4JC0A

Crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
432
structure length
424
Chain Sequence
RVGIKVLGCPKNEADCEVLAGVLREGGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSFVDAKDQYGYKLVVKGCLVQRYYEELKKEIPEVDQWIGVADPEEIANAIETDLVPDRYRKRIDLEERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribosomal protein S12 methylthiotransferase RimO
publication title Two Fe-S clusters catalyze sulfur insertion by radical-SAM methylthiotransferases.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 124
structure length 424
sequence length 432
chains with identical sequence B
ec nomenclature ec 2.8.4.4: [Ribosomal protein S12] (aspartate(89)-C(3))-methylthiotransferase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00919 UPF0004 Uncharacterized protein family UPF0004
A PF04055 Radical_SAM Radical SAM superfamily
A PF18693 TRAM_2 TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jc0A04
3.30.750.200 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A03
3.30.750.210 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A02
3.40.50.12160 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jc0A01
5LMNW 3FHWA 4Y7NH 1IBLQ 3Q8DA 4BY7H 1KRTA 1NMGA 2OQKA 4B3RQ 1E22A 2I5LX 2K5HA 4FDBA 2NVXH 3CCMA 1I94Q 3TRZA 1AE2A 3ZJYC 4DR4L 2MFIA 4C3IH 4DR1Q 1CSQA 1L1OA 4UP7A 4YHHL 2MNAA 4DR6Q 3JAMi 3A5ZB 3F1ZA 4DV5L 4X64L 4EQ5A 2R92G 3HOYH 3HOWG 4A3LG 4YY3L 3ERSX 3W1GA 1OXUA 3HOXG 3PIOA 3ICEA 2JEBI 4NXNL 1NE3A 1M1KC 1QVGA 3STBD 4DV4Q 2UUAL 1HNWL 1E1TA 5IE8A 2E5LQ 5JJIA 5FLXc 3A0JA 1EIFA 1Y1WG 3KLWA 1VQCA 1FGUA 5IP7G 4DV6L 1XNQL 2RHQB 1RL2A 4IFDG 3GDEA 1HZAA 5IYCH 1VQOA 4DUZQ 4DR5L 3RLNA 1Q7YC 2RF4A 3W1BA 4A3GG 2YTYA 4LF9L 4JV5Q 1PH2A 1TWGH 5M3FH 4GKKL 3UDXA 4IPCA 1N34Q 3AQQA 4DV7Q 1L2FA 2WAQG 1MIUA 1CKNB 3KJPA 1N36L 4LF6L 2F4VQ 3U4VA 2E2HH 2JA8G 3T1YQ 3GTPH 4BBSH 1TXYA 4LFCQ 1MJEA 1A0IA 4LF7Q 2RHSB 4BBRH 3CCSA 3S15H 1HZCA 3CMAA 1G51A 1VQJA 3OYYA 1YBYA 4HIKA 1ASZA 2HQLA 1DGSA 1YZ6A 2KHJA 4XTCS 2WFWA 3E0EA 1B8AA 1FJGQ 4X66L 4IFDI 3I2ZA 4A3CH 1FL0A 1K9MC 2LSSA 3S2DH 3PF4A 3EN2A 3STBC 4APVA 1VQDA 4DK3C 2CQOA 3AYHB 2D62A 1VQKA 3F2DA 3RZOH 1NMFA 1SN8A 5LMNL 2UXCL 4LW1A 2CCZA 4JI5Q 3D31A 1PH7A 1IBML 4LF4Q 1W2BA 1BKBA 2YTXA 3L2PA 5IYDH 1CSPA 2RCNA 3CXCA 3CD6A 2XTIA 3L7ZC 4BA1I 5M5WH 5IYCG 1VS0A 4L5QA 5IY0A 2L15A 3J7ZC 3BJUA 4IOCA 4A3EH 4LFBL 3CF5A 4JI4Q 1GD7A 2Q2TA 4C3HH 1JE5A 4YWKA 4POFA 3CC2A 1UE5A 4OWXB 4GNXA 1Q12A 3I4MH 4JYAL 4IOAA 3UE1A 3F2BA 1PH8A 2JA5G 4BBSG 4YCWA 2ID0A 3PGZA 2R7ZH 2C35B 4BBRG 3S17H 2D0OA 3S1QH 5AJ3L 1D7QA 1U0LA 4QL5A 2JJQA 3I55A 1Q1EA 2K5NA 3RLFA 1BBWA 2ZJQA 3K81C 2KCMA 2VUMH 1X3FA 3KF6B 2JA7H 2Z0SA 4JI3L 4LF5L 3PO3H 3HKZE 4DV3Q 1T9HA 1NJIC 1K8GA 1N33L 4JI1Q 4YWLA 5GROA 3FP9A 4IPDA 1Y14B 5C0XG 5IWAQ 2OCEA 3U58A 4JI2L 1IYJB 4YWMA 2AMCB 3J80i 4JBJA 4JBMA 1TWCH 1J5EQ 1KAWA 2K4KA 1IBKQ 4HJ5A 1HNZL 4JOIA 2PI2A 4A93H 1BVSA 3BU2A 1PFSA 1I50H 2CWPA 2UUCL 4AYBG 2VZAA 2D0PA 3KJOA 2ZM6L 4JC0A 2I0QA 4NXNQ 1WOCA 1HNWQ 1HR0Q 1KIXA 3AEVA 1E1OA 4R4OA 1QUQB 4LNQA 4A3MH 3DLLA 1EOVA 3HOUH 1L1OC 1TWHH 4Y52H 4DV2Q 4R1JA 5C0XI 1N8RC 4JI7L 4A3BH 1Q8KA 3U50C 2AKWB 2LXKA 3J81i 1KHIA 4IFDJ 4LF9Q 1WCMG 2F52A 4P75A 4OONA 3TS0A 4GKKQ 1K0RA 4KLKA 4PZ6A 1SR3A 2VUMG 1O7IA 1W3SA 1VQLA 1N36Q 2R7FA 1CKNA 4NPSA 5JJLA 3NBHB 1VQAA 3TS2A 2JE6I 4GLAC 3PO3G 1PH6A 4EX5A 4B3ML 2Q2HA 3PUYA 1GKHA 2K14A 4QY7A 4A3DH 4L5RC 3K0XA 1Z9FA 2CFMA 2GVBA 2A8VA 2JA6H 3RN2A 2WB1G 5IP9H 2ZTDA 1OXVA 3A74A 1S40A 3H3VH 3E9IA 4LFAQ 1IL2A 4X66Q 1Q46A 5GAGC 3T1HL 3RLOA 2N49A 3W5OA 3H15A 2IX0A 4A93G 4DUYL 1XPUA 2YTVA 4A3IG 3CCVA 4QQBX 1XMOQ 3CPWA 2QA4A 4L5SA 4IPHA 2UUBQ 2VQFQ 5LMNQ 2UXCQ 4MNOA 4ALPA 1PH3A 1JJ2A 5BR8Q 5C3EH 4A3MG 2PMZE 1IBMQ 1C0AA 3HOUG 2AWNA 3CPFA 2PQAB 2AHOB 4PZ8A 3G4SA 1A62A 1EYGA 3S1MH 4A3BG 4DR7L 4OO1G 2VS1A 4OX9L 1VQGA 4DR3L 4GLVB 3ULJA 4X65L 4DV0L 4JI8L 4AQYQ 4DR2L 2V1CC 4IPGA 2PNHA 3PO2H 4NXML 3GTGH 2I5HA 4PZ7A 3PUXA 4HJ7A 4JYAQ 2UXDL 3RN5A 3SGIA 1JJCB 1HNXL 4J15A 1SE8A 1AH9A 4GOPC 1VQFA 4B3SL 4HIDA 1VQPA 4HJ9A 4BY7G 5FLMH 2YU9H 4GKJL 3K80C 3PUWA 1G291 1IXRA 2JA9A 3S1RH 3J7A5 3B6YA 1GM5A 1PH4A 2R93H 3DM3A 2Y0SE 5AJ3Q 2EIFA 3GTLH 3OTOL 2YV5A 3UE0A 1UWVA 2VL6A 3I56A 2JA6G 2IX1A 1JB7A 4R4CA 5LMUL 3UDIA 3HOYG 4MZ9A 1Q81C 4JCVE 1VQ7A 2K75A 1EWIA 3KF6A 4OO1I 4KHZA 5J3BA 4JI3Q 2E8GA 4LF5Q 4B3RL 2BA0A 1N33Q 1OTCA 4A4IA 1I94L 3AFPA 1GO3E 5FJ8H 5IYBH 3RNUA 2E2JH 4KHPQ 4GLXA 1UE7A 5E7NA 1K73C 3I4NH 5C0XJ 2UU9Q 2ALYB 3CCJA 1LTLA 3MEFA 1SFOH 5C3EG 1X3GA 4C2MH 5M3FG 2UXBQ 2E2IH 1HNZQ 1OXSC 4JI6Q 1U5KA 4IJLA 2E5LL 1YIJA 1EIYB 3CCEA 3GTQH 4JI0L 1V1QA 4OWTB 2UUCQ 1KC8C 4DK6C 1KD1C 4GN4B 3H3VI 4B3TQ 2NN6G 4R4TA 2ES2A 1CKMA 1X55A 4ME3A 3PIPA 4DUZL 1PVOA 1B70B 4L5TA 3CW2C 5JJKA 1A63A 3HOZH 1QUQA 4JOIC 5FLMG 3NENA 3NEMA 1Y1VH 1N34L 4DV7L 4POGA 1VCIA 1PH5A 1HH2P 2I5MX 4H02A 1MKHA 3T1YL 2VQEL 3LGJA 2WAQE 4LFCL 3WWVA 1YHQA 1CUKA 2HHHL 4A3CG 3F8TA 2Z6KC 3HKSA 3H0GH 2MO1A 1VQBA 4R4IA 4A3FH 3D0FA 1PA6A 3IRBA 4AH6A 2ZJRA 3RR5A 1E3PA 2JK8A 3GO5A 5DLQE 3CCUA 2NZHA 2NN6I 4DR4Q 2HIVA 5IYDG 1E7ZA 1EUJA 4YHHQ 1EQQA 4A3EG 3FKIH 4DV5Q 4K0KL 4X64Q 1WI5A 3JC66 4QIWE 4X62L 4YY3Q 1OXXK 3PUVA 2UUAQ 2MQHA 3VDYA 3I4MG 1VQ6A 4TVAB 3TREA 2KCTA 1K8AC 4GOPB 4LF4L 2XGTA 3KDFB 1KRSA 1L0WA 2CWAA 4DV6Q 2EXDA 5C44H 1XNQQ 2R7ZG 1I6HH 1YJ9A 1G6PA 2A1AA 1SROA 3CC7A 1KQSA 1K3RA 5GQOA 1CKOA 4DR5Q 2JEAI 4AIMA 2CKZB 3HOXH 3HOZG 3PUZA 3E9HA 5C4XH 4JBWA 3UDGA 2LXJA 1Y1VG 1I3QH 4YCVA 3CCQA 1UEBA 1UE1A 2PQAA 4LF6Q 1PYSB 1Y1WH 2ZJPA 4OX9Q 1OXTA 4DR7Q 2JA7G 1HZ9A 3MXNB 4P72A 3UDFA 4DV0Q 1XMQL 1VQEA 3RZDH 5H1SE 3F2CA 1YEZA 3H0GG 3CQZH 2UXDQ 4JBKA 1N9WA 1WJJA 4HJAA 4A3FG 2IT1A 3PV0A 4UP8A 4B3SQ 5GAEC 1X9NA 2OTJA 3GTKH 2NVYH 4JG2A 1E24A 3G48A 1XNRL 2JA8H 4LF8L 3HOVH 2VNUD 1BBUA 4DV3L 3M4QA 4LUZA 2B29A 5LMUQ 2JQOA 4UPAA 1QVCA 2KHIA 1QVFA 5ELNA 5C4JH 1IZ6A 3S14H 5K36G 3GTJH 4IO9A 3BZCA 3G6EA 1JMCA 1J5EL 1R9TH 2DGYA 5IT9c 1VQMA 3A5UA 1IBKL 2WP8J 1YITA 2NVTH 5C44G 1ASYA 4A76A 1PHJA 1D8LA 1SLJA 4LFBQ 1P8LA 2MO0A 1EFWA 4LWCA 1V43A 4RG1A 5C4XG 4XIGS 5JEAG 3GD7A 4A3JH 1LYLA 4AYBE 1HR0L 2Q2IA 3S1NH 4P74A 4BA2I 1Q1BA 3J80c 2GVAA 2K52A 4LUOA 3CMEA 4JI0Q 1VQ5A 3K7AH 5GADC 3J81c 1LM0A 1X65A 4P73A 4DV2L 4DV1L 2BH2A 3HFZB 2ATWA 2K50A 3TQYA 3M3YH 2B3GA 4A3DG 3PCOB 4NB3A 2BA1A 1HZBA 1YJNA 3EIVA 5IP9G 2NZOA 5HGQA 4GNXC 4OXPA 1N32L 3K8AA 2B63H 1H95A 3I7FA 2JA5H 3HKZG 1VQ4A 5M5YH 3HOVG 1IBLL 2ASBA 2VQEQ 2HHHQ 4A3KH 2R7DA 5ELOA 2KBNA 3JAMc 4KI0A 1YVCA 1XPRA 3KF8B 1QZGA 4HIMA 2N78A 2F3IA 1L1OB 4GN3B 4DR1L 3CC4A 1YJWA 4GS3A 3S16H 4DR6L 3M4OH 3PF5A 1YHAA 1VQNA 4JI2Q 4O0AA 1QZHA 4P71A 1XTDA 4LFAL 4UY8C 2WB1E 1A8VA 2N8NA 3CCRA 4DV4L 2K5VA 3GTOH 2OWOA 2VY3A 2H5XA 4K0KQ 1S3OA 4X62Q 1XMOL 1PH9A 2ZM6Q 3KOJA 3J81j 4A3JG 4C3JH 3PO2G 2UUBL 3ER0A 2VQFL 4HJ8A 3CCLA 5BR8L 2EQSA 3M4PA 4JV5L 4GOPA 1KL9A 1WYDA 3KDFA 1YI2A 3PSIA 4BXXH 2PI2E 2F4VL 4JI7Q 2R93G 1GVPA 2ZTEA 4BY1H 4LUVA 4OWWB 2A19A 4AQYL 4TQUS 2N3SA 4LF7L 1PV4A 3ULPA 1VQ8A 1PH1A 1NY4A 1YHBA 2B63G 2IHFA 2HT1A 5GAHC 4DKAC 3TEHB 1C7YA 1SMXA 4PG3A 4X6AH 1XMQQ 5M3MH 1TWAH 1NTGA 1NBWA 1TWFH 4MTNA 4A3KG 1VQHA 2HIXA 3NELA 4WJ3M 3M85A 5IYBG 5FJ8G 1FJGL 4B3MQ 1C9OA 3KFUA 3M7NA 1WCMH 3I4NG 1B7YB 2IHEA 3K7UC 2R6GA 4QGUA 2Q2UA 1X54A 1RIPA 1HR0W 1XNRQ 1J6QA 4LF8Q 1HJPA 3T1HQ 3M9BA 3AFQA 4JI5L 4DUYQ 1XJVA 4GN5A 4DAYB 5EAYA 1X6OA 4UP9A 1WFQA 2OQ0A 1XPOA 2AWOA 5M5XH 4KHPL 1LUZA 1VQ9A 1VQIA 1V9PA 2YYZA 4QJFA 2UU9L 4O2DA 2R92H 3U4ZA 1P16A 1Z47A 3HOWH 4A3LH 2IY5B 4JI4L 1YNXA 2UXBL 4GNXB 1X3EA 4JI6L 2QGQA 4BXXG 2BH8A 4HIOA 5HY6A 3S24A 1FVIA 4A3IH 4BY1G 4DR3Q 1M90C 5IP7H 4X65Q 3CP0A 3G71A 4JI8Q 1K83H 1MJCA 2QEXA 4B3TL 4DR2Q 4WJ4A 1S72A 2GN5A 2DUDA 4NXMQ 1JT8A 1AE3A 2Z6KA 3KYHC 5JEAJ 2VW9A 2OTLA 1EQRA 2NVQH 3BZKA 4PMWA 1HNXQ 4A3GH 4IJHA 4YCUA 1X56A 5M3MG 4RMFA 2KENA 1I5FA 3ULLA 1Q86C 2Y0SG 4A75A 3L0OA 4GKJQ 2FXQA 4DAMA 4DV1Q 3GTMH 1KXLA 3I4OA 1PYBA 4DPGA 1JJGA 1Q82C 1UE6A 3OTOQ 3EBEA 4DNIA 3S2HH 3OW2A 3CAMA 3FKIG 4JI1L 2ZTCA 1N32Q 4R4QA 5IWAL 1SRUA
chains in the Genus database with same CATH superfamily
2HHJA 1MB3A 3UOAB 5B7QA 1EFTA 3TLBA 3ZE8A 1FFCA 2EJUA 2YN4A 4J1TC 1TRHA 2FKAA 4W5OA 4LY9A 3K5OA 1PH2A 2R3SA 4AC9A 4CFYA 3MA0A 1M67A 2CXQA 3W78A 4GZLA 4Q12A 4FDAA 1BWQA 2BEWB 4EB6A 1XB2A 2P9YA 2HU8A 4LI3X 3EPPA 3MINB 4F3RA 5F9HA 4JI4Q 3O31A 3I05A 4EGAA 3F4KA 4FOPA 3L4KA 1LTQA 1YB1A 1VIDA 4IVNA 3PD0A 2AQ8A 1Q0RA 2XNDA 4EY8A 4RLQA 2V0NA 2Z2KA 1NJIC 3PFHA 2WM9B 4AM8A 4FFOA 5KRUA 1CUZA 1YRBA 4HQ0A 5LYJF 1SZCA 3E5MA 1ULZA 4YWJA 4LHYA 1DZ3A 1B2TA 4I65A 1XXGA 4DF7A 4JXKA 1KIXA 4PC3A 3SJBA 5IPFA 4ROSA 1J6UA 4UXIA 1TVKB 4F06A 1EVIA 2DUJA 2CZGA 1YV9A 3OKCA 1RC1A 3DV0B 3UJBA 2A35A 1ZG3A 5JYCA 4Z0NA 1S40A 3X1DA 4EFDA 2CYCA 4PZLA 3NGLA 3W5OA 4IL5A 4FDVA 2YTVA 3CCVA 1LI7A 2H9IA 4RNDB 5EJIA 4UVGA 3LY7A 2BFMA 2WYWA 4TKVB 2MGSA 1KPHA 3E0QA 4L27A 4RJKA 5FOUA 4TXNA 4CM8B 1AH9A 1NBOA 4BY7G 3B3AA 1O95C 3CPHA 1XYVA 3H0KA 3CH4B 1QE0A 4JCVE 2XUIA 2ERCA 1BVYF 2WU4A 3UWKA 3QEAZ 3I4NH 3QKSA 4PYRA 3QWFA 4OMUA 1XZBA 2G67A 1I6LA 3MWEB 4F3KA 2P4UA 1HI9A 3QTTA 2Z09A 5GADl 3H5IA 1PLLA 1M6WA 1G9SA 3O4IA 1CUKA 3DL2A 2GEUA 3IOYA 4GR9A 2L9HA 1SE3A 4KQMA 3VSAA 3ODGA 2DNEA 1GNPA 4OHVA 1EFDN 3TM5A 4YONB 5CDHA 3LECA 1Z4IA 3TTWA 4ITRC 2YV3A 3DC7A 3KB6A 4NTZA 4ZPJA 2HBZA 2JK1A 1D9ZA 3UDGA 4MVJF 4GYWA 3E15A 1B3RA 3SHOA 1SC9A 3EXIB 2A5DA 4UUBA 4IZHA 4UOQA 2CNWA 1ZJ4A 1E2VA 5FYQA 1UC9A 3HG7A 3MWFA 1Z5NA 3SZ3A 2JD1A 4GNRA 2YJTD 2P90A 4YUWA 1UDAA 4N01A 1MV8A 1PHJA 3SICE 3RNLA 5G0VA 1KNXA 3TNJA 5AW0A 6LDHA 3AXSA 3TM4A 1AN8A 3H8SA 4U7JA 1HR0B 1IL8A 1QIIA 2JP1A 1XP8A 1S2LA 3NUGA 1JR3D 4P5DA 5AM2A 3RROA 1BDBA 4W5QA 2QSYA 2F3IA 4E1VA 4ZU6X 5BYJA 1VYUA 1E9FA 2FQXA 1YBFA 5F7XA 4KRXA 1ZH4A 2EWMA 3OX2A 3QOFA 5K01A 2B2TA 2J07A 1C4XA 2UUBB 2H2DA 5K2MA 1XRRA 4Z0HO 3K32A 4DWJA 4E6EA 2ZUUA 3D4WA 3PB3A 2N3SA 5B12A 3CLTD 4IDFA 1AGYA 3ETNA 4JLBA 3ZKWB 1R0ZA 3EWIA 3CZ9A 3EMDA 2VYND 4F93B 5COQA 1ZSYA 2JKZA 4PLGA 1ORDA 2ATCA 2XECA 4RMHA 1MB0A 2OQ0A 4MWEA 1NDHA 4KPYA 2XUKA 1L7BA 4CR7A 1E9CA 4G5QA 3TAHA 1GLVA 2A9PA 3RR2A 5D1HA 2FEXA 2G0TA 5JT1A 2LGJA 3LUPA 2SDFA 1OIWA 1JXQA 1C7FA 5GVSA 3ECCA 1CY4A 4IGAA 5E6SA 2QAGC 1TJNA 2A86A 5JAIA 1OWMA 2V4UA 3LP5A 2O0HA 5JZBA 3HHPA 4LHXA 1CFMA 3IH5A 5KX5B 1E7QA 2NB0A 2AR0A 4DK1A 2BEJA 4E30A 5KAMA 1ZKOA 2IJGX 2J3EA 3W1VA 1KI3A 2KX7A 3KQPA 2YWHA 2PJDA 1O97D 1V7ZA 3SJUA 1EB8A 2Y3IA 1ADFA 5DN6D 2ZUBA 5IVHA 2A6PA 1DKRA 5U4XA 2KHJA 1J1IA 1CZNA 3EXFB 2JJMA 3DOCA 3I73A 1I7NA 3CHBD 3F2DA 4QDTA 2UXCL 2YDYA 4RVGA 5CB0A 2LCFA 5KU7A 2HF9A 4BAGA 1VS0A 3PPWA 1XZMA 3QOJA 1X8KA 3VVMA 3M5PA 1KJWA 1U0GA 3KU1A 3LTEA 2EF1A 3G85A 4YCMA 4WFIA 4QL5A 4D5GA 3GWGA 3VGJA 3W2IA 1Y6GA 2KA5A 3CZCA 2QEJC 4K46A 4C0JA 2F8TA 2OCEA 3WKEA 4UXJA 1GGHA 3T7AA 4Q00A 2CXTA 3LO5A 3Q40A 4XM0A 1JWUD 5IJXA 2ZRAA 1UAPA 2F0DA 4LIPD 3OUUA 1G8JA 3SYLA 3PFGA 3U50C 2WE7A 2ZWAA 4BX0A 4OU4A 3OSOA 4TL6A 4RZUA 4EPRA 1OLXB 2PQMA 4S1NA 5KOHB 2FWBA 2PUVA 3FKQA 5IVIA 1B50A 4QQBX 4RBNA 2UXCQ 4M88A 1SC1A 1DL5A 5JATA 1UNSA 3S1MH 4A3BG 3M70A 4DF3A 3MOGA 3SXPA 4PZ7A 1DBPA 4OXXA 4FYIA 2WJVA 1B8NA 2ZTVA 3TRKA 3GNSA 2OO7A 2HRQA 4HYQA 4N7JA 4QC2A 3NDJA 5FA5A 1Q81C 7GPBA 1PD0A 1QH8A 4BZWA 1MIOA 3IB6A 1O6BA 3HDYA 5C0XJ 1GIAA 2CW0C 1SWVA 3LQRA 1YR2A 4LNAA 4C1NI 3SK6A 3R2IA 3VO8A 4HFMA 2K5QA 2J85A 1SCUA 2VHQA 4XWKA 4V1CI 1Q1AA 2ZIXB 5FPKA 1O94C 3S81A 3E3MA 1H4VB 4O4HF 5AKKA 4G5RA 4L02A 3K0EA 1QF9A 3MQFA 4R3UC 3N07A 3L79A 1U0EA 4UTPA 3ZLUA 1K8AC 1NBIA 2X8LA 3JALB 3ZGOA 1U5BB 1Z8NA 1GR0A 5C44H 1XNQQ 3CC7A 1NBEA 2A57A 1ZIOA 5C4XH 5TVKA 4EX7A 5BN3A 4TGLA 4B6FA 2CJXA 3U7RA 5C1DA 1MAUA 3AI3A 1UBTS 2QK4A 2IPMA 3GLFB 1PFGA 4U02A 1XNRL 2AQ3B 5CB4F 4YMIA 1K83B 2JHGA 4MWOA 1E1CA 1ORIA 4CM5A 1T1IA 2XE6A 3L8EA 1X74A 3K8YA 5JDIA 1I2BA 2ZIZA 3DEPA 3TQYA 5AUNB 3M3YH 4FSHA 2YWBA 1LWOA 4OQLA 3EIVA 5IP9G 1SHUX 1XRNA 1L5VA 1EXMA 1Z88A 4Q5VA 3T1TA 5F5XA 2OHXA 3TUIC 1YJWA 4IJUA 3PF5A 3GJTA 4KXNA 1GSAA 2PCJA 4DPKA 1QYWA 1VE1A 3N0WA 3LXXA 3PQEA 3K0CC 1GQFA 3G2QA 1JIUA 4W6ZA 3NETA 4W5JA 2WVHA 4TQUS 5A2QL 3ZBPA 4KACA 1G8MA 2ZU6A 3K1AA 5T3YA 1DWOA 2HDNB 1NC1A 2HMSA 3K15A 1Z3IX 4WZ6A 3ETDA 4DT1B 2JHPA 1J8FA 1YQXA 1XNRQ 3H16A 4PZZA 4XCQA 5I4DA 5A5DA 1U4RA 3RI3A 5EPEA 3TR0A 4PSDA 3IELA 4R9NA 2FF5A 4NPHA 2PGJA 4NXMQ 3LT1A 5EUUA 5LL6P 2VJQA 1WTXA 1EU4A 3VO2A 1AHIA 6YASA 1OHHA 4HFNA 1H6AA 2DHDA 1MX1A 5EQJB 3U4AA 3E5HA 3IMGA 4KOEC 1LT3D 1PG2A 1HNWB 2VEOA 4MAMA 2H2AA 3PI7A 2P35A 1VSUA 2CJPA 3W6ZA 5C9ZA 5FJJA 1GQQA 4DGZA 2VTBB 1SHLA 5EZYA 5JVDB 4C0QC 3BVZA 3DMDA 5CJJA 4BCDA 2K1BA 2KEEA 1T8PA 4I9UA 4Y6QA 3EJ6A 3BZDB 3NM4A 3ROFA 3ZCRA 1CFJA 3DOUA 4RD4A 3BCUA 4HX2A 3VNQA 4TWBA 5F7OA 1JDVA 3K58A 1V2GA 5EP1A 4ENRA 4LQ4A 5CCDA 5H8WA 1MO5A 3FUWA 5KINB 1F12A 4D43A 5E9WA 2WTEA 4PQXA 2QMOA 2E2WA 3NOXA 3PGKA 5CDSA 5HZMA 2PWZA 3K81C 2D4HA 1D6SA 2Z4RA 1SR8A 3V1UA 2PRIA 5HK9A 4RA6B 1F77A 3T5AA 2X1MA 3HMKA 4M38A 4JOIA 2X40A 1PFBA 4AYBG 5CLJA 1NMEA 4M86A 1MO3A 4IV5A 3PFIA 2KQUA 4CI9A 3AV3A 1E61A 1HLGA 1CZRA 5FPQA 3U5ZB 3A1SA 3R9WA 2R86A 1CRZA 1JA1A 1Z75A 3G17A 1JQJC 4BMPB 4PSUA 1IAVA 1U6JA 4HMPA 2CVRA 1RYNA 1P61B 1M33A 2YWRA 5TQVA 1T9ZA 5B37A 3KZXA 4QUKA 1K8XB 4FC7A 2X0DA 5JDCA 2PQAB 1V4NA 2ODAA 1R8SA 3I91A 4Z3KA 4AZVA 3GTGH 2B37A 1JJCB 2WF8A 4CQNA 3LQFA 2XBMA 1TMYA 3C74A 5J1ZA 4POAA 3D7RA 2FSUA 3GTLH 3AFNA 1RRFA 1HTPA 4DDHA 5LMUB 2Q6LA 2BYTA 1FP1D 2EBWA 4D9GA 3CNEA 4L6AA 4KPUA 4RC9A 4H3HB 1AKUA 2CEKA 1Z15A 2HHCA 4DV4B 2ZXEA 2RI6A 4XJTA 2CW5A 1Z6GA 3O26A 2BI4A 4WXPA 3KT8A 1M73E 4ZVRA 1ADGA 4QL3A 3K9CA 4HH0A 3R7NA 2Z4TA 5EJAA 1XWIA 2FUKA 3C1UA 1P9WA 1ODIA 2VXWA 3HXMA 4D82A 3TINA 1T6ZA 4DGHA 1YZFA 1Y69U 5I7RA 4ER0A 3L92A 2R6JA 3UH0A 4CHTB 2C5SA 3WR5A 4B3CA 2NACA 1E2LA 4KR6A 4BNLA 1STYA 2O0LA 4I55F 3DE1X 4A3FG 1TJPB 3VPDA 1XTSA 4OHZA 4WN9A 5TQ2B 4JLVA 2WKWA 3NKLA 3OOHA 1AQYA 3ITEA 4IO9A 1IXRC 2LIVA 3PX2A 3FIJA 3VR2D 4HWRA 3BRSA 3OZRA 3S2HB 1Y98A 1UDBA 1SPXA 1EX1A 4PR3A 2R65A 4P92A 4Q9LA 2HL6A 1J2YA 2NVXB 1GZSA 4JC8A 2DQYA 1LY1A 3CUWA 4X8HA 5ALQA 4IXNA 3BMCB 3INNA 1HSOA 1LK7A 3ZWAA 2QUAA 5JS7A 4JI2Q 1EH5A 4DDTA 5TS2A 1IW7C 1NTRA 1A88A 2P7IA 2I62A 1UWLA 1A7AA 2O14A 3IKVA 1QTQA 1N6NA 4WKBA 1DBSA 2O2GA 4X3KA 1H2AS 4CMIB 3ZWWA 4ZZ2A 4AJ9A 1FNBA 1QSGA 4R2MA 1XTCD 4JP1A 5D65A 3CTPA 3UXYA 3PFWO 4OJYA 1TEVA 1LA2A 3NPPA 3IDQA 3PLNA 2HD4A 1MVOA 1D8TA 1XFAA 3OY2A 5DSZA 1JU9A 4WUTA 1DCMA 2IGTA 1EWKA 4Y2SA 4BC0A 3O91A 3VTKA 4ZT6A 2GARA 4ZRZA 1VKZA 1AA9A 4ZYSA 2WUFA 2VK4A 5CIQA 5A4DA 2FXIA 4PYNA 5JEAJ 5FJIA 3W5SA 5U9CA 2VNKA 1RADA 3F46A 4FXKC 4XYGA 4FXDA 4CTKA 1TCUA 1C41A 1FW6A 1YJ5A 3L1VA 4EQ6A 5KYYA 3C1OA 1P2TA 1A7JA 3QW4B 3PIOA 3A4TA 3ZBUA 4FE3A 4IDCA 1RDPD 1NY6A 1HNNA 5PGMA 3II6X 2ZRJA 2D5DA 3W1BA 1DX9A 5C5CA 2YXEA 4PY2A 4YV1A 1L2FA 2JLZA 3T1YQ 5IJ0A 4K9SA 3OJWA 4LFCQ 4M9RA 3D8RA 5J9FA 2NU7A 2ZI9A 4KWEA 4HDSB 1QLJA 4BV2A 2RONA 3IS3A 4GMKA 1GOTA 2GN9A 2Z95A 1QHNA 4KYTA 1T4CA 3DVQX 4V38A 2Q6OA 1KYWA 4L73A 3RREA 3WGGA 4NZYA 3NWTA 2OY0A 5E7JA 1WCXA 2ZO9B 1FE8A 4BGUA 4FYVA 4UVEA 3ICWA 4XFKA 5J2TB 2WJ6A 3HGTA 5FTNA 3WWPA 1QLHA 4MEAA 3DAPA 1RVV1 4OQQA 1WPQA 2AUJD 3J80i 4JBMA 4R40A 2XMGA 3RVLA 5BMVA 3AB9A 3LNCA 1PTOB 2JGIA 1PFSA 5AVUA 1S5ED 2ZIGA 4K03A 4KN9S 4A3BH 4F5WA 3GJRA 1E64A 2WINI 2HRRA 1XPJA 4B9EA 4Q3DA 2R7AA 3TS2A 4YMVA 5BY2A 4HNAB 4MV5A 4B31A 1Z9FA 1BAPA 1ST3A 4C0BA 1UBOS 3KJFA 3JQ8A 1YB4A 3DE7X 3NU1A 5EUQB 1M8AA 3FNFA 1ST2A 3VC7A 3CPWA 1JHDA 2GXAA 5CFMA 3QF4A 5CB8A 4MPTA 2AWNA 1Q90A 1EZ6A 4OFBA 3L8GA 1JTEA 1ZRNA 2W2XA 4LJ6A 5JCOA 1AKMA 1BDJA 3JD0A 4DGSA 5IS2A 2IX1A 3TZLA 3C15C 4P2BA 1YS4A 3E58A 1EWIA 1N8KA 3FVQA 2J5BA 5JQGA 4A4IA 4C07A 5I4CA 3RASA 4KVZA 5IT9A 4WXMA 4AVYA 5EP2A 2VHCA 3GV0A 3OX3A 3G89A 4ZPXA 4DV7L 4A8JA 5E4XA 1MOQA 3P27A 2XCUA 4KV7A 8ADHA 3LPAA 1TTTA 1PA6A 1X7YA 1R50A 1C1YA 3CY6A 1WUJS 1COWD 4L4XA 3SS9X 2CL6X 4S05A 4MS3B 2PV7A 3BL5A 3WHLA 4ZRNA 1SNDA 2PVPA 2QSUA 2J7PA 1HQYE 3H5OA 1EM6A 2AFHA 3SR3A 2WKPA 4BJ3A 4ZVUA 5B3KA 4A4DA 3FCXA 4II2A 1UK7A 1QS0B 3TRJA 2AE1A 2M2IA 5ALUA 1E2QA 4PZ0A 2KHIA 1C5KA 2A5GA 4EHFA 1O96B 1OXMA 2NVQB 3V1YA 2WJPA 3GJ3A 2OV1A 2NVTH 3G9XA 3OZUA 2X0KA 4YUAA 3U62A 5ISMA 4BV8A 1YZHA 1NX6A 3GQVA 1QFZA 1UC8A 3HKZG 4YV7A 1Q6ZA 4U7HA 4YR9A 3VDNB 4UVIA 5BUQA 4ZCLA 4KPGA 5EHQA 1VKNA 3DAFA 5CA0B 2ON6A 16PKA 2AXEA 3TW8B 1GUYA 2EQSA 2R8RA 3CFYA 2RIRA 5JCZA 4ZT3A 5HZGA 3NI2A 2P0EA 3S2DB 2OBMA 3E6ZX 2PGLA 4D9BA 4O4LB 3V3TA 4KV9A 1R8YA 1P3Y1 2QG9A 4KIGA 2J0TD 2QUZA 3PTAA 2QY9A 2A67A 4JBHA 2ID4A 5CU7A 2UU9B 4MZXA 1R6VA 2IDJA 1PX0A 3EIFA 3KZKA 3UYLA 2E89A 3PHIA 2LZ0A 3LQYA 1Y4DE 1AEXA 1H8HD 3BFPA 3VNRA 4ZZIA 4EG7A 4B3JA 1LRKA 4DLUA 1U3WA 1ZJWA 1UKCA 4YHHL 2VRWA 5FBWB 1V71A 3V8VA 3K0SA 4KNVA 9LDTA 4ERNA 4TN5A 2GXSA 1MJGA 5GOTA 1RAAA 3H13A 1Z5PA 3JQGB 3IAS1 1S1CA 1FRNA 1EWCA 4C4XA 2HU5A 4N8SA 2ZIFA 1NLFA 1XLUA 1LSUA 1XMXA 4HDKB 2PZFA 3K57A 1L7DA 4JSYA 1Y63A 1PL7A 2IYNA 3B1ZA 4PWYA 1SHZA 2F3UA 1A0OA 1G7TA 1XA4A 1ZK1A 1ZM4A 1Z12A 1VGQA 1UBGA 4UD6A 5DOZA 1Q7RA 4DSOA 2RHDA 1F0NA 5AJ3L 2BTEA 2PTHA 2Y0DA 3R7FA 1EM8A 3PFNA 4AJLA 1RYMA 2JA7H 4LF5B 4OFXA 1LJUA 4H4EA 3V80A 2O0JA 1TUGA 1YNOA 2XCOA 4R69A 4WVLA 2XODA 4U2CA 3NHHA 1N7JA 1HR0Q 4TRNA 1VGRA 3UAZA 4UEOA 3UUEA 4L5CA 3RRZA 1CQFA 1SK8A 3T4EA 4JZKA 3LUJA 2PSJA 1WNFA 2KI5A 4KLKA 1R2QA 5HMLA 3EJWA 1QH9A 4F46A 4TT3A 3SCZA 3ZLTA 2IF0A 2AK2A 5KAPA 5JXIA 4YVFA 3ACDA 4G9BA 7YASA 2P77A 3ICQB 1PS0A 5E3IA 2UUBQ 3SK5A 2YCLA 4ZQIA 4QHTA 3PR3A 3ETCA 4Q1EA 1WEHA 5CV9A 5JSKA 1F0YA 1Q17A 1SIBE 3HOVB 3QKUA 1P0MA 1N6OA 5E6UB 2R97A 1LNQA 4KQ6A 4EB3A 3AR9A 3PIRA 5AJ3Q 1RLJA 4R2LA 2O6HA 1KMQA 5HTKA 2FW9A 4H60A 3I2GA 4PYKA 2I4NA 3JQBC 1JIKA 2NGRA 4EI8A 1Q7BA 4X3PA 2XB9A 2YS7A 1W581 4UATA 5JRDS 4R7ZA 5A5FA 4AS3A 3AJ8A 4KJNA 3Q1KA 4HZGA 4FN5A 3LKVA 4V0MA 2CSXA 4A3FH 1CLEA 3CGWA 4WFQA 4Q4AB 2QV7A 3PGMA 1CQJB 3LBYA 5DGCA 2E76C 1AQ6A 2HA6A 3LW8A 4K0KL 1XD9A 1JRLA 3CCFA 1MT3A 2HV8A 2L19A 3I9JA 2Q3JA 2FAXA 3RJMA 2ETVA 1HDOA 2JFHA 1UBLS 1MDFA 3A9WA 1I3QH 1T29A 1DRKA 4XCXA 2YRWA 1Q91A 3THWA 2O7NA 1DTEA 1S5PA 4R05A 4NMMA 4IY1A 4QUGA 1OPRA 3RYFB 2D5LA 1OYVA 3TZKA 4RSHA 4NMHA 3BC1A 1YI8A 3U56A 4AXXA 5EXPA 5ELNA 1J49A 5I47A 4A3GB 1AHPA 2OD2A 4ARCA 3M3DA 1BS1A 3C97A 3L7KA 4RFLA 1UL1X 4IS3A 5KJ1A 2YXLA 2BH2A 4RPCA 1NY5A 3D54D 4ZYUA 2XF2A 4KE6A 2BHLA 1NQOA 4YJKA 3JAWB 1Q74A 4B40A 2QUBA 3TQIA 3LRPA 3EBLA 5DHUA 3MJVA 4MQEB 1YDHA 1QZHA 2FNAA 2XUJA 8AT1A 3GZTB 1GGJA 4K0KQ 4WY5A 4DBVO 3F6EX 4U673 2IEIA 3KEOA 3A7EA 5FPTA 2IYEA 2GEDA 2PPLA 5HFJA 1GCAA 4BRZA 4E94A 4NP6A 1Z83A 1OAOA 1UPXA 3CM0A 4XXHA 2WD8A 4M7RA 5DYNA 2FKNA 3N2GB 2GHIA 5CVCA 1KDCA 4CEHA 5M5XH 1JHZA 1UK8A 3OO0A 3ZCPA 1OIVA 3E27A 1XSEA 4QOEA 4LMRA 2DQ4A 3PHBE 1JB3A 3QHQA 1RQGA 4ZAZA 2H08A 2CE7A 3PNQA 1VCNA 3V8NA 3ASYA 3HRZC 4B7UA 1TDJA 3GX1A 3LC1O 1WBJB 4I5EA 4MVJG 3M6XA 2FMFA 3CLSD 5J2UF 1PK7A 2CNOA 1ZLXA 1R4ZA 1D7OA 4R8MA 2H63A 1EBUA 5A3JA 4DR4L 2TMGA 4Y2JA 3J7TA 3UAXA 1NMZA 2X23A 4HNQA 2RSNA 1BZYA 2WF7A 1PXUA 4HYYA 4ARZA 4P2CB 3O8BA 4N48A 4XZ3A 4INPA 2HYDA 2R1TB 4YP6A 3HR4A 1CERA 2D13A 2B99A 3R44A 1PQWA 1N4AA 4V3CA 2IY8A 2AOVA 2GCNA 5IDYA 2E0IA 4B44A 4B6RA 3CCSA 1KAHA 2Z5FA 3LV8A 1ONSA 3I2ZA 1DIBA 1RDFA 2P9HA 3IPYA 3AUUA 2YJZA 1K32A 1WPGA 4YP7A 4IUCS 4GOXA 1NNXA 2AJDA 1HT2E 5IYCG 4BFTA 5C53B 1WQ1R 3F2BA 1GAXA 3TAUA 3ACCA 4OI4A 4ZWNA 3LX4A 5AP9A 1Y1SA 2BRUA 1K1EA 1NM5A 1KY2A 4RE6A 4M7PA 5EWMB 5LA6A 1ODJA 4TKOB 5FEMA 4H3KB 4V190 2CUKA 2YZ7A 3UV7A 4DXHA 2D5AA 2G8LA 3GVLA 4E22A 1TKAA 2QNBA 4Y0NA 2YY5A 3WLLA 3LWUA 1NLMA 4Q7MB 4YRZA 4A6EA 4JD5A 1T0JB 2O2XA 1XLTA 2PGIA 4QEZA 5JJLA 4AWXA 3WYAA 1C7QA 3G59A 4WKPA 3SBOA 1Q5PA 3PUYA 2WNHA 4DK0A 1U3TA 4FP9A 1GNSA 4EYKA 4AP6A 3AMUA 1CJTC 2AW5A 4NW2A 4QGGA 4DCVA 2H2IA 3H04A 4AB1A 4IPHA 1ZH0A 1RMYA 1A5SB 1YDMA 1TLTA 1IZ9A 3VC2A 3LOUA 1P33A 4JAVC 2FY8A 4AWAA 4X65B 4Z54A 1ZBQA 1JSRA 2OCGA 4PXAA 1T4MA 3U7IA 3V32A 1QOZA 2F8MA 3B1WA 3K8ZA 5TE9A 4LS3A 3Q2OA 1QZUA 2JAHA 4Q15A 3UJ3X 5CD1A 1T2UA 4S1OA 4RF5A 5JI2E 1RRCA 4YGYA 3ZGZA 3HBAA 5EKSA 4MV8A 3O8OA 3MWDB 1U9IC 2GEFA 3QVLA 1KD1C 1V8BA 2CB0A 4DUZL 1BWRA 2VP9A 1PFUA 3EA0A 3CZPA 5C8YA 1LVUA 5KVQA 5B1SA 3RO7A 1HH4A 4HAWA 3I1IA 2NN6I 4HSGA 1QGUA 3ASZA 3OA2A 3D02A 2JGMA 4LCBA 2C3MA 1Z9BA 3O3NB 2XGTA 3KL2A 3TTUA 1QIMA 3UKOA 1NT2A 4D4KA 4KN4C 2FQYA 4MA5A 3T5DA 1JLSA 2XE7A 2C96A 4JZYA 4EQOA 2HR1A 2GM5A 1CFZA 5CAEB 2GN1A 1CHQD 2DKFA 5ECYA 1M1YB 2C1ZA 1OYYA 4E32A 2HA2A 4RGBA 2F0KA 1EFPB 1BOFA 4TKZA 1P8LA 3ZVLA 3NJRA 5GP1A 3H3JA 2NYAA 3VR3D 3DEHA 3OOCA 3SIWA 4QARA 5IASA 4NENB 3NMUF 1M8GA 4OXYA 5CCEA 3WMWA 1B16A 3TBIB 1CF4A 3NWOA 4E7PA 3N6VA 2I4OA 4FT2A 2CV1A 2N55A 5FYDA 3R3UA 5LC1A 5CG2A 4MIEA 1Y5MA 3QW2A 4N9QA 4INJA 1DD2A 4DR1L 1K4YA 3LK7A 1NZFA 4MWBA 2HNBA 4DV4L 4KPFC 3F98A 3B6JA 2H48A 2PU5A 5CLIA 5HCUA 2YVQA 4X1IA 3VYTB 3R9XB 1O03A 2XSCA 3QWNA 1UAGA 4LVCA 4UZSA 4DSZA 1S7CA 2BTQB 3IV9A 4JP3A 3S55A 2G28A 4NBRA 4JL5A 2GJ4A 1BR9A 3AFQA 4KD4A 2R7NA 5CHYA 1G41A 3KPYA 3ABSB 2W2KA 2OBFA 3DBLB 1R9GA 3FNIA 4DLAA 1GXSB 4F3YA 1HE8B 4RDHA 3ZXXA 3STUA 4CWAA 4LX8A 1WXWA 4HDRB 1C0EA 2X9LA 4I81A 2KENA 2CVOA 3DQQA 3EHEA 2MSDB 1Q57A 3QKIA 2VJPA 3B5IA 5JANA 1I50B 1GILA 4NZZA 4ZDJA 3BH6A 2RE8A 4DR1Q 3TLGB 4KTAA 2DWOA 5JJ5A 2WF5A 1RQRA 4X64B 1HFKA 4DV4Q 2JA2A 3MQ2A 4LJ5A 5TF4A 3VR4H 1Y9DA 4YAKA 1H9AA 1U0NA 1QYXA 4HAYA 4HJRA 4BB6A 1ZGBA 5K8VA 2DFNA 2PWPA 1ID8A 3C3BA 1VZ2A 1UM9A 3E7DA 4CTNA 4AMUA 3H1GA 2GWHA 4BATA 1JPNA 5CORA 2DSNA 2C83A 5GJWC 1IH8A 1W34A 3G88A 4HGYA 1D1SA 3WLNA 2N3ZA 2RHMA 2Q4EA 5TR9A 4PTLA 1UT8A 2O1SA 2HXSA 2B2YC 2WM2A 1VPVA 1IXYA 1C2TA 1RXSA 3CKYA 5EIXA 3GGCA 1ESDA 2A78A 3OWXA 3PC2A 5AJZA 2FHSA 2YVLA 1B76A 3B6KA 3HO6A 3M6LA 2KLHA 4BO1A 3GZ4A 1Y5RA 4RVFA 1DAIA 2GKOA 4HTAA 1AGNA 5SYAA 4B4WA 1DQYA 5KNBA 2QRGA 2P40A 3TEMA 1YJAA 3VYSB 2C4NA 1Z4PX 4H7EA 3T5CA 5CT6A 4L1KA 3O83A 2XV1A 4PSCA 3H4IA 3UGQA 3PO3G 3I9MA 4A3DH 2EV9A 3BG3A 1SUWA 4FE7A 3T1HL 5EKUA 4ENQA 4E03A 3BZUA 3KKQA 1U8EA 2CBGA 3DL0A 2PL5A 1MQAA 2NXWA 1YMQA 5ALVA 4DR7L 3HR8A 3OU6A 4DR3L 1FOEB 1YVUA 4F4HA 3GP7A 4RTSA 4GOPC 3C6MA 4CE6A 4N9PA 2Q0SA 1PWZA 2R5WA 4KY5A 2WT4A 4ZOLA 2LXNA 3K53A 3N58A 2PMFA 5BSGA 1HRKA 4KKSA 2J5KA 2O59A 5F12A 2E2DC 1K4KA 2IPLA 3KHUA 3E0JA 1I7LA 4D0NA 4BPRA 5T8KC 1FNMA 1V16A 1L6IA 2G7MC 1C9KA 1L5WA 3GVIA 4KAAA 3IXQA 4B7ZA 4TLMB 1BGXT 1RP7A 1WMFA 2NO9A 2DHEA 1E3PA 5DLQE 1IN1A 1PFYA 2KA7A 5AKHA 2HUPA 2RGYA 5A4MS 2Y6UA 1YQUA 2HRZA 4F5YA 1IXKA 3QPWA 3GMFA 1T1JA 3GXBA 4QZVA 1F20A 1TE2A 4RD0A 4R8VA 1XCOA 4DR7Q 3VPSA 3N2ZB 4U5XA 4QDUA 3UEOA 2Q7XA 1RCTE 3ZGXA 1HUMA 3H0EA 1E89A 1SG6A 1QIGA 3MS7A 1KQ3A 3X43A 2HK7A 3NT4A 3PGA1 1M7GA 3NVAA 3QEOA 3KOMA 2ZIEA 4QSMA 1YR8A 2C4MA 2W90A 4RK6A 3IA7A 3GAAA 1I4TD 1XNHA 4LXHA 3BMNA 2XUAA 3L5OA 3O95A 4CLXA 3GFTA 3I8SA 1ET6A 2R6FA 3MWYW 2Q5LA 1L3CA 3QXXA 4DUGD 1NASA 4K88A 5I7FA 2GHRA 1P19A 4MAAA 3DO5A 1FSSA 3KXDA 2OCBA 2ZGVA 1SY7A 1T36A 3HVHA 3M3PA 4MUYA 4B87A 1FFXB 3TSYA 2NO0A 4YV0A 1YFLA 4L0DA 2RH4A 4W5TA 1IAQA 3MT8A 4YFVA 4AICA 4D3ZA 1BX1A 2PL1A 4YACA 2R93G 2VJBA 2G40A 1V3TA 3U39A 3TEHB 2K87A 1IG0A 5G0SA 4MVJH 5DHTA 3HL0A 2NWQA 4DE5A 3M9BA 3ER6A 2O8CB 2VAVA 4NEGA 3TD6A 1UOQA 3F2UA 1ZM9A 2QW0X 4CL3A 4JK1C 1TZBA 1JLRA 1NUPA 2PMDA 3UWOA 3DZJA 1YKFA 1NGSA 1RM0A 3HJBA 4YXFA 4MJXA 1KMHB 5T6MA 2P2CA 2ZR7A 1ABFA 2I2DA 5CFRA 4NV3A 4BWYA 1HFWA 1ICIA 3Q87B 5BW8A 4Y18A 1M8JA 1GFZA 5KX5F 3L1KA 3SF8A 3PWSA 5ALWA 4I50A 1AS3A 3GUCA 4HNRA 4YYEA 3AQIA 4NVRA 5L3QB 5TIIA 5IYCH 3RFVA 2JLXA 3QA3E 4S24A 4EELA 1CYDA 1P4SA 4LF6B 1J2RA 1G60A 2E85A 1H0HA 2FPUA 4NZOA 1P5ZB 1THTA 4ZKDA 2AR9A 1CBUA 3NNNA 3RIGA 3NBQA 2CLCX 3ETEA 4K14A 4B5KA 2G7ZA 3DDZX 2BMJA 4PF1A 3T94A 4RSRA 3O1JC 3CXCA 2O3JA 4CQLA 2ZSHA 1FF9A 3BIOA 2GLXA 3OEEA 3CC2A 4QG3A 3IALA 1GUNA 2ZUDA 4W1QA 3MBKA 3H4TA 3SQNA 2D0OA 3DXZA 4QRHA 2VHYA 2I7CA 4EHBA 5JPCA 3L3OC 3BGVA 3OT1B 1YQEA 3MUEA 4RXUA 4DNTB 4ZAWA 2DHRA 1QKKA 4ISBA 4YWHA 2JJ1D 4RXMA 5FLKA 5BO5A 1Z5GA 1QP7A 1N5JA 1VIYA 3PNYA 1F4VA 3AERA 1JDPA 4B82A 1OLUA 4ZAFA 3KJZA 3NC4A 3E4CA 1W3SA 1DPGA 4GKVA 1OOEA 4PVDA 1WQ4A 1Z13A 3LOQA 4N41A 1E2WA 2J9YB 4F71A 3AHGA 1QJCA 3VHQA 3TKAA 1DO0A 1HRJA 1VJGA 2XSZD 1RSZA 1Y81A 4ZYXA 4M9QA 4WXRA 2JJ8A 3ESCA 1QV6A 3RN5A 3TMKA 5FTKA 4WBSA 1V0JA 4XD7A 1ENYA 3PEUA 3VI3B 4QBFA 2OORA 1JQEA 1G21A 4QODA 5DBHX 2OZKA 4EQZA 2PQ0A 2QQGA 1YUBA 2M98A 4DJ5X 2R0QC 3JSAA 1KKMA 1JQ3A 2YXBA 5FADA 1SKMA 2JFQA 3T51B 3I5AA 1PNVA 2UU9Q 3HGMA 4XB6B 4U39A 4JQOA 3KIPA 4ALJA 3U19A 3UMYA 1NMSA 4MV6A 2A0FA 3CNOA 3IAHA 2HDMA 1T1SA 5L7TA 4M1WA 3DMTA 1V8DA 4XD2A 2UZ0A 3PZRA 2JBAB 1DZIA 3WGZA 1MC1A 5COYA 3ZIAA 3QLTA 2PD3A 5HWSA 5B1IA 4S12A 2IBMA 2OFWA 1AY0A 4QIWE 5B3JC 3TNDA 3HKDA 2ZROA 1H4SA 3IAYA 3DDWA 4TS4A 4V2IA 3FGZA 3EA4A 3G2IA 2FFQA 1QVZA 1RS0A 3AMVA 4P36A 2ZSFA 4Y2QA 1VF7A 5E7IA 1TQHA 3OIPA 3PS9A 3N76A 3O4GA 4D26A 3FBWA 1OFTA 1X1CA 1E3JA 1PTOD 2NUBA 4AXBA 2OM6A 5CBPA 1LV7A 4G26A 1NV9A 2HMWA 1CCWA 2NZUG 1DPFA 4KIWA 3WP1B 4D41A 3QVJA 3F9CA 4H9GA 2PKRA 4I36A 3BIFA 2RHJA 3UHPA 2F0HA 4LV6A 1L7NA 2O3QA 4ED9A 1K88A 5KWEA 1AUVA 1ZIPA 4XX0B 1A9OA 5ILOA 1B42A 1L7RA 4FBGA 5TEVA 4D9NA 2UDPA 5GONA 4RKWA 4F21A 5AKYA 4HIMA 3T7RA 4J0JA 4H17A 2QX6A 1VCHA 3GELA 3T1QA 4Q47A 2R87A 1RC8A 3FTFA 3CCLA 3WLAA 4UDNA 2MU1A 2H1LA 3U3ZA 2ZRGA 3G1UA 1QG7A 1QLWA 1EY6A 2W6ID 2QTVB 2EKQA 5EQ0A 2DFVA 3FRPB 3O1HB 3CLVA 1DHTA 4FZRA 1SXJB 3LOPA 2AVDA 4JC4A 4LZAA 2GPSA 1J6QA 3DYIA 3GP8A 3VSBA 1D2MA 2J0EA 3IP7A 2CVFA 1T0PA 1ENCA 1BQEA 3IUNA 1RXVA 3J7AC 2FWJA 2VHEA 4LBVA 4FYHA 3KKEA 5MGBA 4D4JA 2GLTA 1V3UA 5KKCA 1DTSA 3RJ5A 1YZNA 3TO5A 4P8RA 2NIPA 3WLFA 2NXEA 3GOQA 3OQBA 1N2GA 2A9FA 2C8VA 2X14A 3D1VA 4MRMB 2XW6A 3QNWA 3DHVA 4M55A 1IEXA 2YVKA 4G56A 4OHXA 4LK2A 1RFLA 2WW8A 4A03A 2QJOA 1GDDA 1XNQL 2OGWA 2VJCA 2V6GA 1Q6YA 2GK6A 1WV1A 1S2MA 1I10A 4M0EA 4ZCRA 3FRIA 3GR6A 1F9EA 1IK4A 4HVTA 2NP6A 1JQLB 4YQFA 1X7HA 4JHXA 3BBLA 1E5TA 2YBEA 5JVDF 3K9GA 1EJ0A 2Q8TA 2X7HA 3KOZA 4N54A 4ZHQB 4YMSA 3RF7A 1TPYA 3KLPX 3D31A 3A8JE 1T6NA 2SCUA 3KR1A 4F56A 2FPOA 2B3TA 2L0CA 4O1HA 2QTFA 3DEOA 2XHEA 4IUNA 2IZOA 3A6PC 3IP1A 2ORYA 3IOEA 3WAGA 3JW8A 4OF4A 1E9VA 4N3AA 1N3LA 1UIMA 1RJ9B 4DA2A 3PQCA 3PO3H 4W9NC 1GA4A 2OYCA 4A16A 5IUJC 3TG8A 5C0XG 2CHVA 3PGLA 4OTZA 1PJ2A 1BCPB 2WAXA 2GO1A 1OZGA 2I4IA 4H4DA 1KAWA 5C2JB 1RJTA 1P3JA 4WK2B 4WOJA 1OB5A 4DLBA 1FSZA 1CTMA 3D81A 5FIUA 1GU1A 3FGPA 3KYCB 4IFDJ 4WKOA 5K8LA 5C3XA 5IF3A 1KC3A 2VPYA 3DKVA 3MTSA 1KVTA 1LTHR 2OUKA 1SCDA 5CPFA 4PFKA 3R3YA 3M82A 4IDNA 1Y1WB 3VV3A 5DBOA 4O2LA 3PHCA 4KKXB 4RYDA 1ZJZA 1GSHA 4GP9A 4DCUA 1UWKA 1TU3A 4ND5A 3MT7A 1BFKA 4XWTA 2CWWA 4NXML 2BHNA 1QVWA 3FM9A 2NZXA 4BFVA 4GEGA 1BDIA 3T13A 3SDSA 3UT5A 3TFWA 3NEJA 1HHVA 3BE8A 3IR7A 2NZ1D 1ZA1A 4M9ZA 3C8ZA 2ZRFA 3RVKA 1LNZA 5HRUA 3S1AB 2WHPB 1OXSC 1JA9A 4IJLA 2W6MA 4LWQA 3AF6A 3OPYI 1YAJA 1U0BB 1XTBA 5CH5A 1NXQA 1Q7GA 2XCIA 1EK6A 1MSHA 2AR7A 1WHSB 1IYZA 4QASA 3JWPA 1PYDA 2PL9A 3RHFA 5CLFA 1WMAA 2QJWA 2F03A 4WWHA 1BFDA 4AFNA 3DLCA 4Z8XA 3I9V6 5IAEA 2FPXA 2OEOA 4L22A 1S4QA 3H3VC 4WA7A 1JWBB 1DAEA 1LU9A 1KJYA 1SC6A 3AHIA 3WNZA 3UTCA 1Z4KA 2OV6A 3GUZA 2EFJA 1XZCA 2FE1A 2LY7A 3S7ZA 1OPXA 3QGMA 5BSUA 1BCRB 1H2XA 3RVRA 4GEKA 3VYUA 4GPAA 4BUJA 1MW8X 4OA5A 1Y9EA 4X1KA 3P1HA 3PDIB 5AOCA 4N5MA 5FPYA 3NTOA 3K30A 2B4QA 4QB4A 4CT0A 3TN7A 1JI0A 1UT5A 1IJBA 3V55A 5HIKA 2GCOB 4DNXA 1FQKA 4ES6A 2GSWA 3TNFA 1GADO 2H07A 3AGQA 3CPEA 4NR0A 4WY8A 5FNZA 1AH2A 2VAXA 2KBNA 1QZGA 5K3FB 4JELA 1NQVA 3DDCA 1PNQA 4Q9AA 2CDRA 1LBQA 2ZB7A 2IYLD 4WCDA 2PUDA 3H2HA 4DABA 4P7GA 4XDXA 1E6KA 5GOZA 5AVXA 3HDTA 4OMDA 3U0VA 3BHNA 3MPUA 4LISA 1C0IA 4B2LA 1V9CA 2I3ZA 3DVSX 5LM3A 1JHAA 4UBNA 2QA5A 4QGUA 2JVKA 1C1XB 1E2FA 4JJAA 1SZJG 2XA9A 2QL9A 3OZAA 5AKEA 3C6KA 3WQRA 3EWSA 1JECA 2IXGA 2VUMB 4KXMA 4X65Q 3NUCA 3I39X 4F6LA 5HQ3B 4M83A 3L7DA 1QFSA 1K0SA 2WTXA 2FEMA 4Q3BA 3GLHE 3PP8A 1E92A 2Q50A 3THSA 5T7BA 4CXMA 1D6EC 2X9VA 5I8WA 2A73B 4BY7H 2VRCA 1O5TA 1Y9ZA 3SIPA 1VI5A 4N3GA 4DBLC 3UA4A 3V2UA 2PH5A 4ZHSA 3DAHA 1U2ZA 3OZGA 4EEKA 1M1KC 4XLZA 4NYIR 4RDIA 1U8TA 5E4TA 2NWGA 3QJYA 2IXBA 1QNKA 1SUIA 3VR5D 2A1UA 1CQVA 2ODPA 1EFHA 3CR8A 3FCEA 4OYLA 2EFCB 4L1CA 4KQHA 3QFSA 4WVFA 2EYUA 5C3EB 1TVCA 2D7CA 1U99A 4TPKA 2V7GA 2ZRBA 3FOFC 4LZLA 4Y8VA 4NZ9A 4C2AA 1IDN1 2ZBPA 3GRCA 2OKCA 4G37A 1GPMA 1Q50A 4ZCIA 3CWCA 3U7FB 5J2TF 3NXKA 2Q8IB 4PS1A 3JR3A 4JI2L 5F2DA 2BFEB 2GWRA 1WV0A 4YCNA 1KZ9A 1JKFA 3FDJA 4C30A 1E4VA 4C20A 3Q9NA 1SMYC 4GX2A 4TRRA 1PTOF 4C3HG 2PX5A 4ZKEA 1Y7LA 4HCSA 2O1XA 4NE2A 3AVVA 5FO9B 2GZ3A 2XQGA 4NRDA 4NYMR 1H23A 4P75A 4KQ1A 1Y8NB 2FEKA 2M1ZA 2W0SA 2A69D 1KH2A 3O2SB 4HAIA 4S35A 2GESA 4IVQA 5AH0A 3BTUA 1NF3A 4XT3B 1SOVA 2XTMA 4B4VA 2B2VC 4AI6A 1XPUA 1J1ZA 5G3LD 4LOHA 4Z7QB 4GH5A 1XXHE 4PR0A 3MN1A 1YIOA 5F21A 1EVKA 3JWJA 4IXTA 4YK7A 1TS4A 2WUVA 3KYDB 3SNKA 3SGIA 5EKLA 4J8PA 1E7RA 2YU9H 3TKLA 3ZG6A 5EVCA 2XRZA 4TM8A 4LV8B 2CFOA 4AZ3A 3S1NB 1RHQA 1WY7A 2QUHA 1P1BA 1DBRA 1LTLA 1IBRA 2ENBA 1L5QA 3QYFA 4LGMA 4NBSA 1RAIA 3NC0C 3R6DA 4U8HA 3P5BA 3T1YL 4LFCL 1L7OA 2PMKA 3SWWA 4AKGA 4TZKA 3D7SA 3X1YA 2YCBA 1KDPA 4ALKA 5F77A 3NQ41 3DTYA 3CNHA 1S1MA 4TWJA 1F9PA 1U6IA 1ZCZA 4X64Q 5JMWA 1KNEA 2XVMA 3BK7A 1NXTA 1Y42X 1R8JA 1Z0AA 3GJSA 4IXDA 5KJEA 4LOLA 2PYDA 1QO9A 4DA8A 1W1UA 5K5EA 2CN1A 2NYZD 4NICA 4DXFA 4NE7A 2PQ2A 2QBYB 4NCHA 1IJEA 1XMQB 1LJLA 2Y99A 4IVPA 4PWZA 2HN9A 2OP0A 4BB5A 4OV6B 5TPWB 3UB3A 1Q3KA 1GQRA 4PXYA 5IF9A 4H27A 3ZGVA 4D25A 2QVLA 4C04A 3RG2A 1EFWA 5JEAG 3BILA 2P2ZA 1A77A 4C0KA 4Y7NB 3OPQA 1QHGA 2UZ1A 4OY3A 1Y4SA 3AHHA 2OCIA 3DZFA 1ZK2A 3SZGA 2Q5CA 5EWLA 1R8XA 3QITA 3QU7A 3MFGA 2M9VA 2H4YA 4I3FA 3KSRA 2TSYB 4CV1A 3CVVA 3HBJA 1U04A 2JLRA 3J80A 1NJSA 2B8FA 5DK4A 5CA0F 3A6DA 1CY6A 2QJTA 4Y6OA 3EUFA 2YFKA 1F17A 3O9ZA 1YFJA 3DP9A 3Q3GE 1VLLA 3HPQA 4CN8A 3WIUA 9LDBA 5KO2A 1WMEA 3MYRA 5ITVA 4FNGA 2CLEB 3D59A 1JOQA 1XGKA 3MXGA 5KJCA 2KB0A 4O4LF 4OG2A 2AFIB 1OUMA 3MF4A 5I4BA 2G9ZA 4DJAA 1XTPA 1ZJYA 4QT4A 2OO5A 3K2IA 1C2YA 2QMUA 1OVGA 1U3CA 5IJ9B 5TQ0B 3QMPA 5C5EA 1DRVA 3LD9A 3X44A 5LD2C 2VWPA 1KDBA 4UZFA 4F9FA 4OIKA 1I36A 4C4OA 2ZYSA 4IJHA 1M75A 1U94A 3T06B 1T3SA 3O2QB 4BNDA 5I7WA 2WU8A 1BXRB 3BE5A 3Q7IA 4J03A 3EPRA 3NYQA 3A9SA 1SQGA 2OQ2A 1IXZA 2TECE 4I1YA 3VX3A 2ZFUA 4O02B 1ZHOA 1ZGZA 3OSZA 1KEWA 1N2OA 4Y6RA 4K6FA 2LE0A 3GJZA 1PJLA 3FPFA 1ESNA 2W2LA 1Z07A 2HPAA 2ZJ7A 4BECA 2EXXA 2AQKA 1YZQA 4HWSA 1XTIA 4EHDA 2EIHA 4KCGA 1HZCA 3KQLA 3E5SA 1N5IA 1H9SA 5E1FA 4BMSA 5C0XH 2GR9A 3EQZA 1E2PA 3EW9A 1OTXA 3DWEX 4FFDA 4UHHA 1HLPA 4OB8A 4JB3A 1T9GS 1EY8A 2CVQA 1K2VN 1Q12A 1N1MA 2XR1A 3ESXA 1M2OB 2J46A 5GM2A 1F2UB 1QUEA 2IPAB 2ZJQA 5TY0A 1W29A 3WLMA 3MJDA 4ND8A 2GN6A 4TLAA 1T9HA 4NE9A 3QRWA 3B9BA 1NI4A 3VH2A 1B3AA 2ATIA 3NDPA 1OFUA 4B6SA 3EB9A 3ET4A 2YWCA 2DBVO 3VR6A 2EW1A 2L1BA 1PFVA 1KZ4A 4Q1CA 4DJEC 5D51S 3PUIA 3TLMA 4PFJA 5HQJA 3U9SA 3RTEA 3MWKA 1PWXA 5A3RA 2DY1A 5IP9H 3NJ8A 4IH1A 4BVEA 3H94A 3RRMA 2JGDA 5FLYA 3TTVA 3TLKA 4JVSB 1XMVA 3FNQA 5PNTA 2AZMA 1PJ8A 4DNOA 1KXJA 3RU7A 3L8CA 1VQGA 1VHLA 2IHNA 5KSWB 5DW3A 3BZWA 4MW2A 1UXGA 2YV5A 4RS3A 1S5DD 1SNQA 1ZYRD 5J3BA 2VTVA 4UE3S 1S89A 2GNPA 4OL9A 3UGTA 4P84A 3QX7A 1SQ5A 3DB1A 1DG3A 3K0HA 3PCRB 3AYXB 2EZ8A 5MHTA 3AY0A 1GN9A 5FBKA 2RJOA 1BEUB 1LVGA 2E9SA 3SVLA 4GKAA 1SB8A 3ZK8A 3PGVA 1E60A 1FFGA 3OF3A 3QELB 3QMVA 1ETHA 1IOVA 5EIHA 3VJLA 1J20A 2I91A 1HDEA 1R6TA 1ZD1A 3KFVA 2JJ2D 5M5BA 1WMDA 1YACA 5DN9A 2KCTA 1UDXA 1HA6A 4LF6Q 5DNWA 5KJ6A 3MTEA 3ZHSA 4YIJA 3RW9A 4ALLA 1ML3A 5IBCA 1WJGA 4GZMA 1XQXA 3NBMA 2V7TA 3ZKAA 3UJCA 1U02A 1SOAA 4G8BA 4JLPA 2BGTA 2EYPA 3QVGA 1R9TH 1XI2A 3B2NA 1JIJA 1CUYA 1T1RA 2X5NA 4UM5A 3IMKA 4GVPA 2X41A 2XB4A 2V6IA 1HR0L 2VEDA 2HLDA 2UKDA 1NMXA 5DYWA 3LLOA 1UPAA 3K4HA 3HLYA 4HLDA 5JHGB 4UUNA 2V0CA 1HWYA 5G40A 3HP3A 2XLBA 3ONVA 3URYA 3L93A 3HL4A 1ISRA 2JAUA 4IOJA 1B1AA 2PX8A 1U4SA 2XHZA 2VJNA 1SC4A 4R2XA 4TLBA 2MYPA 2UUBL 1KL9A 3VBEA 2ZJAA 2NO6A 1NSNS 3VUFA 4K3UA 5CNJA 4MYRA 2I1LA 1TS3A 4C3JB 1NTGA 4HGPA 4KSCA 1S3FA 3KFUA 1PR9A 4RJ2A 4X41A 1M6VB 2W2OA 1R4MB 1TUIA 4ZO8A 1HUQA 5CX1B 2OCAA 1MFPA 4X6LA 4BE7B 4BX2A 3ZR4B 2VK2A 2Z2JA 1GAWA 2M6KA 5G3LF 3BH0A 1EYDA 3WQQA 2ILTA 4TV9A 5HKLA 1W94A 5LZ4A 2IHTA 1NR7A 1O1YA 1AX9A 4HRVA 4CNBA 1HO3A 3CF6R 1QGED 4X44A 3JRWA 2E18A 3I6YA 1G5IA 4UP7A 4QATA 3T7EA 1MABA 1FLAA 1KABA 2ZE5A 4X97A 2CFTA 2DG2A 4BO2A 3IFTA 1NN1A 2Z30A 1TXYA 2W2QA 2W42A 4UC0A 3DTVB 2RDGA 4V1CB 3EOAI 3KVYA 4XTCS 4NPCA 3MD0A 4I1SA 1A04A 1KY5A 1V1PA 4CLRB 3EXHC 1JALA 3RFFA 2ZAOA 4C76A 9ATCA 2H59A 2J0QA 1L8AA 4F7XA 2HMUA 3AEKA 3GK7A 4C3HH 1HA5A 3L7JA 4LC1A 5TSSA 2V8BA 1A2UA 4QLBA 2EGUA 3W3AD 1Y8PB 2DNCA 2FPSA 3GPDG 1A9YA 2EDGA 2EJBA 3KJHA 3F5MA 1FP7A 2XMBA 1F48A 4CMJA 1R74A 2G9NA 2CEAA 3FSJX 1SRRA 3A28A 2PZUA 2I0QA 2A68D 1WOCA 4K9DA 2AB0A 1VYHA 3T41A 4JUBA 5LZ9A 4DFAA 1L1QA 3E4DA 1GG8A 2VUUA 2HW8A 1V37A 3ZLBA 5JAUA 5HOEA 2PAAA 4JU8A 4YPOA 4NK4A 2D7DA 3GUVA 4G5FA 2ZYDA 5JPDA 3UUGA 1JV2B 2EF0A 4P86A 1DXMA 4L78A 4IFIA 5C1BA 3WMGA 1NU8A 5C18A 2PRSA 2Q5JA 1LRLA 2ID9A 3IQDB 2EVWX 5HGJA 4Q1FA 4EW2A 2ICIA 4REQA 2PZMA 1L5KA 1QB8A 1AZTA 5F33A 5IYZA 1MVLA 4P34A 4RL6A 3O8CA 1MZVA 1R6UA 1V2HE 3DMUA 5AK3A 4A3JB 2BMVA 3D3UA 5DP2A 2WHYA 1Q44A 1SKAA 5HKAA 2Q3HA 1A1VA 2VF5X 4DR6B 1YR6A 3RSCA 4FYKA 3UZUA 1O7JA 4KWIA 2OPHA 5HM6A 4P08A 1OXKB 1R3UA 5FL7D 3SXUB 4QQFA 2JZOA 5E4WC 4RVHA 2OG1A 1C0KA 2WAQE 4RIIA 4KGZA 3ZEIA 3D0KA 2O05A 4IQ8A 2B39A 2WABA 1U8CB 1BXZA 5FO8B 4LVOA 2SOBA 2IIBA 1RI1A 1NQAO 1TYBE 2Y0SB 1GSOA 3GP5A 5JEAH 1YJBA 3HABA 1S4MA 2DBZA 5LL6S 3LBNA 3MVVA 2YWDA 1ONBA 3JQDA 2CC2A 5AMXA 2RGEA 4DNFA 2JQOA 3JD1A 2Q5EA 1EY4A 1YZYA 2GOYA 3M9WA 3W7BA 1R7RA 4MQLA 4MMXB 3B78A 2G9DA 3SIRA 2MO0A 5JROA 1GUSA 4EP1A 3HY4A 2TMDA 4QXRA 3D4RA 1C8KA 3ANMA 1J06A 3D5TA 4JQCA 1LDEA 3OKFA 2OFOA 2VZ8A 4HV4A 1CS0A 2QORA 4OYHA 1QFYA 4V03A 2C4TA 2WB1E 2B98A 3ZQUA 5K09A 5SYNA 4M89A 5KOIA 1EUCB 3RVOA 1EK1A 5LMNB 1JMYA 5LPNA 5I7AA 3OG9A 3ORQA 1GQSA 3WY9A 1KEKA 2XGOA 4WKGA 5IT0A 1NY4A 1Z0UA 5AQEA 1L3IA 3QX8A 2NSDA 3PPXA 1NXWA 5CV5A 3A6GA 2OKGA 1NJGA 1W73A 3AHFA 2ATVA 2H5LA 3ISTA 2Q9BA 2IFTA 2HTFA 1SWWA 1K4MA 4G8DA 3S1QB 1Z47A 1G5PA 1EEHA 4HIOA 4Y1RA 1E2MA 5FB3A 3QTLA 3O0TA 1FL9A 1UBKS 5IH3A 2PLWA 5FFMA 1UQRA 3R6GA 4URVR 3INGA 1F7VA 4TTTS 4NARA 2ZKLA 5LXTA 1TF7A 2I5LX 4RKBA 3OLWA 2FLVA 2ZLBA 4B3FX 1GNRA 4IRUB 4P3XA 1HNWL 5I4KA 1Q3HA 1Y1WG 1VQOA 1N1GA 1X1AA 3GEMA 5IMBA 1OYWA 2F59A 5H4GA 4DR5B 4UMVA 3UDXA 2C4KA 3MA2B 1JX6A 4Y9DA 3LQ4A 3TVDA 5KNLA 3EEBA 1TCAA 1O3YA 2O8VA 4O59O 4MW5A 3RBVA 3VHXA 5F4ZA 2CYAA 2H9YA 2D06A 3QVSA 1EEFD 3K59A 2VY9A 3OJFA 1RJWA 3BWDD 4MS1A 1AN9A 2F0LA 5DOVA 5CFPA 2HIGA 4U9UA 2CJYA 3M9XA 5DCUA 2I8CA 3DEJA 1R6AA 1D6MA 3K7EA 1MF7A 2OSVA 5AHWA 2VXBA 1I4PA 3ZY6A 3NOVA 1B0AA 3U3RA 5EJGA 1P7YA 3QHAA 2I6GA 5IEJA 2QP9X 5DLPA 4J16A 2A4KA 2J48A 2PMEA 4M49A 1AIPA 1HNWQ 4XVUA 4OBXA 1HX7A 1E1OA 2G71A 2BUCA 3COZA 4QYIB 2Q21A 3FTCA 3FLEA 1TUBB 5DNCA 3G1WA 1AKWA 1IL0A 3MCWA 1UEAB 4DMMA 1QX3A 4DLSA 4P22A 4WESA 1CZLA 4PGAA 4ZO4A 2HMAA 2WG1A 4RNCA 2FR8C 3VNSA 3ZDEA 2IOHA 4G4KA 5AI0A 1ISPA 3H1PA 3HP4A 4ZJPA 3ZWVA 1YL6A 2POQX 5LU9A 1E2UA 4PM4A 1LLUA 4GWGA 5LMUL 3LVBA 2P27A 1CT1D 3TPZA 3H42B 3GRUA 3FUXA 2ARKA 1B0UA 1XAGA 3M89A 2BGJA 4FMCB 3IPCA 2AEFA 3MEFA 3A3NA 2IJ0A 3GV6A 3G79A 1O0BA 3TJMA 1SGWA 2HEIA 2VRNA 4PBRA 2A74C 1B70B 3CW2C 3PNPA 4Q24A 1FDIA 1WVGA 4G97A 3PNBA 1IBSA 3LC2O 2A3RA 2C61A 4ME5A 3L6RA 1FVHA 3FEWX 1DT5A 4W8OA 5IN5A 5GAJA 4ZI7A 5IYDG 1D3AA 4F1WA 4MGHA 3WWCA 2JAPA 3RF6A 3THYB 1C9DB 1R00A 1QO0A 2CCGA 2I6FA 2YASA 3T3DA 4JEUA 3FTNA 3WWZA 1SOMA 3EPLA 2G06A 3AESB 4ZN6A 5LWQA 4EA6A 1MNAA 1EWVA 3U61B 1BCPD 3DHQA 1XTQA 1D0SA 2O1WA 4LXQA 3MUNA 4J7UA 2L82A 4PLZA 1VSTA 3O82A 5LMUQ 2C7OA 2EYQA 2NVOA 1Y8ZA 4KFSA 4AMVA 3EG9A 3KQMA 3QPDA 1EESA 3KB2A 1P1HA 3CEPB 3I45A 2R5NA 2K52A 1JKXA 1JIXA 3MS4A 1VCMA 2WV7A 4R3NA 3AWDA 1VIAA 4M8NE 2XTAA 1ZKDA 1U7TA 5EOVA 1KO5A 1J9GA 2OEPA 3CE6A 2XA2A 1DAOA 4E3WA 4PV7A 1LLDA 4Y0AA 1Y1RA 3GTPB 1E2ZA 3BN3A 4OIMA 4I7EA 3MTDA 3I62A 3ZDBA 4CKEA 4JIGA 3MXPA 1ZK0A 5BNIA 1FGBD 2PFGA 5E1BA 4CTMA 4O4IA 1YJQA 5DRYA 4XYQA 4AQYB 1V1MA 3IR6A 3RSQA 3HXTA 2BFBA 1J7KA 2WINB 3F5SA 1IUPA 2EQ5A 3L0ZA 3CS3A 3GFRA 1HFJA 1YZTA 4AIIA 1KRHA 4JOCA 3NWSA 3B1FA 3A6FA 1XPOA 2BSXA 1XUOA 4IIFA 2HWYA 5E7MA 2WFAA 2F1OA 4CEIA 4C0SA 2EHDA 4R84A 4LBZA 1DONA 2YFYA 2IWRA 2NYVA 4LTDA 4GP6A 3W05A 1G5TA 3A4LA 5HK8A 3ULLA 4A75A 2HCRA 3T3GA 3QVKA 1Q8IA 4R9WA 1KKUA 2UVPB 3ROTA 1JE4A 4FFWA 4Q03A 4MIKA 2QW1A 1LZLA 3G6KA 4FDBA 2DVMA 3UA3A 3DWAA 5K4GA 3KS9A 5KYTA 1K63A 2A7QA 3NPAA 3QG5A 4MYTA 3KLWA 2XJ9A 4IOKA 1CC1S 1L7VC 1R5NA 1MGOA 3HB1A 5EHNA 3Q12A 4AJ1A 5BV7A 2F17A 5IT9E 4I9HA 4QNMA 5BPHA 2XWQA 2X4DA 3KSZO 4MW6A 2VSOA 3E9DA 3VM6A 3C5WP 5F7JA 5C31A 4S04A 1EPUA 5THQA 5E1DA 3ANXA 1CRLA 4UAVA 1B6TA 2AFVA 2WACA 1FRZA 3IUYA 1CEEA 2WU1A 1GJRA 4MW1A 5DNVA 3G0CA 3X1WA 3AONB 5IY0A 3IC5A 1NW3A 5EHXA 4NFYA 1O95A 5SZKB 4BLOA 4B3GA 3QOWA 4EL0A 3QFRA 2DP4E 3WLTA 2AFHE 2EQAA 3C1FA 4M22A 1TF5A 3RVMA 4AE2A 1BOOA 2X13A 2VNAA 4EPTA 1PI3A 3PHJA 2K4KA 3IEIA 3Q7TA 4P4UA 1XRPA 1BQ4A 1LLRD 3L0IB 5HTOA 2PH3A 3QVTA 1LXCA 4RPLA 1I4WA 3U1VA 2ZM6B 5DP1A 3FAZA 4E1AA 2I67A 1UF9A 2XOKA 1XEWY 3GT0A 1V7QA 3KKMA 1T6XA 3QEKA 2GVBA 1KOGA 2WMOB 2DQZA 3BMOA 4AF6A 3HGBA 4E12A 1QRTA 1AGRA 4DMKA 3FSGD 2P5UA 2QA4A 5ENDA 4P7FA 4C43A 2C3YA 3W5HA 5IGBA 1YRHA 4G0ZA 3CPFA 5LLDA 4IIHA 1L5GB 3CKMA 1P77A 2OMKA 4RK7A 3TVTA 1V5GA 4TOIA 3F6CA 3RYCA 3KF6A 3IAEA 3ZZUA 4XSGA 3IEVA 1HQDA 1YBVA 4DRXB 3JQAB 3IAXA 5AKGA 3UATA 4EIWA 1XELA 4HR7B 1QONA 1N6EA 4J0GA 2IPOA 3B20A 4ME3A 2P6MA 3TIGA 1AF4A 3EDCA 3GTOB 4U7WA 5D7NA 1A9PA 2AGVA 4D74A 1HE1C 3H2KA 3G2LA 2BR4A 3B53X 1Z63A 1W2HA 5HXAA 4IV8A 1TT5B 5ALJA 3PI6A 4FVMA 2MINB 2PDAA 1QDEA 4R0NA 4J1NA 1IPFA 1V0EA 1QKJA 3MJSA 1FYDA 4K6CA 3KLRA 3HRHA 2EFDB 1GN8A 1GY8A 3BRWD 4GNKA 4OO3A 1ULUA 5ALKA 1J1UA 1J5EB 3AFIA 5L3RA 4FGWA 1SIWA 2M6SA 3VFDA 2ZJ6A 1D4OA 2QAGA 3O84A 3E8MA 1VP3A 1TW2A 2X6LA 3ONWA 2ZVDA 1E9EA 1X42A 2KM1A 3I0NA 4JMLA 2NZOA 5AUOB 2I2FA 5FHQA 3SR1A 1ZBDA 1IHPA 5H9VA 4GN3B 2IS2A 1VLHA 3DVAA 1ZEMA 2CL5A 1T5XD 2QL6A 1USWA 3P9SA 4HFRA 2AI1A 4QU0A 4W1SA 2ZCUA 4M1ZA 3R7LA 1IIRA 2HBQA 5H83A 1W0KD 3ABRB 3GUHA 4G1UC 4K7JA 2N88A 4FOSA 1FYWA 1VQHA 1RWMA 1X3QA 5IHXA 5BNFA 2XMSA 3PQ3A 3QE3A 3G2HA 2ONCA 1E5LA 1JMKC 2Z8LA 2AWOA 2UU9L 1UKVY 3U4IA 3KOOA 2NPFA 3M81A 3GL9A 1K6XA 3N7UA 1OC4A 4RHSA 1USIA 1K83H 5AJYA 3I01M 2BFAA 1YK1A 3D8SA 1WTAA 4EYEA 2IXAA 1W0JD 5AVRA 1I3MA 2W2MA 3SU8A 1VL5A 2QM7A 1OIXA 4V0QA 1XDSA 1BDHA 2FP4A 1EFID 3BD6A 1Y9JA 1W4BA 2IIQA 4W7HA 3QLUA 2VF2A 4FSXA 4PGGA 5ESDA 3S8EA 5IP7G 3CJTA 1NJ5A 4IRMA 3DBVO 2MIIA 2QPAA 4HGRA 1HYGA 5HNKA 2C7BA 1PWYE 3L5KA 2WD7A 4JLKA 4CDNA 4Z2YA 1E0SA 3CMAA 5KQRA 4BX3A 4PN7A 4BDTA 3PIP3 2I46A 5FOTA 4BFYA 2C0QA 2YQ4A 2WPDD 1I6VC 3B1VA 3QJGA 4V0ME 1W85B 4H13C 4ZHQF 2Y76A 4RKLA 4K6GA 3B7WA 4PS0A 1PZNA 3T0GA 3HVRA 3VJMA 3UMBA 3AG6A 1QHIA 4L72A 4B6JA 4E6IA 2BEVB 2X1LA 1ZY2A 4J76A 5C3MA 5JADA 3IMCA 4GI3A 1JJFA 2B5VA 3IJEB 2NVUA 1BBWA 2DFLA 2IUSA 1Z8HA 1CP3A 2HO5A 4C2MB 4LF5L 4DM7A 4OX9Y 1UM8A 4BVJA 5SY4A 1BCPF 1Y5LA 1V26A 4DIBA 2ISCA 2ZDHA 3UANA 1PFKA 1E1LA 1O94A 3ZD8A 1R3DA 2R00C 4D3DA 2V3VA 1Q15A 3J81i 1EYAA 3EIWA 1QB5D 3CN7A 5IANA 4LHSA 1PCXA 3U09A 1CKNA 1YJ8A 2PEZA 5LMZA 1XEXA 3U17A 4E2FA 3FMCA 1GU7A 3D7MA 1EWHA 3IJPA 5I9MA 2B9VA 2VF8A 2Y0BA 3RUHA 4E31A 1ZNXA 3V6MA 1E98A 1EK2A 5CPBA 1EVEA 3FYCA 1A2OA 4CTOA 3DT9A 2O2IA 5TJ9A 4QMGA 4DDMA 2F64A 5BOVA 4R6WA 1ODLA 2MSKA 3PUXA 4HJ7A 2I0FA 3QOLA 3U37A 2XXBA 1W0CA 5FBVB 4PCAA 2NPIA 4AJOA 3EQ9A 4KNYA 5T4EA 4LF5Q 1ISHA 4R4JA 1PKXA 1T2FA 2XJ4A 1RI5A 2R4UA 3WFIA 4FM9A 1MH1A 4NPAA 2OV8A 4JP5A 4FYDA 2ZAMA 3PVSA 4YRTA 5TARA 4PYJA 3CG0A 2ZSJA 3OE7A 3ODPA 1I3NA 2HYIC 1ESCA 1W1WA 1CIJA 1CKEA 3BJEA 5H82A 4ZAGA 5EGTA 4ZV7A 5HJ5A 1BXGA 4CM7A 1GPLA 3AP3A 1T5OA 1U7UA 1DVRA 5LWHA 4R8LA 5I48A 3OMXA 4L8WB 2EG9A 3OF5A 1KRSA 4FXOA 2JAQA 3R8XA 4QFMA 3L6EA 4ILEA 5EWJA 2RC5A 2WR8A 1GL3A 4O1NA 1XL1A 5DNFA 1HZZA 1MGSA 3MGAA 4R41A 2K01A 4CODB 3P4XA 3GDWA 3A36A 3DUFB 4AZTA 5CP8A 5K05A 3ZI4A 4HNSA 2VQDA 3CR3C 1TM3E 5T64A 1K3TA 1W36B 3EXEA 1U9ZA 3CB4A 3IUEA 1IDOA 2QT0A 1X1EA 1UWCA 4C1BA 2ZYIA 2H1OA 4IMPA 4DL9A 5BSRA 1YB2A 4OXPA 4TMXA 3HOVG 3OZTA 3ZBTA 4K28A 4DMRA 4DR6L 2G25A 4Y2XA 4M87A 1YS6A 3E9QA 4AX8A 2E7ZA 3V4LA 2B1JA 1NFQA 1GARA 4P98A 1BYUA 2YHIB 3TFQA 3ADBA 1UFOA 1E6LA 1O7YA 4KQIA 4D80A 4FNOA 5I3CA 3G7NA 1LBSA 3D9QX 4ZGWA 4F0JA 3ENZA 3O7MA 3U3XA 1SMXA 2BDUA 2QYOA 3ZU5A 2EERA 2O5IC 4HLNA 5FJ8G 1PRYA 2GJSA 1ZH6A 3L1UA 2EC5A 4MGKR 3SX2A 4ZAXA 3QX3A 1I1OA 4NCIA 3AB8A 1YC5A 3GVKA 5IGDA 4K6OA 1RRPA 1FS4A 2WPNA 3UFXA 4DLNA 4BGIA 5IT4A 4MLCA 2CDAA 3OX1A 3JTEA 1EQRA 5HZHA 3BZKA 1DQPA 4XVCA 4B7CA 1PYBA 4EF6A 4NCBA 3S2HH 4IG9A 3CAMA 2YRXA 4CKWA 4K6DA 2BI7A 3K71B 2CHQA 2VCEA 1TA9A 3CPJB 2MSWA 1U8FO 4OYYA 2NVXH 5SV2A 4F5ZA 4DR6Q 1GZ6A 3HQ4O 4P0PB 4R1TA 2IVFA 3KZNA 2KHZA 4MS4B 1HE2A 2WSSA 3K94A 3DW3X 4HL6A 1WA5A 4MJ7A 3CCCA 4IFDG 4RQAA 1JICA 4A3GG 4YROA 1S4ZA 3GC6A 4KZPA 1NVGA 2J3KA 3OTGA 3GF4A 3ZQ4A 5JXWA 4RK4A 3IQWA 4NZPA 2Q3LA 4BNUA 3WGVA 1BJKA 2ZCVA 5JTTA 3L7LA 3VZBA 3GDGA 2F0QA 2BGRA 4JASB 4CKBA 3GEGA 5LMNL 1XJCA 2DN8A 1V11B 2YTXA 2R60A 2KYRA 1XLVA 3UHFA 2XYPA 4HPWA 2F1JA 1CUDA 1G3QA 2MJ8A 1AXGA 2QGFA 2R2GA 1UJCA 4HSVA 2FVXA 3B8HA 5B3LA 1L4NA 2P3QA 4OAOA 1Y8AA 1CUJA 2IX3A 3FNGA 3OOWA 3DJFA 3C70A 5AVJA 2PGXA 2RGDA 1U2TA 5K0BA 1OGJA 4HJ5A 1TO2E 3CVXA 3TLXA 4CI0B 1P2DA 1XDGA 2VSXA 5DT9A 4GD3Q 1W6KA 2J6CA 2IYSA 1NUHA 3Q0TA