1SQFA 2O7SA 4H7BA 1HLDA 2FN4A 2NZ2A 4KYUA 4OXYA 3AYXB 2D5CA 3QEKA 3GTQB 4NCJA 2GBCA 2OG1A 3OH8A 1BW9B 4GMGA 4PBSA 2NP6A 1MH1A 4YR9A 4NZ9A 3T1TA 1Y80A 4QJ3A 5EXSA 1IBML 4YEDA 3A8JE 1VM6A 2K4KA 1K73C 1KY4A 2C8KA 1VE1A 2XVZA 3B85A 4IDDA 4L27A 3SYMA 4Y6GB 1TZ2A 1W34A 1IUPA 3N86A 4MW0A 3RH0A 1QHYA 2PZLA 3O5AA 4PAOA 1K89A 1XX6A 1NVDA 1Y81A 3OTQA 2YW9A 2I2WA 3GZNA 1Z37A 2WAXA 4LXXA 3WC4A 1BDHA 4GPAA 3FTEA 4JLSA 5AR1A 3AL0C 4UMVA 3BXEA 2FSVA 3PXAA 4JJEA 4F2WA 1W73A 4NBSA 3S14H 1ISGA 4R2HA 1UJMA 2JIZA 4RL6A 1UOEA 3S8MA 4IWYA 3VISA 1MZVA 1PFUA 3MRXA 3ZNOA 4RVUA 2HMTA 2JP1A 2PANA 3VO8A 3ZWKA 4A26A 2P35A 2RAVA 4YXWA 1W36C 1IY2A 2Z5GA 4MIEA 3QLUA 1MT3A 1K1EA 2ORWA 3V32A 1J8VA 2CXNA 1ND5A 4Q1EA 2OD7A 3FKIG 2FWBA 2GH1A 4DV5L 5C0XJ 1JZSA 1UFKA 2AF4C 4AQYQ 2IHKA 3AVXA 1YQUA 3EDMA 1C2TA 1RZUA 4IALA 5ICSA 4JI5L 4TZ0A 2R66A 4UULA 3ORHA 4EX5A 5CA0F 4C78A 4F9FA 4NPHA 2ZWOA 3AY0A 3N52A 2GJSA 4GIBA 3AW9A 4YMWA 5LHY1 4ZPJA 1V2GA 3L8EA 4ZOLB 3T8YA 4MINA 5KTTA 5C4IA 3LX5A 4DAYA 1FVFA 4MARA 2DGYA 4G1UC 3WGOA 1QO0A 3OU2A 4ZT2A 2DM6A 5LL6X 2FSPA 3T7CA 1MB4A 2HUNA 2ZYAA 3L6EA 1SC1A 2KBNA 1LTSD 1W4LA 3HZRA 1YB1A 5F7OA 4OG2A 5TGTA 4TMVA 1O6CA 1Z56C 1GV1A 2TRSB 3T9EA 5KX5A 1Q19A 1L5HB 1W93A 2OBMA 3MVVA 4M2LA 1KFBB 1O77A 2WB1E 1BHJA 1ZWKA 3K5LA 4HMJA 1NBMA 1WD7A 4X8MA 4FGWA 3CCBA 1ECBA 4EKNB 2GXAA 5AI8A 2PZFA 2G9HD 3OJEA 4XX1A 1BQQT 1NULA 1XI2A 1ESNA 2H1FA 3BPSA 2A3RA 2XDAA 1KKUA 1QAMA 3V2HA 4CEJB 1Y89A 2C2BA 3GRVA 1X3LA 3TQFA 1GXSA 4IG9A 4DR6L 5JPIA 4CHGA 3HJRA 1TVMA 5IDXA 2MSKA 3A1CA 1JR0D 2N78A 1IN7A 2MGSA 2K2QB 1XAIA 3D0RA 4G97A 4KX5A 2AZ4A 5E4WC 3G6KA 4MS4B 2B37A 3E1KA 3FNGA 4HGZA 4IKOA 4L8JA 1E3SA 2PQ2A 1NW4A 3FPBA 3N2YA 3EC2A 4RQAA 1JHPA 2VUIB 1UWCA 1AB5A 1TGYA 4XTCS 2VJNA 2YRXA 4D79A 2FSVC 5KC9A 1A5ZA 1I4HA 2NAPA 1BHO1 2MWMA 5FBVB 1J7JA 5JEEA 4UMEA 2OHHA 3ZQJA 2IHNA 3PJEA 1A15A 1KH3A 3GJTA 4H1WA 3U7GA 5DBIA 2GHIA 1SQ0A 1U7XA 1F51E 3RW9A 3PDCA 1ZI8A 1EINA 4TLEA 2OL4A 3FZGA 5CCEA 2Y0SB 4ZVOA 1KNQA 2GEKA 3H75A 4TWJA 5EERA 5AW9A 3TOVA 2ZBDA 3U62A 4ZHSA 4QZVA 4BXOB 4RZUA 4GNRA 1KJYA 4LN1A 1GZ3A 2M6SA 5DN9A 3TIIA 3IDSA 4BBZA 5CA1F 2A78A 4UM9D 3E9NA 3VR5D 3P7MA 2G1UA 3PO2H 2FFJA 2GXUA 1Y9JA 5EMJA 3NKLA 2A6ED 4PO1A 3W9UA 2Y1LA 4PS1A 4KD4A 1Z8NA 2ES2A 1AA9A 1ZD5A 4M9CA 3DE2X 3SZRA 3VKFA 3ZTWA 3QELB 5JLAA 5CK5A 5J2UB 1AQLA 4HDSA 3ZDEA 1QONA 4QU5A 4C0WA 4FNOA 1OSNA 2I46A 1ZHOA 2ZAMA 5KYWA 1TF7A 1I24A 1QH0A 5EXDA 3WYNA 3HCPA 4D8XA 2VY3A 1M2VB 2PS3A 4FDVA 1ZYUA 4QL3A 4Q4AB 4I7AA 3QPBA 3SX2A 2BFBB 4KFCA 4D9MA 1S40A 1WCIB 3EK2A 3RFTA 4CLXA 3VNAA 4TN1A 2VK2A 2PKCA 4QPCA 1IBSA 2BY4A 4WASA 1N9GB 1SQSA 3BAFA 1SCBA 5KIAA 3D2CA 1HQYE 2GK3A 3WLHA 3BOSA 4X8HA 4L02A 1CEYA 3R4CA 4Q9JA 1FGBD 5DM1A 4B43A 4PZAA 1QB5D 5FWXA 1IYUA 1JU3A 2FR0A 3ZQKA 1VQPA 4JBMA 1XZNA 3LRXA 5AJVB 2YVKA 1LZKA 1L5QA 3H9UA 1AKNA 2JD0A 3PGMA 3I5YA 3S1RH 4TMZA 1B43A 4C07A 1U90A 3VYUB 1MR3F 1G3QA 3FPUB 2UAGA 2BE5D 3H5NA 4C4SA 3Q1LA 4DR1L 5CFOA 5KYYA 2QZSA 3J80c 3NGXA 1I3CA 3W2IA 2UZIR 5DGTA 3F47A 1SRQA 2O19A 2WIBA 5JALA 4TTIA 3X44A 1NQOA 3C16C 3OE7D 3OZTA 1E62A 3W4KA 3I91A 1XCBA 2H1WA 3L5KA 4FZJA 3ZGVA 3TDQA 3EA4A 4B3RB 4RKYA 2VHYA 3PI6A 3PC7A 3K0YA 3EOAI 3BGIA 1ATIA 4IIVA 4XWAA 5DU2A 3ZOKA 1T1EA 1NP3A 3PGXA 1Y1TA 3H91A 3JQDA 3T5PA 1E2QA 3IB6A 4GMFA 2FN3A 4C3JH 3GRUA 4Q9NA 3F3SA 5F78A 3KEFA 2H00A 5CB6A 1MO3A 3BIXA 3RPEA 1LPMA 2R7KA 5DI9A 1J1UA 4TS4A 4CNBA 5A4IS 1D0SA 5LIRA 1O89A 4DUGA 3RLOA 1G5PA 3EUEA 4JELA 4DLAA 2DTXA 3VC3A 3GHFA 3IR6A 1LTKA 1ZSYA 5IT9c 3GLHB 2Z8YM 5C3XA 1J99A 4YK7A 1HDIA 821PA 1DMSA 3B7PA 1GR1A 3DZ8A 2R93H 3GC6A 3K0AB 3MJHA 3N6XA 2XW6A 4MPDA 4O3FA 4PE5B 2J30A 5D6OA 2PEZA 4OSPA 3H1GA 1EG7A 4PY2A 3V00A 5CA1A 4ENSA 3A0JA 2OECA 1QKIA 3GJYA 5IYDH 4QQ8A 1J8FA 1ZCZA 3R75A 1KSHA 3BHNA 1E3LA 4FYHA 2BGUA 4WMLA 4MUKA 1FJGB 4CUKA 2R5WA 5LM3A 2DHQA 4RFBA 2XWBF 3GRCA 3JV7A 1M0WA 3NVMB 4RK4A 3TLGB 3GVKA 1U8TA 4MDHA 4UZSA 3EW9A 4A5SA 4ABTA 1SCUA 3MCAA 3DZBA 5EGTA 1GTSA 1QAQA 1R64A 1T4CB 1AVTA 3LUBA 3UUWA 3W2HA 1JJFA 1JQLB 1Y1LA 1DV1A 2ZBFA 3KXDA 4X1IA 3UXHA 4QOHA 3HO6A 3MJSA 1ISRA 2IXEA 4YN3A 3VI3B 4CM9A 1Y69U 3GFPA 4TZTA 4IURA 4DLPA 5EXXA 4RA6A 4EY3A 4ISBA 1VSVA 3OAAD 3IEKA 3DVQX 4EJSC 5FTMA 4D82A 2BEVB 2UUPA 4DQKA 1I4GA 3A8IE 2GRAA 2FPRA 4IJUA 2O4UX 1VF7A 2K87A 2XUKA 5JVH3 3F8WA 4IJQA 4BGVA 2HUGA 3HVRA 3BRSA 3K8QA 4A3CG 4L16A 4EJ0A 3OMLA 4K40A 3OW2A 3GUCA 4P5PA 4TWIA 3ZJTA 5DHQA 2PYDA 3F5FA 3RYHB 1L4EA 4C20A 4DB4A 1PZFA 2ZE5A 3HWX1 4MKGA 2C9YA 4ZU3A 3LE8A 5T8KC 1VJRA 5FBKA 5E0KB 3ZNQA 4BV8A 3N2KB 1ZCJA 4PZUA 2Y92A 1KYXA 4E7PA 1V3QE 4UBKA 4EGFA 1QX4A 5D8DA 3KVRA 1Q0TA 1VQ1A 1Q8KA 1G2OA 3IUYA 4I9HA 1YMQA 4NU5A 2PT6A 4PTZA 4AURA 2I55A 3FNFA 5IHXA 1PG0A 2QILA 4R31A 2NO9A 1TO1E 1W88B 2GNAA 2JVKA 3DPUA 4OB6A 4S1TA 4TYNA 5EJ9A 1Z4LA 4O4JF 1QFSA 3IT2A 3LCJA 3THSA 5HUHA 4M0FA 3MWYW 3FYTA 3QPUA 1UH5A 3UHPA 1IY0A 1JKIA 1UIMA 4ER5A 4G0VA 2D0IA 4NCNA 2JYOA 4DV0B 3QPCA 4KMSA 2XGJA 1IJFA 3BORA 3GDFA 4JX8A 3RT7A 1AUQA 1NLZA 5M5XB 3L1JA 4K3UA 4S1NA 1SNYA 5EJ7A 4D4MA 3TP7A 1CR6A 3I42A 1YOVB 4Y2VA 2D00A 3IPAA 1PFQA 4FF1A 4R7GA 3PUYA 3N8HA 2QTVA 2PSEA 4J6EA 4J7CA 2X4GA 4JI6L 4WOBA 2Q2UA 1VQAA 3L01A 3KR9A 2VWGA 1R18A 3DXZA 1I8TA 1OI7A 3BKXA 3FIUA 3G8AA 2V7TA 4KAAA 4MS3A 2C3YA 2KW5A 3O3CA 4CCYA 2Q2WA 3MFGA 2P2ZA 1RKQA 5FR1A 2VTVA 3DMYA 3LNNA 3ZTTA 1FTYA 4NZYA 2AFRA 3OTOQ 3F3KA 2HSZA 2XUJA 3AMUA 1I3QH 1E2FA 2W6ZA 4S2UA 5EKXA 5BVGA 1QUQB 5IWAQ 3BREA 3ASZA 3IRUA 1ZPDA 3THOA 3NVKI 4ZIRA 5KVCA 1X3PA 4BKPA 3TSSA 1L1RA 2XVYA 2B5OA 3H2BA 4KO2S 3K9HA 1UQRA 4BLPA 1SULA 1MV8A 1Z5WA 5JVDA 3TIVA 2CWPA 3GEPA 4HF7A 2OYCA 3RVQA 2I6QA 2LKCA 3TJRA 5E95A 2H2HA 5EVCA 5F5NA 1C4WA 4GI5A 4M3NA 2SDFA 4C6TA 5ICMA 2NMVA 5K45A 3VAYA 3NAZA 1PMRA 1X9GA 1DAGA 2QAGA 3CX8A 2JA7H 1Z45A 2QUZA 1IRIA 4V0NA 3SJAA 1WEHA 3B78A 3X3HA 2LBPA 4K5XA 3EFHA 3O83A 2XDYA 2SKDA 2P9BA 3CEJA 2NTEA 3H9JA 3LTEA 5HDQA 2C5CA 3WQBA 1IPFA 1AUPA 1FL0A 1FYVA 1MCZA 1IHOA 1XTKA 2BHTA 4M0MA 2R00C 4DNPA 2JCYA 3T3OA 2KCTA 2V7XA 3FUXA 4O2BB 4URHA 3FHOA 5IANA 3UWPA 2XGSA 2F59A 1Q1ZA 1QIKA 2I3AA 5FPPA 3A5ZB 3K15A 4LF9B 3U16A 2HIXA 4CBVA 5SYAA 4B4DA 4IL5A 3FSEA 3D0QA 4DUYQ 3KEQA 2DJGC 4FBMA 3K09A 4TMXA 2V03A 5DNDA 2ZG6A 1L8XA 3Q6IA 2LRHA 4LJSA 4EH1A 1SHUX 2AJTA 2NVWA 1GGFA 4U7HA 2V9ZA 1CR0A 1T6ZA 2WTMA 2ZIEA 3DYBA 1X80A 5HUJA 4HWGA 2Z9CA 3S6JA 2YWHA 1X7ZB 4WJLA 4B87A 3LBIA 4ZO6A 4PPNA 1H9KA 4F11A 3OTHA 3C3AA 1N5MA 4AY5A 5TIIA 3IMGA 5FTNA 4DJDC 2BH9A 1KI1A 3LY9A 1QG6A 4NL4H 2W0SA 3DB2A 1NE7A 1Q81C 5GQSA 2VPYA 4DWWA 4F2DA 2XCLA 2YQZA 2GDJA 4INAA 1E89A 1SFRA 1HMPA 5HILA 2FEPA 4UE3S 1QV7A 2QPOA 2X3UA 2ZR7A 4M0CA 4HOYA 4PW0A 2R44A 3CSSA 5H70A 3JATB 4O2LA 3SSNA 3VUFA 3W4IA 4BB5A 4F5YA 1U4LA 1BXKA 3AINA 3KDPA 1T6NA 4HXGA 4YIHA 4B08A 2VJBA 4BX3A 1YTUA 3HYLA 4RJJA 4WRDA 4OPMA 2PSFA 3SZ3A 4HYYA 4G7ZC 4HZIA 3ITPA 1TD9A 5DLQC 4TTTS 4YAIA 1GUNA 4DPGA 2V4DA 4R4IA 2FP3A 3D8HA 4JOBA 5DM4A 2ZJBA 4LDJA 5AVUA 1Q3LA 1E5TA 1Q7BA 3S2SA 3A6PC 3SHVA 2W6QA 2XNCA 3RYCB 4ZKCB 1DXOA 5E7NA 1H9AA 4RFSB 5JU6A 1TKAA 2O8CA 3A1FA 4QJFA 1OLSA 3DONA 3OM9A 4UFPA 2FEKA 1A4XA 2WAOA 1X65A 1A95A 3T4AC 1D0IA 3EC1A 4B3RL 3R5XA 4H4CA 4D9GA 2J3HA 1HDYA 1GHJA 1D7QA 2GXSA 2ON6A 3IPCA 1CT9A 2Q3BA 4UNNA 3LO5A 4EM6A 4M1MA 3H0GH 4TV9A 2PYIA 3FVQA 2WB1G 1ZKMA 4OX9B 4PFJA 2OV1A 1Z9FA 3SBDA 4LE2A 1N2EA 1U5CA 1CRLA 3TR6A 3LRTA 1SELA 5CCDA 2I5LX 1KYWA 1CY1A 3SVMA 2XMSA 1P17A 4GKVA 3GJ5A 5T4EA 4H7JA 3RSCA 1XTZA 4WK2B 2A69C 4HYEA 3THXB 3IE1A 3DFFA 1ZJ4A 3ADDA 4LRQA 1M0TA 2E4XA 5TS3A 5IF9A 2ZRGA 2IEGA 2CGEA 4OKNA 5AWFC 1KAWA 3TPFA 1XNRQ 2V7WA 3GEIA 2BFAA 4OJTA 3G9ZA 3LF1A 2A1TR 4HWOA 4BBAA 1AQNA 3WLOA 4HATA 5IP9G 3M4XA 1MG0A 5B55A 5I9PA 1OBHA 2BFCB 1H5QA 6YASA 2Q3HA 1HETA 1HT0A 1YJQA 1DRVA 4X65L 4IHKA 5EZYB 3HV0A 4EA8A 4ZI7F 4RPIA 3PL5A 1CLUA 1YK1A 4O33A 4RTOA 1H69A 2QX9A 2KHJA 2DWCA 4QQNA 2IUTA 2DY7A 2VZLA 2BSQA 4DZRA 5KNDH 4BMSA 1QE0A 3RS9A 2DFDA 1SXJE 1HSZA 2LNDA 4ZQBA 4DUYB 4HRXA 4RADA 3GPBA 1X7YB 4WGFA 2WMOB 1DAPA 2LKVA 1GUWA 4WZAE 4ZALA 3VQTA 3QDQA 4CIWA 2C7BA 1Q1GA 2CWAA 3K5OA 4EX7A 1S3FA 2QW1A 3CKKA 3KHTA 5LUAA 3W5BA 4ITRC 1BDOA 1EBBA 1GEGA 1D2HA 2A0KA 2C29D 3WK7A 4EELA 1I7DA 4ZOLF 4MNOA