The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
124
|
sequence length |
432
|
structure length |
424
|
Chain Sequence |
RVGIKVLGCPKNEADCEVLAGVLREGGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSFVDAKDQYGYKLVVKGCLVQRYYEELKKEIPEVDQWIGVADPEEIANAIETDLVPDRYRKRIDLEERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVILEH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Ribosomal protein S12 methylthiotransferase RimO
|
publication title |
Two Fe-S clusters catalyze sulfur insertion by radical-SAM methylthiotransferases.
pubmed doi rcsb |
source organism |
Thermotoga maritima
|
molecule tags |
Transferase
|
total genus |
124
|
structure length |
424
|
sequence length |
432
|
chains with identical sequence |
B
|
ec nomenclature |
ec
2.8.4.4: [Ribosomal protein S12] (aspartate(89)-C(3))-methylthiotransferase. |
pdb deposition date | 2013-02-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00919 | UPF0004 | Uncharacterized protein family UPF0004 |
A | PF04055 | Radical_SAM | Radical SAM superfamily |
A | PF18693 | TRAM_2 | TRAM domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | Nucleic acid-binding proteins | ||
Alpha Beta | 2-Layer Sandwich | Transcription Regulator spoIIAA | Transcription Regulator spoIIAA | ||
Alpha Beta | 2-Layer Sandwich | Transcription Regulator spoIIAA | Transcription Regulator spoIIAA | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |