4JC0A

Crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
432
structure length
424
Chain Sequence
RVGIKVLGCPKNEADCEVLAGVLREGGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSFVDAKDQYGYKLVVKGCLVQRYYEELKKEIPEVDQWIGVADPEEIANAIETDLVPDRYRKRIDLEERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Fe-S clusters catalyze sulfur insertion by radical-SAM methylthiotransferases.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Ribosomal protein S12 methylthiotransferase RimO
total genus 124
structure length 424
sequence length 432
chains with identical sequence B
ec nomenclature ec 2.8.4.4: [Ribosomal protein S12] (aspartate(89)-C(3))-methylthiotransferase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00919 UPF0004 Uncharacterized protein family UPF0004
A PF04055 Radical_SAM Radical SAM superfamily
A PF18693 TRAM_2 TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jc0A04
3.30.750.200 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A03
3.30.750.210 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A02
3.40.50.12160 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jc0A01
4OWTB 3UE0A 4B3RQ 4GKJL 3JAMi 1XPOA 3RZOH 3NELA 3U4ZA 4X65Q 2F4VL 2RF4A 1C0AA 3K80C 1D7QA 2QA4A 3H15A 1UE6A 4DV0L 3BU2A 1XJVA 4HIMA 4AQYL 3KOJA 1JMCA 4AIMA 1O7IA 4LFCL 2OTLA 1HR0L 3S16H 4P75A 4KHPL 1EIFA 4DV3Q 2JQOA 3M4PA 4PZ6A 3CCLA 1SR3A 3STBC 1K0RA 2EXDA 3E0EA 1YHBA 3U58A 1E3PA 4R4CA 2KCTA 2NVQH 4KLKA 4POFA 2OCEA 3I4MH 1HZCA 1ASZA 1YJNA 4DR4Q 2VQEL 5IY0A 5FJ8H 1Q12A 2MNAA 3K0XA 5IYBG 4YWMA 1N34Q 5ELOA 1FL0A 2PI2E 3KDFA 5C44H 5FLMH 3S1RH 1Y1VG 4GNXA 2K75A 3UDGA 1OTCA 1IXRA 1EQRA 3PUWA 2QGQA 5IWAQ 2VQFL 4DR3Q 2L15A 2VUMH 1C9OA 1P16A 1Q46A 1N36Q 3GTQH 3HOVH 4R4TA 5K36G 2BA0A 3HOYH 4QGUA 4BA2I 2JK8A 1XNQL 4NB3A 1K9MC 2Q2IA 4PZ7A 4DR6Q 1N8RC 3M7NA 2EIFA 5GROA 1EUJA 3KF6A 2JA5H 4O0AA 4A3MG 3K7AH 1PH8A 1BBWA 3GD7A 1TWGH 4A3DG 5AJ3L 2N3SA 3H0GG 3PO3H 4GN5A 3HOWH 1N32Q 1I6HH 2K5NA 3SGIA 2A19A 3PF4A 4IOAA 2Z6KC 4AQYQ 5GAGC 2K50A 2XTIA 1HR0Q 4KHPQ 4LFAQ 1L1OA 3PSIA 1L1OB 4YCWA 1TWHH 1PH4A 4GOPA 3S15H 5FJ8G 4LF6L 4LF9Q 3M9BA 1NTGA 2UUBQ 2B29A 4OWXB 4HJ9A 3CQZH 4BY7G 1U5KA 1BVSA 4DR2Q 4LF4Q 4A3MH 2VQEQ 3ER0A 1NMGA 4DR7L 3EN2A 4APVA 1X65A 4BBSH 4JI8Q 1QVFA 3CW2C 2ZTCA 3RLFA 4DAYB 4GNXC 4A76A 1N34L 4JI6Q 3BJUA 1CUKA 2CWAA 4GS3A 4IOCA 1YJ9A 3S17H 2IX1A 1J5EL 2B63H 4YCVA 4JI3L 5C4XH 2IT1A 4FDBA 4DKAC 1X9NA 1EYGA 4LFCQ 3CCVA 4OX9Q 1XPUA 2MO0A 2GVBA 4C2MH 1YITA 1RL2A 3TEHB 3A0JA 1MKHA 1VQPA 3E9IA 4BBSG 2MQHA 3J80c 1X55A 4LF9L 4GN4B 3CCJA 2UUBL 3CC2A 1IBLQ 1R9TH 1UE7A 2NVYH 4A3CH 3F2BA 1B70B 1K8AC 2VW9A 1CKNB 1VQEA 2QEXA 4A3FG 1HZ9A 1K8GA 2F3IA 3U4VA 1N33Q 3H3VH 2YTYA 4HJ7A 4ME3A 3PUVA 3S1MH 2OTJA 1MIUA 2NZHA 4NXML 1HJPA 3PUYA 4DV4Q 4HIDA 5IP7H 1EOVA 3G6EA 1T9HA 1PH5A 1OXTA 2KHJA 1YEZA 1VQAA 1L1OC 5FLMG 1PH1A 4A3BG 2YU9H 1TWCH 3EIVA 2JA5G 3AFQA 1CKOA 2I5HA 3I7FA 5IYDG 1AE2A 1M1KC 1PVOA 3NBHB 4Y7NH 4LFBQ 3G4SA 1YJWA 2Q2HA 2UUAL 3FKIH 4A3GH 1EFWA 3K8AA 4DUYQ 4A3IH 2XGTA 5M5WH 3BZCA 4KI0A 1VQ9A 4K0KL 5BR8L 1I5FA 4DR6L 1I3QH 2ZTEA 2WAQG 2WFWA 3T1HQ 4JI7L 1A63A 4AYBG 4NPSA 3S14H 1GVPA 1UWVA 1V9PA 4YHHQ 2AWOA 5C0XJ 4DV1Q 4LUVA 1PHJA 5M3MG 1IBMQ 4OWWB 1W2BA 1PA6A 3F8TA 3L0OA 2RHSB 4JI2Q 1VQOA 1Q8KA 1Q81C 1JB7A 3M4OH 5C3EG 2UXCL 2D0PA 2Q2UA 4OX9L 4DR5Q 3AFPA 5J3BA 3OTOQ 2NVXH 1VQFA 2UU9Q 2D0OA 2ASBA 3J7A5 2N78A 3L7ZC 4J15A 1FGUA 1HR0W 1JJGA 5LMNW 4MNOA 3STBD 2UUAQ 4A3JG 4ALPA 1KL9A 4A4IA 5IP9H 1XMQQ 4P72A 4JYAQ 3TREA 1XPRA 5C4XG 4LF5L 1IYJB 3TS2A 4GOPC 1KIXA 4A3BH 4DR7Q 3I55A 1CSPA 5GADC 4DK6C 1XMOQ 1KAWA 4BY1H 3I4NG 4JCVE 4GKJQ 2A1AA 3ULJA 4IO9A 1S72A 1VQ7A 4NXMQ 1VQ6A 1X3FA 1AE3A 3A5ZB 4TQUS 1VQBA 3ZJYC 4GNXB 3TRZA 2VS1A 2JA9A 5C3EH 4AH6A 3F2CA 4OO1I 4OXPA 5LMNQ 3TS0A 4A3LG 2K5VA 1K83H 1Q1BA 2DGYA 1QZGA 1RIPA 3IRBA 2VNUD 1YZ6A 4DAMA 1N9WA 3G71A 1UE5A 1JT8A 3M3YH 1Q82C 3NENA 5BR8Q 4DV5Q 1K73C 1BKBA 3J81i 1YVCA 3RZDH 1KC8C 2IY5B 3D31A 4DUZQ 2R92H 1A0IA 1VQCA 4C3HH 1P8LA 2RCNA 1WI5A 3MXNB 4X62L 4LUOA 3T1YL 1HNZQ 1OXXK 1TXYA 2UXBQ 5JEAJ 4DV4L 4A3EG 1S40A 1KXLA 4X64L 1SRUA 3PV0A 4IFDJ 3UDFA 4DV0Q 3PIPA 4JV5L 2UXCQ 3I2ZA 1Z9FA 3HFZB 3EBEA 2YV5A 4AYBE 1WYDA 2AMCB 3JC66 4MTNA 4JI1Q 4A3KH 1VQKA 1YI2A 2CKZB 4X6AH 1JJCB 2ZTDA 3GO5A 3DM3A 3MEFA 4P73A 5IE8A 4GLXA 3OW2A 2E8GA 4HIOA 1PH6A 1N36L 2VL6A 4IPCA 1EIYB 2JA7H 1UE1A 4JI0L 4A3IG 1XNRL 4QY7A 3KJOA 3KJPA 4A3EH 1PH9A 2WB1G 2LXKA 3RLNA 3H3VI 3J81j 1QUQA 4UY8C 2HHHQ 2ZJRA 4YHHL 1PH2A 4JBJA 3HOUH 4DR1Q 1XMOL 4B3TQ 4YCUA 3I4OA 2NZOA 4A75A 3CC4A 2AKWB 3GTLH 4JI8L 1G291 2I5MX 2UXBL 1LM0A 4RMFA 5AJ3Q 2JA6H 4HJ5A 1E22A 1HNWL 4JBMA 3PGZA 1X3EA 2ZM6L 4BXXG 3HOXG 1DGSA 4JI5Q 3CCEA 2H5XA 3GTJH 1PFSA 1VQJA 4DR5L 1KHIA 3AYHB 3OTOL 1Q86C 3RN5A 3WWVA 4HIKA 3K7UC 5M3FH 4WJ3M 1G6PA 4LF6Q 5IYCH 1HZBA 3L2PA 3UE1A 1YNXA 1MJEA 3CPWA 3ICEA 4R1JA 1GD7A 4DV2Q 1X3GA 3GTMH 4JOIA 3S1QH 1EWIA 4JI4Q 1PH3A 2ATWA 3A5UA 2UUCQ 2KENA 1IBKQ 3S2HH 3HOZH 1U0LA 1G51A 1HNZL 4JC0A 1VS0A 3W1BA 4DNIA 4BY1G 3I4NH 1GO3E 3RNUA 1NJIC 1E1TA 3DLLA 4OONA 1SFOH 2CFMA 3HOWG 4X64Q 2HT1A 3PO3G 1E7ZA 3W5OA 3HKZE 1BBUA 2HIXA 5M3FG 1KD1C 2NVTH 3KFUA 1CKMA 4IJLA 4A3DH 2MFIA 1QVGA 1FJGL 1B8AA 5FLXc 3W1GA 2B3GA 3UDIA 4C3JH 5C0XI 3Q8DA 1Z47A 1QZHA 1XNRQ 4A3LH 2JA6G 4O2DA 1Y1WH 4GN3B 1KQSA 4DPGA 1PYSB 2LXJA 4GLVB 3T1HL 3KDFB 1VQ8A 3CXCA 5M5XH 1S3OA 5C44G 4B3RL 1VQMA 1CKNA 2OQKA 4LF8L 4IPDA 1D8LA 2NN6G 4XIGS 1WCMG 1W3SA 3J81c 1HNWQ 4JV5Q 2ZM6Q 2WB1E 4GKKL 4QQBX 2OQ0A 4IJHA 4DV7Q 3B6YA 3CC7A 4B3SQ 2E2HH 3ULLA 3I4MG 3UDXA 2JE6I 3S24A 5H1SE 4LNQA 3HOYG 3M4QA 1HH2P 2PMZE 3HOVG 4L5SA 3PO2G 4LFBL 4R4QA 4DV3L 5GAHC 2Q2TA 4K0KQ 2HQLA 3J80i 2IHEA 1VQNA 2KHIA 3LGJA 4DV6Q 1VQGA 1ASYA 1E24A 1KRTA 3VDYA 2K14A 1JE5A 4BA1I 4IFDG 1IBKL 4B3TL 3CMAA 3RLOA 1XTDA 4YWKA 2E2IH 1NY4A 4MZ9A 4X65L 2F4VQ 4HJAA 5GQOA 2K52A 3J7ZC 2N49A 1WJJA 4JI2L 2UXDQ 2CCZA 5LMNL 1V1QA 2Y0SG 2YTXA 5EAYA 2BH8A 4EX5A 2KCMA 1OXUA 1FJGQ 3CP0A 4PMWA 4JOIC 3F1ZA 1SMXA 1SROA 1VQ5A 2V1CC 3S2DH 5IYCG 5C4JH 1QUQB 1YHQA 3K81C 4DV5L 4LF5Q 1SE8A 2K5HA 3OYYA 3CCRA 4JYAL 4LUZA 1Y14B 3CPFA 3HKZG 4L5TA 3A74A 4R4OA 1PH7A 1NBWA 2BA1A 2IX0A 3KF6B 1X56A 3U50C 4YY3L 3FHWA 3I56A 4EQ5A 3ULPA 2VY3A 1SLJA 5LMUL 2E5LL 1UEBA 4KHZA 3FP9A 1QVCA 5M3MH 4LF8Q 4JI6L 5HGQA 4L5QA 4B3MQ 1B7YB 3CCSA 1K3RA 2WAQE 2LSSA 5IT9c 5C0XG 4GKKQ 4IFDI 4UP7A 5ELNA 3CCMA 1Y1VH 4B3SL 2UXDL 4GLAC 5JJIA 4LFAL 1WOCA 2F52A 2N8NA 5IWAL 2VQFQ 3HOZG 4JI1L 4GOPB 2GN5A 3RN2A 3KYHC 3CD6A 1Q1EA 3NEMA 4A3FH 1TWAH 1EQQA 1V43A 1IL2A 3PIOA 2CWPA 1YHAA 3KF8B 1OXVA 4P74A 4QL5A 4A93G 1CSQA 1LYLA 1Y1WG 4LF7L 2JEAI 2MO1A 4JG2A 4OO1G 4X62Q 2YTVA 4DK3C 1GM5A 2R93G 2HIVA 2PQAB 2ES2A 3TQYA 4YY3Q 1YBYA 4NXNL 4DR1L 3T1YQ 2D62A 3E9HA 3PUZA 2GVAA 4L5RC 2OWOA 5LMUQ 1FVIA 2JEBI 1LTLA 1MJCA 3F2DA 1PV4A 4UPAA 2JA8G 3KLWA 4X66L 3HOXH 4BY7H 3CMEA 4JBKA 2ID0A 1J5EQ 4DV7L 2PNHA 4Y52H 4HJ8A 4A93H 4A3CG 3JAMc 4JBWA 4C3IH 1Q7YC 3S1NH 4UP9A 2RHQB 1J6QA 2BH2A 4H02A 1HNXQ 1PYBA 5JJLA 4JI0Q 1VQLA 4PG3A 4BBRH 5IP7G 1JJ2A 4DV2L 4DV6L 1VQDA 3M85A 1IBLL 1GKHA 1X6OA 4BXXH 5JJKA 2R7DA 2Y0SE 3G48A 4YWLA 4JI7Q 1VCIA 3PO2H 2JJQA 4DR4L 4UP8A 2Z6KA 1VQHA 4PZ8A 2PQAA 4NXNQ 2JA8H 3HKSA 4QIWE 3CCUA 1C7YA 2A8VA 3D0FA 3CAMA 4IPHA 4WJ4A 2I0QA 2VZAA 5E7NA 4JI3Q 1H95A 1KRSA 2AHOB 1HZAA 3GTPH 1L2FA 1NMFA 4R4IA 3CCQA 3HOUG 2VUMG 3PCOB 2Z0SA 2FXQA 3BZKA 5DLQE 2R93H 5IP9G 4DR3L 4A3JH 1A62A 1TWFH 1E1OA 2B63G 4BBRG 2R7ZG 1HNXL 3GTKH 2R6GA 1A8VA 2YYZA 1NE3A 1XNQQ 2JA7G 4LW1A 2NN6I 4LWCA 2IHFA 3CF5A 1I94L 2HHHL 4A3KG 4JI4L 4IPGA 2UUCL 3AQQA 5GAEC 1N33L 1VQIA 4RG1A 2K4KA 2ZJQA 2E5LQ 4DV1L 1M90C 3H0GH 1WFQA 3PF5A 2C35B 2E2JH 1IBML 3GTOH 2AWNA 2PI2A 1X54A 2I5LX 5M5YH 1YIJA 4B3ML 3AEVA 1LUZA 2ALYB 3ERSX 3GDEA 4X66Q 5HY6A 4JI5L 1N32L 4P71A 4XTCS 2EQSA 2WP8J 3RR5A 2ZJPA 1AH9A 1I50H 5IYBH 4TVAB 1IZ6A 2UU9L 4DUYL 2R7ZH 2CQOA 2DUDA 4POGA 1XMQL 3FKIG 4A3GG 4QJFA 2R92G 1WCMH 2KBNA 4LF7Q 3GTGH 2R7FA 1L0WA 5IYDH 3PUXA 1OXSC 5JEAG 4DUZL 1I94Q 1SN8A 4DR2L 4LF4L 1VQ4A
chains in the Genus database with same CATH superfamily
2ZDHA 1DCTA 4W7HA 4RTLA 1V2HE 1A9XB 2QTRA 2ZWVA 2C94A 2F4VL 1H6CA 1O03A 1OYYA 1X8KA 2P75A 4U2KA 3PDCA 4RV4A 3ZEIA 3K80C 1H4YA 4EJMA 5B7GA 1XXGA 2QRPA 4EHAA 1THZA 1YOVB 3ZWOA 1Q1GA 2YQ5A 3EIEA 2ODNA 5DHSA 5CDUA 1Z0AA 3I1FA 2IOHA 2EYQA 1M6VA 4L3WA 2CJWB 3GJZA 6Q21A 1S5CD 3CVXA 4G1MB 1VLQA 4Q3LA 2A6HD 1JG7A 2P9EA 4GZMA 3F6BX 4PWZA 2VRNA 4LGMA 3CCLA 1AU9A 1J7JA 3L8FA 1C80A 2F0DA 2GCGA 2AYYA 2FZCA 1X80B 3H3XA 4PG8A 3FCOA 3G2LA 3E9CA 1PQWA 3HN6A 4DM7A 3U58A 1IJEA 3I4CA 5K0SA 2KCTA 1IVNA 4POFA 1PG2A 2FRDA 1GPDG 4DV0B 1CU1A 1Q6YA 3OJFA 5E3FA 3RG2A 1ARZA 4EA7A 3N0XA 1BDIA 2Q4BA 4YJ3B 2YVUA 3HA7A 4JI1B 1V3QE 1HE4A 2ZUUA 4JYCA 3TVDA 2QD4A 4L07A 1PV1A 4G25A 4N7MA 4QOEA 4WZAA 4J0EA 5IYBG 3IR5A 5ALLA 4KRXA 4F2GA 3QEMB 3DL0A 4GSKA 2C2ZA 4C21A 1WY5A 5BNIA 4TKVB 3ZVRA 3W79A 1I3KA 2PMZB 3DE6X 3G0CA 2F1IA 3GUYA 3H2BA 2ZKIA 1RAHA 2EDCA 3I30X 4M8SA 4N01A 4KV6A 5FLEX 1FNWA 3HB0A 5BN4B 5T57A 3SP1A 4U7DA 5BSUA 1WP9A 1EE9A 1LSJA 3CZAA 1SYGA 5IWAQ 1KO4A 3O94A 4D43A 3SIRA 4EI9A 1E4OA 5KYIA 2Q2WA 4O4JB 1GQOA 4Q1DA 5B6JA 4JLKA 4QGUA 4BA2I 4EGQA 3KR9A 2A5FA 2JA2A 4K2KA 2ZJ3A 4DBVO 1H2AS 1X39A 3D4PA 2VPTA 1MO3A 1NATA 2Q5QA 2X22A 4NSNA 1NVVQ 3A8TA 5EPJA 2FSVA 3T9DA 4GBED 2FE1A 2SDFA 5SV2A 4G4GA 3A3PA 1MKYA 1CSEE 2GAIA 2P0AA 4YN3A 1COWA 1I2BA 3K31A 2F0WA 3IJRA 4I7ZC 2JANA 2VNSA 2ID7A 3OX1A 1BHJA 1DWPA 3U4CA 2LDBA 2LMCB 2ZUVA 4ZAFA 4GN5A 2FK7A 5ES3A 4YUVA 4G7HC 3B78A 5JTTA 2O06A 2RJNA 3UUGA 4BE9A 4ZO4A 1G2PA 1M72A 1RQPA 2GTIA 2Q7OE 2R79A 1TS2A 2Q2QA 1PH4A 3LX5A 4GNKA 1TWHH 1XF9A 1Y3HA 2EQBA 4MS4B 3RGWS 1IK4A 2F17A 3JD1A 1MQSA 3ERCA 2CDCA 2IV2X 2HIMA 4GHNA 2K7FA 2HBYA 1PJQA 1G16A 4V02A 2C4WA 1O2DA 3UMMA 4B3MB 1XRMA 2JFGA 4X64B 2FETA 2XWJI 1WB9A 4ALMA 2BI7A 1KORA 1IJKA 3D8TA 4NEHB 5BXQC 3W7AA 1ESCA 1K3FA 2W6JA 3EA5A 1RWNA 5F2NA 1A5BB 1BA2A 1JLSA 2I99A 3CB2A 4KE8A 4E4RA 3HB7A 4QGBA 4Q12A 5BN5A 1U9IC 2O23A 5AKIA 5EWJA 1DZ1A 1EK5A 1LGYA 3G3EA 1RYYA 3INRA 4GGPA 2HY7A 4PYIA 4KPUB 5K6RA 1UADA 4BB6A 1BGVA 1A04A 1H8HD 2ZRBA 3ILYA 3IP5A 3GEBA 3IUSA 1E98A 3GJ8A 5H1YA 1PVDA 3V00A 4IGEA 4QDZA 2NVUB 4GOND 4EYOA 1NUAA 4X62B 1DSSG 2M6KA 4OIFA 3TLGA 1RL2A 5EWLB 4B8ZA 3CFYA 5EWMA 3V6MA 2ZYIA 2QX6A 3L4BC 1S5BD 2MQHA 1AUZA 1T35A 1G1MA 2O07A 2WP0A 3ED5A 3F8SA 3M89A 4JT8A 5K8TA 3OZVA 3BQ9A 1HTLD 1IHYA 4U3JB 1F77A 5FXMA 1USIA 3WTBA 2DCUA 2XB8A 1D1QA 3B82A 2QW8A 3LUKA 1ZHOA 3MAAC 5F1YA 1B70B 2IUSA 2LTAA 3MHPA 4Y2VA 2VSFA 3WYNA 3RIYA 1JEJA 2YBEA 4A3FG 1XXHE 4BMPB 2RG1A 1MGPA 4KNWA 4DLKA 2BYTA 3LV8A 1SHLA 1II0A 2AMJA 3A10A 2V1UA 1YVPA 3SK4A 3H7IA 1GVNB 4LGCA 4X44A 1YA6A 4DN6A 2EFHB 1WTPA 1YDMA 4FU0A 5AW9A 1BFUA 1G4AE 1L1OC 4J2TA 4PAWA 1Y8RB 2RI0A 2GFQA 3GARA 5HQJA 3UGKA 3UK0A 5BV8A 3LTNC 1CKOA 1STBA 2BRUC 2ZE8A 1PNRA 5F9FA 1DGQA 3G5MA 1T4MA 2WMOB 2HRDA 5BV7A 4FW8A 3ZY6A 1UINA 2IY7A 4HF7A 5JS8A 2AFIA 2REXB 3CUKA 1V8QA 2EU8A 1IY0A 3CY6A 3PEVA 4KDRA 4RLQA 1DRJA 1L0BA 1SYFA 4GLBA 3NDPA 2WFWA 2C58A 1WVIA 1A63A 3NORA 4FCVA 5CIWA 1HDIA 3BRWA 3ENVA 4IO0A 3RBZA 1TMOA 4M76B 2QRUA 3IXLA 2Z95A 4TT3D 1PHJA 2DFPA 2WU1A 5HBRA 4F5EA 4EKYA 2O8DA 1KQ3A 16PKA 4A82A 4DNPA 1RD9D 3VNUA 5AMXA 2QTMA 5DGCA 2NU8A 2NU8B 5HR5A 4JD5A 5T3UA 1JS1X 1RMQA 4I2VA 3QEAZ 3FPPA 1HL7A 3IAS6 3WOFA 4II7A 8OHMA 3FN4A 4FQ8A 4EHKA 2UU9Q 4OELB 4K2HA 5K8VA 2K7VA 1MC4A 2C2YA 5BSWA 2NGRA 2I2CA 5CXUA 2Q4RA 1QK3A 4A4IA 4Q21A 5AVTA 3M34A 4UUAA 3BTOA 2WZQA 2EJGC 4NCIA 3GPLA 1YVUA 3ZWMA 2CFIA 2I3BA 4DR7Q 1IEVA 2IFTA 1NQUA 3H1BA 4I1OA 2HMYB 1YR6A 1KAWA 3KYBA 4GKJQ 3EMBA 1QYDA 4LMRA 3FDZB 1IXYA 4FR2A 2VTBB 4MQBA 4ECAA 1QJCA 4M0DA 1VECA 3GJRA 2V74B 3L6DA 4X8OA 4D9BA 1OTYA 1PCXA 4I4TB 1BO6A 2OBYA 1YBHA 4OHWA 4AH6A 1FPQA 2XXBA 4PBTA 4PTYA 2YV2A 1Y8PB 3T7RA 3TEMA 5CCXA 1QG6A 1FW6A 3KVVA 1PGOA 1SXJC 1QZGA 5GONB 2M6LA 1NV8A 1QOQB 4GYJA 2E76C 2VH5R 3C3BA 3BGVA 3CV3A 5KSPA 2BDTA 1L3IA 3L4JA 2JIOA 1JQLB 1A3UA 3MGAA 4RGYA 4DADA 1POXA 3ZLUA 4L6IA 2QLFA 1ZL0A 2EYPA 5EZBA 2D7CA 2R4UA 3SEQA 1CUJA 2HHJA 4E7PA 5IVPA 2QORA 5U9CA 4RTPA 4NCAA 2R92H 1HXYD 2QF7A 3EFHA 2B1RA 2XWJB 3I42A 2BEWB 4YRTA 5BNTA 2ADOA 3QE0A 5L7WA 1GGMA 2JG3A 4K40A 2G76A 3KCQA 1X1TA 2UXBQ 1YACA 5CRIA 2NLOA 3D6HA 1ODIA 3BXGA 3QU7A 5L7YA 2NUTA 1CQJA 2R85A 4YCSA 4F7XA 4X64L 1D09A 3AESA 2DYKA 4Q39A 4EOGA 3CZ5A 4E5SA 3OQPA 1C81A 1QTRA 2E48A 4E11A 2BHLA 4OYHA 4O1HA 3TPZA 2J3LA 4FFMA 1HPLA 5IZCC 2O52A 4JZKA 4TWJA 4X8LA 4ZANA 1ZI6A 2G07A 1PH6A 2PMWB 4P73A 3GWGA 1KWGA 2E8GA 4RTJA 1CEXA 5LWQA 4O3MA 1Y8AA 5GIOE 2J0VA 1CM9A 3E22B 3OFVA 3NP9A 3GRAA 3H3VI 1S96A 4BCCA 2KQ3A 2ZJRA 1O94A 4PVDA 3KLPX 3N28A 4JBJA 3OAAD 4JLSA 4RKYA 3AKEA 3SVZA 5C8ZA 3D6AA 1N36B 1EKXA 1O89A 1G291 2B8JA 3O2JA 3O38A 3Q7QA 5DBGA 3U7FB 3IMCA 2D6FA 1QP8A 3PYMA 5A3JA 2DM6A 3IAFA 4ZREA 1ZW6A 3NMUF 5FBKA 4AJJA 1QFJA 4NOJA 3CXUA 3NU1A 1JG3A 4FNGA 1I9GA 3WX0A 3I73A 4DGFA 1TTHA 3SHVA 2Y68A 4Z8YA 4OQNA 1GNQA 4MV7A 1NSNS 5ESRA 1IY1A 3WZMA 3CBGA 3F6RA 4UM8B 4ER5A 2E5LB 2BFCA 3OTGA 4MDEA 3ICEA 4D44A 1NXPA 2PUTA 4YQFA 4W8GA 4TQGA 1M1UA 1MRZA 1TGYA 2JFZA 2LW7A 3QPDA 2OO5C 5DCWA 4JI4Q 4CCWA 5IJ0A 5D87A 2X9NA 4OSEA 3NXWA 2WJPA 1NU8A 3OSUA 1KNAA 4NYJQ 3LPAA 1FS6A 5CCEA 4KHPB 4LDRA 4N3CA 1HX7A 2XMZA 1VLHA 4RVUA 4EG0A 2X9VA 3HOZH 3P7MA 3W77A 2RAUA 2EQ5A 1KERA 3TDKA 5LQUA 1R0XA 4YYZA 2J0UB 2P68A 4MQEA 3RFFA 2HRZA 4LZLA 4QDUA 2ZO9B 4P4GA 3HOWG 1OYWA 1GQFA 1E7ZA 1B76A 3IEMA 1XB2A 5M3FG 1RM3A 2E82A 4OJNA 1SXGA 2CVFA 5JRJA 3NPPA 2VZEA 3I39X 1ZOIA 4D0GA 2JSOA 4MW5A 2HWUA 5D85A 4Z9FA 6ABPA 2VDWA 2E21A 4FQ5A 1DC5A 1B0UA 3ZQ6A 5C5MA 4UMDA 4EMTA 2XUGA 4C3JH 2I6SA 4LSZA 2EL7A 4IIJB 4RZ3A 5BWOA 5TNXA 3ZCVA 2XCTB 3AL2A 2VP5A 5FLXA 2FAXA 1MVLA 5H9WA 2ICAA 1NULA 2J3DA 4LRYA 1SBTA 1S4ZA 1AIPA 3UF0A 4DXHA 2PL5A 1I3MA 4HG2A 1CUWA 1L1QA 4MV0A 3PFIA 4IJ5A 2EOTA 2ONKA 4WV3A 1DAHA 5AKXA 3SN6A 4DB2A 4RLFA 1P18A 3TQTA 1QP7A 4YCDA 3RGGA 4R8IA 3EIHA 5C4HA 3GFPA 2EL9A 1ZD2P 1UPXA 2QDLA 1Z7EA 4M53A 1JJAA 4N39A 5HZGA 1OPXA 2LY7A 3Q72A 3VJKA 3AIIA 4TLAA 4L63B 4N7RA 4MKZA 5AK3A 2BGKA 3QUAA 1U7DA 3KR0A 2K05A 3VR4A 2OEPA 4DV3L 4LOAA 3QW4B 3WLSA 4RHUA 1W93A 1GHJA 1WG8A 4EKNB 1EE2A 1HYHA 3NW9A 1IK6A 3HKDB 3W8DA 4Y9DA 2B4RO 4ZUIA 4MUGA 5EBCA 1LBTA 2LS01 3S44A 3SQWA 1JE5A 2C99A 4C4ZA 1WV1A 1Y1WB 4MJXA 2GEJA 3RK0A 4J07A 5JJBA 2NU6B 2DJIA 2FG7C 1U4PA 4E13A 1NJSA 1X0VA 5F7JA 5M3FB 3T94A 2I91A 2O1XA 1B00A 4WDQA 4ZYVA 3DMHA 3PICA 4MUYA 2BCOA 2JCVA 4XLZA 2KCMA 2QMZA 5HOEA 3MT9A 1FJGQ 1CQZA 2IEBA 4UE2A 1HTBA 3EDYA 1IBMB 3IJEB 4B9XA 1LUAA 1SC4A 3H7AA 5CX1A 5AR1A 1BOOA 4YR7A 2V1CC 2H4YA 5ALYA 4JC5A 3IEPA 2GXSA 5BWCA 1Z8DA 4B7AA 1EG2A 1T2CA 2HQEA 1UJ4A 2DLNA 2DJ5A 1SE8A 1PW5A 4JSTA 4LIPD 1A0OA 2I6XA 3HKZG 2VA8A 2X0RA 5REQA 1B6RA 5ANRB 4ND3A 3MS7A 4BGUA 4DMUB 5J4KA 4LFAB 4CFZA 2L82A 2XOXA 3KYCB 1ND6A 3KLNA 3H11A 5D1NA 3VZRA 3SBOA 4CKCB 2GXAA 3PEYA 2AR9A 2NVUA 3IDAA 5I7UA 1XYGA 4B3MQ 1Z8HA 2A1IA 2RMKA 3ICCA 5ALPA 5ILQA 4TKVA 4ZJZA 5IK2A 5CA0F 3DWFA 1R6XA 3EE6A 2ZJ4A 4IHJF 1HFNA 2FUEA 1WSDA 2PX4A 2B4AA 2HBRA 3DMFA 1J1IA 3BG5A 1ORWA 1ZGHA 1R8SA 3IVRA 4Q4JB 2B1QA 3IELA 2RGCA 4JI8B 2G83A 3AZQA 5LZ2A 1JYFA 4PYRA 5AM5A 1LK5A 2D2IA 1V43A 2J67A 1THTA 4J03A 3PIOA 3AT1A 3I53A 1UWKA 3PPVA 2OLJA 3KF8B 1WUYA 3KF8A 1GVHA 3I2GA 3NKFA 4L5AA 4ZCPA 4KYIB 4ZJYA 1Y1WG 4MUFA 4EVIA 4OO1G 4X62Q 1YVEI 1QH1A 4R98A 1KZ9A 4V3CA 1I6WA 3LXMA 4RH1A 3NANA 5ENDA 2ZROA 2X23A 3T1YQ 1RPNA 2FF7A 2CL5A 2YZMA 4HI0E 3F0TA 3ZR4B 4F7DA 2PQEA 5EOVA 3HBJA 1OVMA 3C43A 4BLSA 3LNNA 2A0YA 1E2EA 3LNCA 2VAPA 1N3BA 3ODPA 4DKXA 1HTWA 1R5OA 2PCFB 2PSEA 3OVMA 4OYLA 4YRZA 4HJ8A 3ILXA 5FT9A 1KDYA 1KAAA 4IRUB 4BRSA 1FX0A 4C0AC 3MT8A 3Q1KA 4DEYA 2NYRA 5ADWA 3P26A 4H02A 1ZIDA 1CI3M 1PYBA 2HSDA 4Q48A 4JI0Q 1NTRA 4FHCA 1SQGA 5KYUA 2C03A 2WTEA 4ZYZA 2CHGA 2GX6A 3AYZB 3H5AA 4BNLA 2IBSA 1NUTA 1HYQA 3D3WB 5JJKA 3Q7IA 4AROA 4ZYYA 5M5BA 1XWFA 3VYTA 2M98A 4Q1CA 1EVQA 2CMKA 3O8QB 3CQZB 2X40A 4JMLA 1E3SA 1PXUA 2FPSA 2FRDC 2CD7A 3NOXA 1U9YA 3BJRA 3KXLA 4RKWA 1PTOF 1J8QA 3OE5A 4IDOA 3TAUA 2JZCA 1HY3A 4IPHA 2HMWA 4U39A 1RP1A 3UMBA 5IYZA 1QDUA 1EP2B 4JGIA 5CBEE 3DEZA 2V3CC 3ORHA 2J6HA 5EZ6B 1LK7A 2XCUA 1T8UA 3C87A 1CZUA 4ZI2A 2HHHB 5DN9A 4Z4GA 2F90A 3R6GA 3UAWA 3MAQA 1YC2A 2QVGA 1MW9X 3N7TA 5SYNA 1JVSA 4CXMA 1QU3A 4YGYA 2PJZA 3NAZA 3O8CA 4QWWA 2B63G 2HXSA 2A9KA 3TTWA 3UAOA 4OA5A 1YFKA 1A8VA 1AN9A 1EFVB 2I66A 3AJ8A 2JA5B 3IFSA 3IPCA 3QOLA 1F3LA 1NNLA 1Z5GA 4UCFA 2ZWIA 3DZGA 3FWNA 4OB8A 4AMVA 4N82A 1VYVA 4UEWA 1J21A 3A4VA 5C31A 3OESA 2AQ2B 4CKZA 4OHOA 1R50A 4KE7A 3DUFB 1J00A 3GTOH 4K8IA 2C35B 3ACCA 3GELA 2P9ZA 4KGZA 4UULA 4EQPA 1AKVA 2BP7A 5CDFA 4DDHA 4C1BA 1NG9A 1GZHB 4DMGA 1IOWA 1P39A 2PO5A 3B9PA 4X66Q 3QVMA 1T24A 3S2DB 4KQFA 3SQOA 2IEDA 4AF8A 1DQZA 4DLSA 5T6BA 1KE2A 4GSLA 1OFIA 3GIDA 4W4TA 5JPCA 1BWQA 3WMGA 3W3AD 4DR7B 4OFXA 3VZPA 3EBLA 1OZHA 3QPCA 1ZH4A 1GAXA 1A9QA 3QXXA 1PUXA 1ENCA 4TVAB 2UU9L 1C3VA 2DUDA 4TSSA 3R8XA 1XMQL 2JL1A 4KRYA 3TL6A 4DUGD 1V1JA 2VUIB 5LD2C 4BN4A 2J7KA 5ALOA 1EB9A 3MPUA 3D5QA 4IW3B 4QGGA 4PG7A 3T4EA 2WIJA 4ROSA 3CRKC 3UM9A 3H4VA 3EJ6A 3PGLA 1UK7A 1SCDA 2G0TA 2GN8A 3AF3A 3BAZA 5F1KA 1ZITA 1OBVA 5CA0A 3W5JA 2H57A 4NYJR 1F0YA 2FWJA 1HCZA 2XADA 4X65Q 3BTUA 2AQ8A 3GUVA 4H7KA 1VM6A 2XWSA 2ZIWB 1ZHFA 3MWYW 1WV0A 1D4ZA 4N0DA 1YWGO 3T61A 1AF4A 3KSZO 5E8JA 4PNEA 4GHWA 2BSAA 4DUZB 4WACA 2O4XA 2PXAA 2N3ZA 2QAGA 3AHJA 2TSYB 5K3AA 1CQIB 3CZPA 4HFJA 2CB0A 5FPQA 5H9VA 5LZ8A 4P75A 3I61A 4LCJA 4YRFA 3GLUA 3WYFA 1HUMA 5KYWB 4ZMRA 3G0HA 2EG9A 4WKGA 4FUTA 3E3MA 4KN5A 1FW8A 4IIJF 1PL7A 5IVHA 2PRKA 2LGJA 4CIAA 1E3PA 1QFZA 1XZJA 4HZUA 1ISSA 5JCOA 1YJ8A 4A2WA 1P29A 1SC6A 5AM1A 3FWKA 4Y6QA 2I2DA 4HAEA 2JCSA 1J0DA 4QOJA 1OA0A 2WYVA 1B3BA 4X45A 3T3EA 4HQLA 2B20A 4Z0HO 3T7EA 2QSYA 6YASA 2JARA 4F4FA 3ESQA 3EH1A 2XOKA 1N34Q 2EHJA 1E7YA 2O0KA 4YYEA 3U7QB 4KVZA 4H1WA 4Q9DA 1ECCA 3PMFA 1A2QA 1KR5A 3H0EA 1YS6A 1JDSA 2XIJA 4OHPA 3WMWA 3IAHA 5KSYA 3NBFA 4NZYA 1RIIA 2FN7A 3E3LA 3ZH2A 5L3QB 3B20A 3L9WA 2D00A 4BLQA 4JBXA 1Y3FE 1RKVA 1R4QB 1LJUA 4DR3Q 3EAQA 3QTBA 3FVQA 1JOQA 1Q46A 1N36Q 2FOIA 3GIWA 3IQGX 3P2MA 5CXXA 3VBEA 3WIDA 3WRYC 4ESOA 2WFLB 1SQFA 1YB7A 3FZGA 4AKEA 1FCFA 3ZJYA 3DVQX 3RVBA 1Q7RA 2HDMA 1JQDA 4RPJA 5I8ZA 4RPIA 4RWEA 3DVAA 3ORYA 4CJ1B 1TWGH 4A3DG 3JQGB 5FL7D 4TSFD 2DULA 1MORA 5EVJA 3RSGA 3WSVA 1SE3A 4BFTA 5ER9A 2BUAA 3NCTA 2RSNA 1MN6A 3AEQA 3R3YA 4MVJA 4OYRA 3BHNA 2ASEA 3QLTA 1A8PA 3VH2A 3MJCA 3R7AA 4YJDA 2QN9A 1I1NA 1Y8CA 2G3YA 3IUPA 2K6AA 2CBZA 3RSZA 1QQAA 3R7DA 5F52A 5EFOA 1HUQA 3JQ7A 5FAKA 1QDEA 3S15H 1EBUA 3LDFA 2EJVA 1EFKA 1GUWA 3KDSE 4MWDA 4MVCA 4EEZA 1E2BA 5CH5A 4IJKA 3UJ3X 4UARA 3CW8X 1P7CA 3NIWA 3NTVA 1XZQA 3RT7A 4BJ5A 4K1XA 1KDAA 3UTCA 4RK6A 4LF4Q 2ILTA 4IIUA 4LG1A 2C5BA 4GM1A 1V6SA 3OAAA 1LWNA 2E74C 4BBRB 4X66B 3KSUA 1Z29A 1GDHA 3DDWA 3I62A 4L4XA 4O4IB 1B44D 5AHWA 2ZUTA 1H2RS 5AKZA 4F9GA 4GS3A 2CWAA 3PUHA 3S17H 3LOQA 3LW7A 4LY6A 1KJJA 1QKKA 1JBKA 4WFKA 4U2FA 5JQGF 5M7EA 1FNUA 1I1HA 4AO8A 3GDOA 4C9BA 1QOZA 1BJTA 1FLDA 5EXPA 2IH4A 4R83A 2WTXA 2MO0A 1LLFA 1H94A 1SOAA 1ZVQA 2IELA 4F1JA 4AY3A 1K68A 4QPJC 2PV0A 4M0FA 3V8BA 5DCUA 4AKIA 1DO2A 3J80c 3PZRA 2JI8A 4UKDA 4R8NA 2BFAA 2V8OA 4PPFA 3ASUA 3CIFA 3BE5A 1HDEA 1EYZA 3EGXA 5IKXA 3K0YA 4UDNA 2JLWA 1FTNA 4MRNA 1JPNA 5KWSA 4IIFA 4XDGA 1VQEA 1N33Q 1SZDA 4FYKA 3LKDA 2I78A 3PUVA 4BB9A 3B6KA 4TMVA 2R92B 5GM2A 5KKCA 2RC6A 2Y2UA 4O4LB 5AHOA 1JORA 3UJ6A 1A7JA 3KELA 3GRKA 4OSPA 2DLCX 5JR3A 2PMDA 2F0QA 1Q1AA 5FLMG 2CXNA 2J3KA 3NTUA 2LWIA 4XARA 4Z0TA 1NVDA 3NWEA 1OI2A 3IVGA 3L4EA 3RG8A 5A06A 3KSAC 4JI7B 3FUXA 1LTBD 3TQOA 2SKEA 1AUXA 5CD9A 4OUKX 1ZFNA 3D5EA 2Q2HA 1AMUA 5ELCA 4Q5VA 3FIJA 1CF9A 2NQ2C 3EMVA 4XDYA 2O7VA 3T3PB 5REQB 2PS3A 2BF4A 5T7BA 4CUZA 4EQOA 1ZQ9A 4RXTA 3A36A 4U2GA 2Q5CA 3RRYA 1QGZA 1C0KA 1O8CA 1SB8A 1ZMBA 2NUAA 2ZXFA 3HU2A 4WN3A 5EP2A 3LO8A 5KNDA 3U4GA 2QUBA 2M2LA 3V34A 1DZ3A 4MV1A 4BXOA 5U1PA 3DE4X 1JYSA 3G13A 4RF2A 4QPNA 3DUWA 1UK9A 2AUNA 4DA8A 2D2CC 2CGEA 5JD5A 1RZRD 4N4AA 4DLXA 2OCBA 2R1ZA 3T5GA 4DR5Q 1P7PA 2XYHA 3FYUB 5C5CA 4X8MA 3JQ8B 4IDPA 3LP8A 2B4YA 2QMYA 5KTYA 3KQVA 4IJUA 2GMWA 4JHLA 3DEYX 4MVXA 5AOVA 3FSEA 3RROA 3U40A 1ICFB 1I3OA 1QCDA 4LSGA 3GLFA 5DRYA 2EYLA 3C70A 3AIMA 1JDNA 4BKPA 1Z06A 2IV3A 2E55A 3HKDA 2DQSA 5FI5A 4WY8A 3QENA 1JH8A 1KIXA 1C30B 3K53A 1H4XA 2HDOA 2PZBA 1CSPA 3LUGA 4IHAA 4OKIA 3AV0B 4HSPA 3BA6A 1GGHA 2VAXA 4F71A 4GT1A 3W4KA 4W82A 3GMTA 3PGMA 4BMCA 4XX0B 2IGTA 3C3EA 3ZJYC 2GM9A 1V5GA 2QUKA 4WOKA 1Y98A 2ZSJA 4YP7A 1N77A 3HJUA 2NW6A 2I1LA 4PCLA 5TMDA 4HDOB 4BNKA 3T3MB 1JSLA 3IVAA 4K1LA 2ZE6A 3IRBA 1V1RB 5FOVA 2R7LA 1N9WA 2CW0C 1HRKA 1RXIA 2CDBA 1SVIA 2GPYA 2QPTA 1PK9A 2E4UA 2ZU6A 1NR2A 2JBWA 2O50A 3PIIA 4CKWB 4D8XA 2ZCJA 4KWHA 3M7GA 1U98A 4NY1A 4X1OA 3TRFA 3BIFA 1UZLA 1Q16A 2K5WA 1B1AA 1F9AA 1W4AA 2FMXA 2QK4A 4MGIR 1NY6A 3PCRB 4EUSA 3JR3A 2DY8A 5EJ5A 4QAQA 1RPAA 2GARA 5K1ZA 5EIEA 1Y7HA 1U5AA 4FHFA 5ITSA 2Z8XA 1B0PA 3JQBA 1EWVA 3UJ7A 3WGNA 5KX5A 4KY7A 2PWZA 1S40A 1Q1ZA 3E4DA 2KB0A 2WKDA 1ZINA 2IU4A 3A6FA 3R3ZA 3PNSA 4M9ZA 1TIID 1HOTA 3PIPA 4CL3A 3HFZB 1W85A 3NFYA 1XP8A 2B34A 2NUCA 3DD5A 4IHJB 1Q3KA 4JN6B 4QQRA 3FZYA 3ZCSA 5B6IA 3PDIA 2VFAA 3WHPA 3L2OB 4BZZA 1U04A 3D8UA 3JXEA 1VJRA 3LUFA 1CJUC 3OJCA 1XTBA 3RTAA 2VL6A 1OJLA 3RPEA 4H7FA 2NSJA 4CKEA 3M4JA 1O6ZA 4HRAA 2BE5C 4QECA 3VVCA 1GUZA 4AWAA 5BVHA 5JMTA 1V1MA 3CRRA 4W9RA 3EDRA 4OLFA 2BZSA 2V7WA 3QU5A 4B6PA 4B3IA 4CMIA 1B6TA 2IYOA 1Y5NA 4PPNA 3FSRA 3O4IA 3QI2A 3ESBA 4K7JA 1XJCA 4LY3A 1Q44A 2AW3A 3PXXA 2GBLC 2YN4A 1C0IA 3EODA 3SE0A 2HJRA 3EQ9A 3AHIA 4FSDA 4MEBA 1LJLA 4PVCA 3O8OB 1COZA 1C9EA 1SMKA 1Z5PA 2F2TA 2H4JA 1JL3A 3JRWA 3OOHA 3T6KA 3BOSA 4OM7A 4K9RA 1YDHA 2AN4A 2Z1MA 3PG5A 4RSGA 3G68A 3WWVA 1Z08A 4H6WA 5DYNA 1N2JA 3GNQA 4IDFA 1G6PA 3LKLA 3EPPA 4OHMA 2QRMA 2FF5A 5LUBA 1KOJA 1ZUNB 4C04A 1V37A 2EP5A 3BFKA 4ENPA 2VJAA 5DSZA 4ZZ1A 2GJAA 1EFVA 4NMHA 2XXAA 4HRVA 5BUSA 1S1MA 2VI5A 4DDMA 1PH3A 4Y9UA 4B6JA 1A9ZA 1CWUA 2ZDQA 2NACA 3NP8A 3VA5A 4A0QA 3FKIB 1YRQA 1TO6A 5DHRA 1NVFA 3LPCA 1CG6A 2H7CA 3PJEA 1UMCB 5LXTA 2Z4TA 4Z49A 4BY1G 1KTIA 3JWGA 3DLLA 3ND5A 3BWEA 3PE6A 4YPFA 4EA8A 3JRNA 3MB5A 2PXCA 4P53A 2DNEA 2NVTH 1HT1E 2PXXA 1RZ3A 2YWBA 3G2IA 3D3JA 3IC5A 5DLQC 2VQEB 2HU2A 4DNRB 1K8OA 1JSXA 2JHAA 1G5TA 2AC4A 1WHSA 4UMEA 4L7VA 2LCIA 3CE6A 3QFTA 5J2TF 3ICPA 2XRZA 1JDZA 3ADKA 2IYUA 3H4TA 2PRIA 4IIDA 4WW0A 4PBRA 3UK7A 5HF8A 4XYMA 5A62A 2ZQZA 1LW7A 1OGYA 1N7JA 4HD8A 1P0MA 1CUGA 3LZCA 4P22A 3G7LA 4MR9B 2WB2A 1FQJA 4EGJA 3QITA 4QYXA 4F2WA 2QVZX 4G0MA 2QJTA 1UBLS 4YALA 3OZBA 1G2OA 5HQ3B 1X87A 1ZWKA 3B1FA 3EXFA 4Q0FA 3GLQA 4M6WA 3O4HA 3WL3A 3FKSA 1T1JA 3ZCQA 3BMQB 2ZWAA 1NHWA 4PNPA 4QQBX 2JFBA 3PDUA 3QU9A 4WXMA 4E5MA 5A3VA 2IDZA 3DDHA 2DXLA 1I5EA 4P3KA 5CVUA 3ADOA 4L75A 5LFAA 2ZSHA 2P9QA 3CNBA 3ZHUA 5GAHC 2IXEA 3H97A 1N34B 1QP0A 3MILA 3NVDA 3UT5A 2HJ9A 3RYHA 1YKFA 4DV4B 3WP1B 3WNDA 3O90A 3OWFA 2IHEA 3A3KA 2KX7A 4RVOA 1XTTA 1QBKC 3COVA 3TZLA 4AIIA 4ZK2A 3ETHA 1RVV1 3R3HA 2X0DA 1YDWA 2VHXA 3OCJA 3TNJA 4PAGA 4CIBA 4GUAA 4L5CA 1S1CA 3UK6A 4EGFA 4BWGB 2NWGA 1KYYA 3D8SA 2XRSD 1KYQA 3PDJA 1HF3A 1XCJA 1C1XA 3FAZA 4KD3A 3JATB 3QG5A 3VOBA 5FEUA 4OJMX 3IR7A 4JB3A 3UJNA 1A8SA 1DXMA 1BG6A 3KEGA 3T7SA 1IG0A 3M49A 5DM1A 1JWUD 1ENOA 3IOCA 4PYMA 1SBNE 3C5EA 2FKAA 3SS9X 4PQRA 4X20A 1CUIA 2BZGA 2XYRA 3OOYA 3UCXA 1SWVA 4DV1B 2WPDD 4G26A 1SMXA 3VHLB 4QUJA 5AJXA 4S1WA 5A9RA 5L4NA 3GTLB 1BRMA 3OF5A 1PZFA 3GMDA 1ZW1A 1RSZA 1MRSA 4RPCA 3GLGB 2FE4A 4L8WB 1N8SA 2GZAA 3GBSA 2EIHA 2ERYA 1KIFA 3A74A 3A9CA 3S81A 2PH3A 1NL3A 2R4TA 3LKVA 2XTNA 1L5WA 3W5SA 1ETHA 1TAQA 2KI5A 4XW2A 1MH1A 5ISRA 3Q3EA 3ZDZB 1ZGBA 4HMJA 2BBSA 1S2NA 1AUVA 1ZN8A 2B6NA 1W96A 2WAQE 3EXIA 1G8JA 2BGRA 1AS3A 1TWFB 1R6DA 4OK6A 2Z1NA 4IUQA 2VQFQ 4ZN6A 3QOYA 3TIXB 3D0OA 5M34A 1CP3A 3P1JA 3RN2A 3KYHC 1P1BA 1XMPA 5GGXA 4EM6A 2O2YA 4JXZA 1IB0A 4BN5A 1PEKE 1PNOA 1YHAA 2A8YA 2DT8A 2WM9B 1G20B 3EPRA 4KLRA 1OYOA 1TC1A 5D7NA 5KSZA 3S1AB 3K70D 4QUFA 4O33A 4LF7L 3ZV5A 4IF4A 3X1ZA 2G0NA 1YE5A 2CKMA 1B8NA 5FULA 3W7BA 1NZFA 2BV3A 3U2QA 4E4TA 1L8OA 5DM4A 2YH2A 3PUZA 3HADA 1G9TA 1FVIA 4ZOBA 3VR1A 3TRDA 3BGOS 3N8DA 4BY7H 4DGZA 2XDYA 4I99A 2HK9A 1NNSA 1D5ZC 4IIHA 4Y7NB 2YFKA 2IXDA 3OPQA 1MIOA 3PFCA 5CJJA 3VOAA 2EDAA 2EYUA 2R7NA 4MYRA 1J24A 3FPKA 4DDVA 5IUNC 2J3HA 1KU6A 1TD1A 1TT5A 4H77A 4I1PA 3M6IA 4UP9A 1PEDA 1I4RA 2RHQB 1KAEA 1LBEA 1S5PA 2DWOA 2FPIA 1D8TA 1SU4A 2VXOA 2FX2A 1L5LA 1FD7D 1KC3A 1R37A 5IF9A 1XRPA 3LYUA 4BP3A 4X63A 3M4ZA 3D6JA 4REQB 3CCBA 1FP7A 3RSOA 3VC1A 3FHJA 4CM3A 3AM1A 2V6MA 2VNAA 4RPHA 2JLZA 2AK3A 2O2GA 2D2VA 4YBRA 2C57A 3L43A 4DR4L 3OOEA 3F90A 4AJHA 2GT1A 2JA8H 5B5SA 1ZONA 1T5XD 2H92A 2FSUA 2XNHA 1N1DA 5KVVA 3ZIAA 2IODA 5THQA 4HH4A 4DIMA 3AU8A 4G1CA 4XGIA 2QS9A 1KRSA 3GTPH 3JQQA 2CNKA 2RAFA 3BFPA 5E1OA 1Q0HA 2BC9A 2V55B 2ZR7A 4PIMA 5J2UF 3GHYA 1AP0A 1A8QA 3B1JA 5ESXA 3RFVA 2XOEA 2OT2A 4B4WA 3V2HA 1U7UA 3QJ5A 2XVAA 4BBRG 1JEAA 3BBPA 4XFKA 4NV0A 3VAYA 1Z4PX 2AR0A 2QD5A 1UXKA 2WNSA 1AOXA 4HEQA 1ODSA 4ZZ3A 3L92A 4RD2A 4A3KG 2LXNA 3AVYA 4JYMA 1IE3A 3AINA 3WDSA 1F2UB 1A82A 3OQIA 2YHSA 3WK6A 3VJLA 5A9SA 1CJTC 3KC2A 5JY1A 4GRDA 3PKIA 2Z9DA 2PI2A 4L5JA 5KJCA 2QUAA 2BEJA 1VF7A 3KHUA 3X1KA 5B7QA 1KJQA 4YJ2A 5F51A 4I1IA 1VLJA 1YO6A 2QGZA 5LDHA 5TPZD 2OE2A 3PC6A 4AWBA 2WUGA 1C7FA 5K3OA 4JK1C 1UDRA 3RYIA 3EOZA 4FB5A 2Y2VA 3JASA 1UP4A 2F9LA 3ZE6A 3GXOA 5CIYA 5EP1A 1S3FA 5DP1A 3FLMA 3HMKA 3E2IA 2OKCA 4AF7A 3ZHYA 5I4IA 4Q4HB 3R6TA 4RVFA 2R7FA 1ONSA 1OLSA 2VZ0A 3THYA 4K5VA 2CF5A 3UUEA 2FN8A 1WBJB 3SX4A 2CMDA 2XITA 3E9EA 3MGGA 1CHDA 4KK3A 3UE0A 1OWMA 4B3RQ 1XLTC 4BRWA 3ZXYA 1HFKA 3TG2A 2OHXA 3A1NA 4LXXA 4XGQA 1GT6A 5EJ2A 5GQSA 4U4AA 1YA4A 1J6UA 2AG1A 4BS9A 2PCJA 2PM8A 4R8KA 4YNBA 2C7QA 2JI9A 2QN2A 5M2QA 2D2EA 2QZSA 2B8WA 2BLLA 1FY2A 1O77A 2VNJA 4LOKA 5G0SA 1EQVA 5EPLA 4M86A 4FEAA 1MOSA 1GQSA 1I4PA 4GOMD 1NUQA 3P0HA 3ZDEA 1JHMA 3JQ8A 2PLAA 3HZHA 3KQSA 1QMGA 2OAGA 1O5OA 1TQ6A 3RT1A 2J0SA 4EATA 4KQ9A 1ZEQX 1CA5A 4RY2A 3PQEA 4CDEC 2NVQH 1RWKA 1ZRHA 2M1ZA 4ZI3A 5B1HA 3UVEA 1RRMA 2DPLA 2Q5HA 1V3UA 1HE2A 5K6TA 1VMKA 3WNZA 4JSYA 1SZCA 1BZYA 3VR2A 3O1HB 2C54A 1P7YA 1RKXA 1CDEA 3OIWA 4D6PA 5AM3A 5ELOA 4HMOA 2ZSEA 3CF6R 1W5AA 3NT5A 2Z8ZA 3O5AA 4N7BA 2C97A 3VR3D 4BWYA 4ZVVA 4YPOA 3ICQB 4OU4A 3AWIA 1SE2A 5IT5A 4P3PA 4DUGA 3ND7A 4FONA 2Q99A 4R9SA 1TO2E 2C77A 2C07A 5AXAA 5BYBA 1KVUA 3BWVA 1XA3A 2IYRA 3OZFA 3PPYA 3DLHA 4QVKA 2WTBA 5JSHA 2JB9A 4Y67A 5LQMA 2O2SA 2H1FA 1B6SA 3BB3A 2WSMA 1YR2A 2IHYA 1TX4B 3LOPA 4PCUA 4BBSB 2Y1WA 2D7DA 3FGZA 1JR6A 4L76A 4PV1C 1DQSA 4DMKA 1S5ED 2AG6A 5FTLA 5GROA 4F4DA 2P40A 1EZZA 1ZEJA 2QPLA 3I9V1 3KF6A 1ZD1A 1XMQB 3EW7A 1CKEA 1GTG1 2F8TA 1PRTC 2NXWA 1WQ3A 4IBOA 3ZYZA 2GOYA 3H0GG 2A58A 2W93A 3IB6A 2Y1OA 4G5HA 4AICA 2JLBA 2B8GA 3BZUA 3EZ6A 1JDBB 4H2DA 3OQJA 4IOAA 3TGLA 2I7DA 5GAGC 3QE4A 1R16A 4POAA 3N1UA 1L1OA 3PSIA 1BEEA 1XA4A 4KN6A 1YAHA 2WF5A 3W2FA 1XQ6A 1KOLA 4KAJA 1ISMA 4J1SA 4UHJA 3IBFA 3KZXA 1XJ0A 3HCOA 5JSKA 4YT4A 1YJQA 4TKUA 3SQXA 1K3BC 2RSLA 1HGXA 1H4VB 2ZJ1A 3O9VA 1LBSA 1BQQT 1OFUA 4GMGA 2I6TA 4DR2Q 3K4PA 4BZPA 2CH4W 2I8CA 1DP4A 5A0VA 4YRDA 3DD1A 2PNJA 1KP2A 1N34L 1WMSA 3UB3A 1M2KA 1LQ2A 1Q0QA 3K0HA 3NETA 4MARA 1EJ6A 1YJ9A 3HLKA 2B63H 1ZMRA 2F6RA 3DA8A 2OZLA 1DWUA 2NPOA 4KBYA 1US8B 1UXOA 3HNPA 3U4IA 1U9CA 5CB0A 4GWLA 1BMFD 5KOIA 1KFKB 4NBUA 5KU1A 3TEHB 5AW5A 3OLCX 5DPMA 4YJFB 1E66A 3E9IA 2BHNA 1NFRA 2P3LA 2PT5A 2VIIA 2Y93A 1J97A 4M9QA 3OZIA 4F97A 1MF7A 2P2GA 2PWPA 3SJBA 5JDCA 4R84A 1HG1A 4A27A 3FOEC 5KB3A 2G9HD 2I9PA 2AOTA 1AKMA 3BXXA 1HRJA 1RAIA 1IYZA 1K8GA 1FBTA 1H66A 1T9KA 1AHIA 2RHMA 1QUFA 4JH0A 5DTIA 4BMZA 1QVRA 2I4TA 2QGFA 5CG1A 2H4ZA 4ZT6A 5CTJA 1BVYF 2XJ4A 4KDFA 2E9SA 1HV8A 4MGYR 2OCXA 1EUDB 1I32A 4MYCA 1O87A 1YZ3A 1V6AA 4E6PA 4ZI7A 5A5VA 4G0UA 3EIVA 1KTVA 5HA5A 1ID1A 1OCEA 5KJFA 1YJWA 3GMIA 4X6LA 3FKIH 1D2BA 3RS3A 5JZ9A 5FWYA 3GDGA 3PXDA 4TXHA 1M2NA 1D6JA 4CCYA 4G36A 2IPAB 4DLYA 1HNNA 3EG9B 5DYGA 3E5MA 2YY7A 2EYJA 1LTSD 1EI9A 1R0BA 2IYEA 4OF4A 5DHTA 5EUZA 4ZU3A 2BKLA 3K8QA 1O57A 4C29A 2O7NA 4YHHQ 2ZAOA 1CBUA 4DV1Q 3ZWYA 2OR3A 2RH5A 4LUVA 1NUCA 4IFEA 1IM5A 4QEKA 2XMDA 4MN3A 4HX9A 3WP0A 1QX4A 1PA6A 1DFGA 1LZKA 1YE8A 1Y8QB 5F5LA 4FP5D 4FYMA 2XZLA 2RHSB 4PQEA 3W5BA 1CJMA 1YOVA 4U68A 2B99A 3NHZA 1YZYA 2HK8A 2PA3A 1U5BA 2QMUA 2Z8LA 3D6NB 3RS8A 1H93A 1PJCA 3LUDA 4DCJA 1I8TA 2QR3A 4TRMA 4B9WA 3GDHA 2YJ5A 4I55B 4ND8A 1YNND 5LMNW 4A6DA 4BQFA 2IUYA 2QCPX 2C2GA 4L6CA 5GAJA 3R74A 4CNQA 4BGDA 4BYMA 2OYSA 4GR4A 2H1CA 3CHYA 1AZTA 5JZBA 1WEKA 2XIWA 1NXQA 1SCUB 1GG2A 4A3BH 4AP5A 3LL4A 2POQX 4PQFA 2VQFB 3FJOA 4UHBA 1VL2A 1X3QA 3IQHX 4Z51A 4FZJA 5NULA 4EB0A 5SZHB 3AETA 3AHHA 3RAGA 3NDBB 5IXYA 2JA9A 4L8LA 5MGBA 4KQKA 4TLBA 2G09A 1CF4A 1Q17A 3RYCA 3NBAA 5M5WB 1WW3A 1CCWA 1SBHA 3EC7A 1Q1BA 2EJMA 2SNSA 5LLSA 3ZWAA 4G24A 5AW6A 3AUFA 4GU5A 3SIXA 3MWJA 2FUNB 4TZTA 4DAMA 4B6GA 2PK3A 4HQNA 3MWDB 1U4RA 1HA6A 1TUBA 4WK6A 4IAOA 1HL3A 3ZY2A 1F6BA 4EMSA 2FDCA 4LY0A 1XX8A 4ETWA 2PG3A 1RTNA 4R2HA 1X1SA 5TQJA 4HJRA 3DZFA 3UMYA 1HNZQ 1OXXK 1N9GA 3IXQA 2X7JA 1QKIA 5CHYA 3QLUC 4D97A 3SF0A 3ND6A 4Z4CA 2JLVA 4N49A 4Y9SA 4BVLA 1P74A 1SY7A 1WUIS 2IHUA 3B70A 1P1RA 3G5LA 3I8SA 4C78A 1I6KA 4F1WA 2FZKA 3S2FA 4H4CA 4DG9A 1IN6A 4M98A 1YA8A 4XDHA 1FYWA 3FUTA 5EC8A 3UMFA 2DXNA 1A9XA 1USWA 4OJQA 1WD1A 3ASVA 3QMWA 4FYHA 3HKEA 4NI5A 4WXPA 3HL4A 4ZHQA 1U28A 5SZIA 5LYJB 4HEA6 4A3MB 3TNYA 3VH3A 1L5MA 1CYEA 2F3VA 4C4XA 2AG5A 1FS4A 5AVJA 3G6WA 4A3EH 1PT6A 2PUVA 2ZSFA 3ABQB 3O8DA 3RLNA 1G20A 1K2WA 3VR3A 2SKCA 1EHIA 2XSZD 3EMDA 4TVKA 2WD8A 3HVKA 3K6OA 3EFEA 2X86A 5FCDA 1BCRA 4QLBA 5BR4A 3B85A 3SDSA 4X61A 3FH0A 4FBMA 4BLUA 1XTIA 1Q3LA 1GL3A 2A84A 1LX6A 2ZATA 2YJ4A 3PFWO 4LWOA 4OH7A 5TR9A 3MHTA 1QF6A 2RBMA 2NTEA 4HCSA 1DJQA 1PR2A 3OE1A 2H5XA 4UU1A 5FNVA 1QRUA 1XFDA 1IQRA 1JDUA 1WETA 2A78A 2XQKA 1HA5A 4ZU1X 4HAVA 4HIKA 1D0VA 1B41A 4QCLA 1JTFA 4LF6Q 3LHDA 4BUJA 3PFGA 2QBYA 5GJVC 4RTKA 1OZFA 1EAMA 2HMAA 3F98A 1IN1A 4C7OB 1NJ2A 1RD4A 3FWZA 3OFSA 5KUTA 4GI5A 2ATWA 1OV4A 2FTKE 3ZG6A 1X7XB 1IY9A 1Z2AA 1XAGA 3MGBA 4ZKEA 2R68A 4DXDA 2XZOA 2ZFUA 3O03A 2GTHA 1BS1A 5E2IA 2XKAA 5BOSA 4LQLA 3W1BA 1ISFA 4UDYX 3K15A 1XNGA 4EKDA 3EZNA 4FKMA 1ZX1A 2Q46A 3OM1A 1XR3A 2FVYA 4X64Q 3F43A 1EZ4A 4KIUA 3WRYA 4B82A 1NPTO 2DPYA 1GEGA 3IEXA 3NLLA 3O91A 3UXHA 3N2KB 1QVGA 4FCCA 5ED4A 2IVFA 4M89A 1A4UA 2OPHA 3VKGA 3S5UA 4HMQA 2PYZA 5C0XI 3Q8DA 1XNRQ 3I4MB 1W4CA 2ZKLA 3C3CA 4MVYA 2PJUA 2HHLA 2Q4OA 4GZ3A 3D4NA 5EQTA 3ESCA 5AKEA 4KITB 1RHJA 3F97A 3KZ1E 3CBQA 5AUQA 5CA0B 5MGNA 2CUZA 2MTBA 1VQ8A 1FDOA 3W8NA 2DQ4A 1U0FA 3AVPA 3I6MA 3IO5A 4A16A 2JCBA 1W0JD 2HF2A 2NNWB 3K6SB 1DIGA 1JILA 3MMSA 4ZKCB 4W1SA 5AM0A 5CA1B 3SSAA 2OQKA 3K6RA 4PC3A 4BVHA 5WRFA 2NN6G 2C20A 4V0KA 1G9XA 1ORHA 2QYTA 1DV1A 2LR0A 5BMVB 3PHJA 1R0RE 2BRUA 1EL0A 1BX0A 5CGQB 1BS2A 3TSOA 4ZTUB 3X1JA 1KY2A 5IYZB 2IYWA 5LWHA 1QHGA 2X0EA 4DCGA 2NAFA 1I51A 1YIDA 3O93A 3ZWPA 3HOYG 2GBPA 3U1VA 1E3MA 2AQHA 4PGFA 3NIBA 1RLIA 3RRNA 2YWFA 3WBFA 3J80i 5GMOA 3ETGA 5M5XB 2UYGA 2Y0SB 2PFSA 2DB3A 2FH5B 1DBSA 1E24A 1XQ1A 3NHRA 4NH4A 4ZU6X 1T0BA 2RDFA 2PFKA 5ULLA 3V7UA 4DMRA 1I7SB 3K9FC 2DJGC 1TCUA 3DBLB 2NOAA 3D3NA 3JVVA 3LQQA 3RLOA 3P45A 3RSHA 5K0LA 3UGTA 4MZ9A 1UPCA 3PQ5A 3R5SA 2EOAA 3A28A 1NRIA 2WUFA 3HABA 4DLPA 1LPSA 3CMCO 3Q5DA 2VHWA 2R00A 2VZ8A 3FMVA 3Q40A 1C1DB 5GGYA 3KXDA 4BQNA 5LMNL 4A3DB 5IXSA 4DJAA 2IV7A 4IUDS 3WOVA 4HXFB 8GPBA 2BW0A 5FUQA 2WVHA 1RJTA 3ED1A 3THXA 4G09A 2CC2A 2ZJ7A 2AX3A 3I58A 4RVHA 2J6IA 2SECE 3ZQ4A 2KUMA 4C7XA 3NTQA 4JP5A 1BXTA 1NY5A 1N0HA 1WU7A 4MWOA 5ENZA 1ZIYA 2X8WA 4B31A 4D81A 4EEKA 4F8EA 5DHUA 1L7NA 1X42A 3PYXA 1U3FA 2AQ3B 1NBWA 2A68C 1PGNA 2EKQA 1T5EA 4RM3A 2F55A 2UU9B 3HJNA 4ZAIA 3HO6A 3IO3A 1ML3A 2F0FA 4ZODA 1E0AA 5DDIP 4R7TA 3K8YA 3HCFA 1V39A 1VG0B 2W2NA 2X19A 3AEQB 4RIIA 5AVXA 1HDRA 4AI6A 2O9JA 5HGQA 4GQAA 4LDZA 1Y89A 1CVLA 1J9GA 2IOYA 3P0IA 3EULA 5FKAC 3PS9A 3PHLA 4UP7A 4EJSC 4F04A 1QR6A 4MVJM 5JJIA 2JHGA 5FTNA 5LJLA 1K66A 2UZ4A 4D3DA 4H3KB 4D8WA 4ZJPA 1STYA 1KI3A 1NVXQ 3X1MA 5EZYA 4JI1L 4MW9A 1QR2A 1GU7A 4DIBA 3IAEA 3SMVA 3S1SA 3AF4A 1E0KA 1EQQA 1NW8A 4KXYA 4OAQA 2VYQA 5AHXA 3ZWVA 5AUOB 5BVGB 5JH7F 4RZUA 2O5VA 1IYVA 4BX9A 5HWSA 1X94A 4UTVA 2PBRA 5EKLA 3IE2A 2HUNA 4O42A 4KFSA 4FMCB 2ZXPA 1W34A 1WUTA 1Y6QA 2GGSA 2WWTA 2J9YB 1U4SA 3ZTBA 4TLMB 3B8HA 2Q3FA 5DTRA 5FP0A 4HAXA 3QUBA 4P0PB 2JEBI 4JB2A 1LTLA 2OGTA 3M2PA 5BN1A 1LCIA 4M4SA 3GJ5A 2N0SA 3VH4A 1CY8A 1YIOA 2J9XB 1Q3HA 1IYUA 1ZYRD 5DM63 4Y52H 2F9FA 2PZKA 3MC1A 4MRRA 1WD7A 1WKVA 4Y6SA 3ADCA 4FVMA 4EZEA 4C3IH 3Q6MA 3RLIA 1WZEA 3L8CA 2IP2A 3E5SA 5C1PA 3OZWA 1P75A 1S8AA 2N1MA 4F86A 2D1YA 2V1XA 4ALLA 2FPGA 1JJ2A 2FPGB 4BBPA 2RI6A 3SBEA 1R74A 2I4IA 4NNPA 4CFYA 4NJMA 1ZPDA 2OENG 2MOKA 1CY4A 2R7ZB 1TT7A 5FUBA 2AOTB 1ULHA 5BO5A 2GF2A 1Y1LA 1YDEA 2AZ4A 2YFYA 3EISA 4OQEA 3T9CA 2AF4C 4UQPA 4DGQA 4HPWA 3BDOA 3ERQA 1JU9A 3QV2A 3R24A 1V1OA 1E9RA 2O4CA 2P2YA 2PO7A 3ECAA 2E89A 1GXSA 4MUBA 4RJLA 3UJCA 2XDQB 3K0AA 3WKAA 4WJLA 4HNTA 2QQGA 3CKKA 2BI4A 3N6XA 5C8YF 4ME5A 4E1BA 1CNFA 2YRFA 3E3OA 4FFVA 3CVWA 1H2ZA 2CXQA 3C1EA 5DEHA 1ZN9A 2VRCA 2Z0SA 4HADA 2QP9X 3X43A 4EG5A 5DLQE 1ESNA 3A6DA 4RVDA 4O2RA 3THRA 4CQJA 3HZZA 4I8DA 4QLAA 2Z4IA 3SS7X 3SK5A 1KH3A 4ODIA 3MWEA 5CXQA 1UOQA 3K70B 4XX1A 5ELFA 4TKZA 5CB6A 1AH2A 4FGSA 1G8ZD 1MOPA 3ZK8A 3OWEB 3NTOA 5DXFA 4F92B 3PU6A 1H5UA 1OTXA 3L04A 1BD3A 1L8XA 2WHPB 2E5LQ 2WHPA 4DV1L 2XF2A 3OD5A 5CK5A 5IJ9B 4JYZA 2YHBA 1IBML 1E9AA 3PUJA 1WMBA 4LHZA 4BMYA 4B7UA 1C9KA 2X4LA 3HEBA 2ZRDA 1CX9B 5CAEB 3NS7A 1O3YA 3DHWC 4HNSA 3E6AA 4OHUA 3KEQA 2BEUA 3FTQA 3W2IA 5FO0A 3RJ9A 3E8XA 3WL5A 2RHWA 3ZUPA 3NHYA 1IUKA 4MIKA 1QB7A 4Q47A 3E9YA 2G1UA 4G4SO 2FW0A 3KZKA 4JJAA 4WCFC 3B89A 5H7XA 4HNUA 5AK6A 3RT9A 3JVUA 2VWHA 3GLIA 4Q7QA 4KUHA 2DHQA 3GMSA 4GZYC 2X6TA 4ENUA 1E2MA 3M1AA 3H9UA 1C41A 5JXIA 1L5KA 4AKSA 2QY6A 3JALB 2ZYHA 2FRVA 2XUHA 2EFJA 3DMGA 3A6PC 5BSRA 4C14A 2NXNA 1BDOA 1RQNA 1BFDA 2CCGA 2AA3A 1HM5A 3ONNA 5F3DA 1YONA 2MPMA 1L5SA 1E3WB 2FXVA 5IJAA 4ERNA 2E18A 3GFVA 4PFKA 1UE6A 2CMHA 3EVBA 5I7HA 1GYPA 3QX3A 2IBMA 3TLXA 1JMCA 4CKWA 1O7IA 3N9IA 4HDMB 3DW3X 3H75A 1JAHA 2HRQA 2I07B 5CGZA 2PL1A 1MHPA 4LMQD 3STBC 1M6EX 3DHEA 3HXTA 3UAVA 3TLMA 1W36D 6PFKA 4R0NA 2K2QB 2AQIA 3BSWA 4BJ6A 2A1UB 1Z4OA 3AYXB 3I45A 4KTVE 1NW4A 4ZALA 4UQLA 4GOKA 3G8YA 2H9YA 4RH6A 1HZCA 1KABA 4C3JB 1D5WA 1CIVA 4W5OA 5JLAA 1XWIA 5JDCC 4P80A 2IP4A 1PK7A 1E79A 2DN8A 4DDWA 2N75A 1JWLA 2B30A 1ZAKA 1S4MA 3GJ3A 3HSSA 4EDFA 4LRQA 3GL9A 4UPDA 2BDUA 3MCUA 2ID9A 1U90A 4CLXA 1XN4A 4QUEA 1Q92A 2ALJA 3FHCB 1DLIA 1H2FA 2CD9A 1H9JA 1EDZA 1T26A 4LPKA 5BSHA 1T9DA 4I1SA 5B30A 2ZIFA 1S5FD 1PE0A 4BLWA 2ZSKA 4LMAA 4PTZA 2Y0PA 5H3LA 3RRZA 2JAXA 2L15A 3V3KA 4EO4A 5IU6A 2DXIA 5KTNA 1QQ7A 1IW7D 3CF4G 1YBAA 2UUPA 5CT6A 1NPYA 3VPGA 5KVAA 4Y2JA 2JK8A 4UNSA 1QG0A 1UM9A 2NV0A 4EUKA 4C7MA 2G9ZA 3QKIA 1OASA 3FPHA 2BTQA 5EGSA 3MEQA 4HR7A 3I4NB 2XVZA 3EYAA 3FPLA 4FW9A 5ER6A 4BNXA 1PVVA 2VBGA 5K3FA 1FJGB 5EFZA 1MB9A 1DJPA 2ODWA 2ZVQX 1VB3A 1XQ9A 1H9CA 4XGRA 1C30A 2UUOA 2R8BA 2G9RA 4C6RA 2GSDA 2PWAA 2QLNA 1MX9A 4FN4A 1OGJA 1A50B 1CJCA 2OOSA 1I4LD 2B2CA 3Q2OA 4LHVA 1JXMA 4QYIB 1EDEA 4YEDA 4HAOA 1DCMA 4MZXA 4FDVA 2ZK7A 4GR9A 4L8FA 1JWSD 4LA4A 2ECFA 4PONA 1U9JA 2IOQA 1JWAB 4BAZA 2YJ6A 1Y82A 4OUDA 4BQPA 2VDMB 4DSUA 3S8EA 2ZT7A 1X0XA 4LFAQ 2G82A 2HWKA 1K5PA 5HCIA 4M1KA 3GZTB 4GOPA 1MC5A 1U7OA 2I65A 3GB9A 2HU7A 3L0SA 4LF6L 1YT5A 2EKBA 2HZ7A 3I1YA 3NDJA 3T1QA 4B45A 3VTKA 2NP6A 4LUCA 5IT9E 3IMFA 1ZNXA 1OAOA 2IPOA 5L3ZA 3F4KA 4GKKB 2C3MA 1QSGA 4N6NA 5CX1B 5AI9A 3CNQS 1QX3A 5CURA 4OL7A 2NVQB 2PLRA 3SGLA 4DR7L 3OMCA 3EN2A 1Q0UA 3PJDA 2Q6OA 1I4EB 4GC5A 4L8VA 4NC9A 3LYAA 4TYPA 4ZVNA 1GL9B 2ZTCA 3WNQA 4X6UA 5EPEA 4LSWA 1V0JA 4QGSA 2FG5A 2XDWA 4OKSA 5HSGA 4IOCA 2P4SA 4FJ2A 4PPYA 4URVR 4HDSA 1G6HA 1DX6A 3E9QA 4CBVA 4LSMA 4PG5A 3VYUB 4LQDA 3B53X 2QZJA 1PR4A 4A2PA 3TG8A 4DKAC 2VYFA 2W6QA 5I4DA 1LACA 1ZK2A 2CVOA 3GJXC 4CMCA 4O1MA 4C2MH 1PNQA 1R4ZA 5FK9C 1E8MA 1ZJJA 4P92A 3A6LA 4US1R 4PINA 4KP7A 3CGGA 4R1TA 5D2CA 1IVYA 1CDZA 5CEFA 3UGJA 3K5NA 2IU3A 4LF9L 2Z58A 5IJXA 4YXWA 4JP2A 4V1CI 2FW7A 2CJYA 2H7VA 3AEXA 3F2BA 3NK9A 4G5OA 5K09A 4X3PA 3ACBA 4KR0A 1B2LA 3J7A5 2DCMA 4QC2A 4GVPA 3S1MH 2ZOAA 3SC2A 2VHQA 1IMJA 2FJ0A 3PJGA 4YCBA 3PUYA 2QL6A 4WL0A 5FI0B 1A96A 3QSGA 2D4HA 5EGNA 4FYWA 2QG9A 1QNLA 4JVMA 5BN5B 3ZBTA 2YU9H 3ANLA 3L0ZA 2OFPA 3QMMA 1AN8A 4RQTA 3I0MA 1B26A 5CHEA 4R1MA 3WYAA 1G59A 4EAAA 3HN7A 2F43A 1AGXA 2K5DA 3MSXA 1DIHA 4YT5A 4JOSA 2BF7A 3WHKA 3ZHSA 3TO5A 4PZZA 3DHQA 4DQDA 5A4MS 2VDKB 2DR2A 4B08A 1PSWA 3F3YA 5CLIA 3G9QA 2B25A 3PVZA 2O2XA 2YV4A 4G5YA 1AV7A 4IV8A 2HTEA 4MUEA 4K0RA 4JI7L 1Z33A 5E9AA 4CW7A 4E5DA 5C0XH 1K8XB 3H0CA 5DNDA 2G80A 1OR8A 2VT6A 3R0VA 4MCHA 5TDHA 2VK4A 5HCNA 3CMMA 2IWRA 2VTBA 2ZSIA 2ASVA 1ESZA 2NVOA 3AY6A 3S2IA 1OZAA 1W2BA 2G7MC 1VGRA 4DAOA 2Z43A 1P2UA 3O92A 4PIVA 4QHSA 1JB7A 3M4OH 2W2OA 4QYTA 5IBPA 3TRKA 1FRQA 4YIHA 1PBNA 3IVXA 1KYXA 3HR7A 4C01A 3JVEA 1D1PA 2NADA 4CG2A 4PMBA 1ENPA 3GFBA 3T5TA 5DE3A 2XBLA 621PA 3AY3A 3ZQUA 1MNAA 4H35A 2BCEA 5EKXA 5EY5B 5AD1A 2D0OB 1SXIA 4WWHA 5DV9A 2EGUA 1HE8B 2YWDA 3LO5A 2GQ0A 2BMDA 3G2MA 1KL9A 5IP9H 2ZSAA 5C5DA 4IUCS 4FPXA 5DLYA 4WNAB 3DTTA 1LLRD 8ATCA 4J1TA 1GUFA 2WU0A 3F7NA 3JZIA 4PFSA 4H1HA 4U9UA 2PFGA 4GOPC 3BERA 2XUAA 1IY2A 1NOJA 2AMLA 2GBIA 3D2BA 3KYIB 3DONA 2PO4A 3GN2A 1XMOQ 2J4FA 5E8RA 4PNYA 2R86A 3I4NG 3SVMA 1KR2A 4MRVA 5I7EA 3ULJA 4EZBA 3IB3A 4EPVA 4LX0A 3F73A 3KKNA 3P9IA 2JLRA 4HDRB 4UOZA 2Z4HA 4LE1A 4TV8F 5JD3A 1N2ZA 2OBBA 2AUJD 3N53A 1QIHA 4M0EA 5SY6A 3TOXA 4PHFA 2DBRA 2BBTA 3RRMA 3O3CA 5I3ZA 3A2MA 2XLBA 2ZTUA 2BGJA 1NUUA 3D02A 4L16A 4WZBA 3V4FA 2XX3A 3S29A 5C5IA 2D8MA 2AFIE 3CEPB 4HFNA 2WIGA 5FA8A 1E6MA 5LCXA 4M0CA 3UXEA 5B12A 3Q0AA 4G0NA 3MRXA 3QELA 1H0KA 3AWDA 2WTUA 3ZVNA 1VMIA 3R5HA 4DUZQ 2IXTA 4MRSA 1JZQA 3F2IA 1WI5A 3IKLA 2O8NA 5CFZA 1E8NA 1SBQA 2AI3A 4IFIA 4M60A 4RBNA 4AWXA 4JVSB 5G3YA 2H2GA 1J1ZA 3HEMA 4DJEC 2F62A 1V1PB 1OAOC 2CLMB 2OCLA 2QTZA 3B3GA 3EGDB 3HKCB 5BV2P 2G36A 1NIJA 3KQOA 4XSVA 1IXRC 4EJFA 3TW4A 4G9BA 1H8HA 3IERA 3R5TA 2XE7A 3K50A 4WXEA 3KQKA 2JIZD 3UAYA 3DQZA 1QKJA 3DMYA 4AYBE 2IPMA 4MTNA 3LJKA 4I2NA 4OD0A 1Y6ZA 4E94A 4R68A 5B3LA 2IHTA 5HUHA 1DEHA 4WDRA 5B6PA 1M76A 1T0IA 4G84A 2JA7H 1ZSVA 4GUDA 4XQ9A 1RQ2A 3TX6A 5FR2A 3U6BA 3E70C 3GJ6A 2V0CA 3HV0A 3KVOA 4L4RA 4QY7A 4ENQA 5HIAA 3U4QB 1PH9A 4W5RA 2GZRA 3HCEA 1NMSA 4MP3A 1P81A 3JQ9A 4XB6B 1VLZA 4OL9A 4V2UA 2G77B 2IZ6A 3E81A 5C4JB 4A75A 3CC4A 2YHIA 4URHA 3C6QA 4JI8L 1DV2A 2AT1A 2V6JA 3GVXA 4F06A 4QASA 4LJ4A 1H9MA 1M1NB 2NYZD 1XG5A 4BXXG 1JNXX 1YMUA 2W0SA 2CXHA 4JI5Q 2Y66A 3HFJA 4BLRA 4KLZA 2C3OA 3F5FA 1KHIA 4EG1A 4YAOA 3K0FB 2ICEC 1MJNA 4O02B 4IEEA 1Z56C 2BFBB 4L8JA 2HK7A 3DE2X 4P4LA 4BO0A 4Y1RB 1T6BY 5FD8A 5IYCH 1ESEA 5TV2A 3PXUA 1NW9B 1VSVA 3QR8A 2ONCA 2R8EA 4R6WA 3GDFA 1XZCA 4UAUA 3CKIB 1U4NA 1USVA 3BGWA 3R3VA 5GJBA 4KKVA 4H6PA 3S1QH 1YR9A 3ROTA 2WHQA 2ZBDA 2MR6A 2YOHA 3I6ZA 4DXAA 4YV7A 2COEA 4WECA 1C8BA 1KYWA 5DEIA 5JWHA 5JARA 1MJGA 3OJWA 2G5TA 5L37A 3V8RA 3FBWA 1LTGD 4X3SA 2WF9A 3BD7A 3JD4A 4PS0A 3RYTC 2HPZA 2DY1A 4FYVA 1NJIC 1T8YA 1T0JB 3HHPA 1CY7A 1QO7A 3UA4A 4B6FA 4D9EA 5L51A 2CFMA 4ZZ0A 4RD6A 2R5WA 1CUEA 4QVGA 3A6KA 4DSAA 5K0TA 2HIXA 4R5MA 1KD1C 2ZW9A 2KEDA 3IMGA 4H31A 4K9OA 4HAUA 2HDWA 2H5IA 2FU5C 3DAYA 4MMXB 5FLXc 4MPDA 5EESA 3WE7A 1LPAB 2XVXA 4QTXA 4ATNA 1YI8A 2AN3A 2OZKA 1PS9A 1QZHA 2A74C 2AMYA 3TD9A 3RWOA 3Q6IA 2FG6C 5E2AA 1XMSA 7REQB 4YCAA 4KFUA 5EIBC 3LL7A 3ZPXA 4A1OA 4AJ4A 3D7MA 2RHCA 1JAZA 3IE0A 4DLLA 3CVYA 2D13A 5C44G 3R0ZA 2HH9A 1QPZA 1P5ZB 4LXHA 5IF3A 5M04A 1DOAA 5BYJA 2Q21A 1U9ZA 4WQMA 2J4CA 1Z7YA 4CI9A 5ALJA 4D26A 2FSHA 1FJXA 2JE6I 1A8HA 1Z4JA 1T5DX 4KN9S 3IDZA 2YC2C 3LCMA 4DLNA 4LFBL 3D6TB 1PTOB 1VHTA 5KTKA 1JF8A 2GHQA 3VR0A 1UBTS 4MP8A 1UBSB 2HQLA 4I7AA 1R18A 3AR4A 2J9FA 3CUVA 4PN3A 1M2GA 2CHQA 3IP6A 1LJ8A 4Z86A 1KRTA 3T41A 2EWVA 1IULA 1UKEA 2AKYA 1JE4A 3VU9A 5E9QA 1JHVA 4TTRA 3VV3A 4NFHA 5LL6S 4PLHA 1WXEA 1E77A 3JARA 3NTIA 1D2RA 1T8TA 1TQOA 2NTYC 1N0WA 1FLAA 3CLHA 3HUDA 3L06A 4IXWA 5ALWA 3B3AA 3UKJA 3DF7A 2XSCA 3IIMA 3VKVA 3IT2A 4EVSA 1YQ9A 2HUPA 4N5IX 3CR8A 4AG5A 1EEID 3AVQA 3G5TA 2BM9A 1L4GA 4QIHA 4D9JA 3VISA 1B43A 2H11A 4CTOA 3P9ZA 5EJEA 4R81A 2GBLA 3E7FA 4OXXA 2BGLA 4UHVA 1DB3A 3DTYA 2WY2D 1C4QA 2Q3HA 2ZB4A 2C4NA 1JJVA 2QRVA 2H8KA 2ZIXB 2ZXEA 1DL5A 3L8ZA 4TX1A 3C8UA 3AZPA 4R0VA 5LYYA 5A3RA 5L9AA 1N32B 5BQ3A 3R5KA 1Z4IA 2H65A 1JHUA 3ZWBA 3IP7A 3DLIA 4NCHA 3EWAA 1FIUA 2ECQA 4Q24A 2O59A 1R8JA 4Q7MB 1UJ5A 4XM1A 1D2CA 4DAPA 1CJBA 1KDRA 1Q83A 2P6NA 1J1UA 3E61A 2VPXA 1QO9A 3IF5A 1GZ3A 1OLXA 3RJMA 3LHKA 2HXYA 3NJ8A 2F1KA 2Z9HA 4FDTA 3UV6A 2R1TB 3OJEA 1K6XA 4HLUC 1Q2XA 3KB8A 1CRQA 1CE8B 3IEKA 3F9IA 5ECGC 2GEUA 2R93B 2QX4A 1M8GA 3HOZG 1QWSA 2G9QA 2QVYX 1FVFA 2VSYA 5AQEA 3AUJB 3L7LA 3NEPX 3CH6A 4GOPB 4GAEA 1TWAH 1J49A 1I2ZA 2ERXA 3PFKA 2ZSBA 3CLRC 5IAGA 3KDAA 4KZPA 1QF9A 2WD7A 3M6XA 4L9SA 4C0LA 1GQQA 2O3UA 3JYPA 3DBHB 4E2WA 4ZCMA 1UODA 5LIPA 1LT6D 3RVOA 1QWYA 1ZXXA 4DQVA 5EL0A 1YQXA 2JEAI 3PT9A 5COAA 4A8JC 4JT4A 3RC1A 5ADVA 3IQWA 3LUPA 5THKA 5JROA 4DR1L 2YASA 4MV5A 5DYWA 2WJHA 1TGVA 1VE3A 5KNCA 3QBTA 4V0RA 1FLNA 3EFBA 5FWDA 2VQ3A 1C8CA 5BSKA 5J43A 1H9BA 1N9ZA 3HOXH 3DORA 2OCPA 2W7TA 3GPIA 3QBVA 1U2TA 4Y6OA 4D56A 4BY7B 1Z74A 1T8PA 3RSFA 1TNDA 3VVMA 5JEEA 3FVWA 5I9IA 3LSYA 4OPMA 4CPDA 4F96A 1B2RA 2VXBA 5FL3A 3L0CA