4JC0A

Crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
432
structure length
424
Chain Sequence
RVGIKVLGCPKNEADCEVLAGVLREGGHEIVFDVKDADVVVLDTCAFIEDAKRESIDEIFSFVDAKDQYGYKLVVKGCLVQRYYEELKKEIPEVDQWIGVADPEEIANAIETDLVPDRYRKRIDLEERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLNSLNGEFWIRVMYLHPDHLTEEIISAMLELDKVVKYFDVPVQHGSDKILKLMGRTKSSEELKKMLSSIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDEEGTVAFNLKEKVDPEMAKRRQEELLLLQAEISNSRLDRFVGKKLKFLVEGKEGKFLVGRTWTEAPEVDGVVFVRGKGKIGDFLEVVIKEHDEYDMWGSVILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein S12 methylthiotransferase RimO
publication title Two Fe-S clusters catalyze sulfur insertion by radical-SAM methylthiotransferases.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 124
structure length 424
sequence length 432
chains with identical sequence B
ec nomenclature ec 2.8.4.4: [Ribosomal protein S12] (aspartate(89)-C(3))-methylthiotransferase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00919 UPF0004 Uncharacterized protein family UPF0004
A PF04055 Radical_SAM Radical SAM superfamily
A PF18693 TRAM_2 TRAM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jc0A04
3.30.750.200 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A03
3.30.750.210 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 4jc0A02
3.40.50.12160 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jc0A01
4IPDA 1VQBA 4XTCS 4LF5Q 2F4VQ 3KFUA 2V1CC 1Q81C 2B63H 3ULLA 1PH3A 1AE2A 5JJIA 2RHSB 4IJHA 3CCVA 1QVGA 2VUMH 4GOPB 4X66L 5FLMH 1TWGH 3AFQA 4JI2Q 3CPWA 1PH6A 3CC4A 3DM3A 3PO3H 4A3CH 3GTLH 2UUCL 1S40A 2OTJA 1YBYA 4NXNQ 3F8TA 4A3MH 1X3FA 1R9TH 3CAMA 1LYLA 1VQGA 1E3PA 4GN4B 2JEBI 3GTJH 2N8NA 3RN5A 4YWLA 2UUBQ 3J7A5 4JV5Q 1WOCA 2R92G 3H3VI 2WP8J 1B8AA 5ELNA 2ES2A 3GTKH 4JI4L 5JJKA 1G51A 3A0JA 3EBEA 4K0KQ 1NBWA 4BA1I 2KHJA 1PVOA 4HJ5A 2OTLA 1TWFH 5M5YH 1Q82C 4PZ7A 3PUYA 4HIDA 3M7NA 2E5LL 2BA0A 3HKZG 3PO2H 3S1QH 4A3LH 2YYZA 2IX1A 1VQ7A 4PZ8A 4JI8Q 1VQ4A 3I4MG 3HOZH 1EIFA 2LXJA 4QIWE 3HKZE 2BH8A 1IZ6A 5GROA 1XMOQ 4OO1G 1D7QA 1HR0L 3E9IA 4Y7NH 4Y52H 3UDIA 1XNRQ 5K36G 4A3IH 1I6HH 4A3EH 1QZHA 1Q7YC 1EFWA 5GAGC 1ASYA 3HOUG 1OXVA 4TVAB 3UE0A 4A76A 2HIXA 3RZDH 1I94Q 4JI7Q 1N33L 3L2PA 3CW2C 4L5TA 2PI2A 4DR4L 5BR8L 1PYBA 2F52A 2C35B 4DUZL 1X55A 4DR6L 3CCLA 1Z47A 3B6YA 4LF8Q 4R4CA 2PNHA 4P75A 1SR3A 1P8LA 1UWVA 3PIPA 1KRTA 2CQOA 4YHHQ 3DLLA 1VQLA 4GKKQ 1JT8A 5FLXc 2AMCB 1X6OA 2AWOA 3KJPA 2HIVA 1B7YB 1N32L 2CCZA 2Z6KA 1I3QH 3PF4A 2OWOA 1UE7A 2KBNA 2R92H 1BBWA 3S24A 1UE5A 1GO3E 1Y1WG 3NENA 2NN6I 3W5OA 2MNAA 2PMZE 4UP7A 3CD6A 4A93G 4OWTB 1VCIA 4HIOA 4GKJL 4LF7Q 2JA7G 1KXLA 3KF6B 2HHHL 3HOWH 2QGQA 5GAEC 1PH8A 4DV4Q 1XPOA 4IOCA 4LF4Q 1LUZA 2ZTEA 1NMFA 1MIUA 4BXXH 4B3ML 3M4OH 4IPCA 1Q12A 3CCUA 1EYGA 4JI5Q 5LMUL 4LNQA 4A3JH 4JI1L 4DKAC 4JI0Q 4O0AA 2OCEA 2K5VA 2GVAA 3KLWA 2WB1G 2K5NA 1IBML 2BA1A 3T1HQ 3G6EA 4AQYL 4DR2Q 1N34Q 4OWWB 2WB1E 5GAHC 3KOJA 2AHOB 4IOAA 2NVTH 2E2HH 1KL9A 2LXKA 3JAMc 4A3FG 3SGIA 5C3EG 4DV7Q 4WJ3M 1YJWA 4YWKA 4HIMA 3I7FA 4JYAL 4IO9A 3JAMi 4P72A 2GVBA 2N49A 3ZJYC 1V1QA 1UE6A 1YHBA 2I5MX 1YEZA 4FDBA 4UP9A 3S1RH 2VUMG 1UE1A 1K0RA 5FLMG 3PO3G 1K3RA 1G291 1PH4A 3PUZA 4A3CG 1OTCA 1BBUA 1C9OA 5IP9G 4A93H 4A3MG 2R7FA 1E24A 1D8LA 3BJUA 4GNXB 3UE1A 1HNZL 2XGTA 5ELOA 4A4IA 2NZOA 1M90C 4B3SQ 5LMNW 3K7AH 4ME3A 1NJIC 1GD7A 3CCRA 3A74A 1VQHA 3F2BA 1I5FA 2ZJRA 3CC7A 4WJ4A 4JCVE 4RG1A 1XTDA 3PO2G 2A1AA 1JJCB 1NY4A 2VQFQ 1IL2A 2VNUD 1VQDA 4DV3Q 1VQ6A 3HOZG 1QUQB 5C0XG 1IBKL 3CCQA 2PQAA 1VQ5A 2UU9Q 3S15H 2CFMA 4H02A 1CSPA 1J5EL 2WAQE 4OX9L 4OO1I 3I55A 1YJNA 5JEAG 4A3IG 3CPFA 3U58A 4GN3B 1TXYA 4UY8C 1FGUA 4BY7G 4C2MH 2JE6I 4A3FH 3FKIH 5C3EH 4LFAQ 5IYCH 1GM5A 2QEXA 4LF5L 1VQJA 4LF9Q 2YTXA 4LUVA 3T1YQ 2F4VL 4DV5Q 1E22A 3RLOA 2N3SA 3I4OA 1FJGQ 2ZJQA 1BVSA 5C44H 1GVPA 3AQQA 2BH2A 4KHPQ 4QY7A 4UPAA 5JJLA 2VZAA 5AJ3Q 3MEFA 5IP9H 1XPRA 2YU9H 4JI2L 4BY7H 4YY3Q 1EWIA 2OQ0A 1SRUA 1PYSB 3CCEA 1PHJA 3K7UC 3FHWA 4JOIA 5GQOA 5J3BA 3GDEA 4DV2Q 2UXCQ 3F2CA 2ZTCA 4ALPA 4DV6Q 2NVQH 4JV5L 4C3IH 1X3GA 2ATWA 1WYDA 4GLVB 3PUXA 3RZOH 1K73C 1RL2A 2B29A 1SFOH 1EIYB 4JBKA 2JA8H 3HOWG 1EQRA 2KCTA 5C4JH 3W1BA 1QZGA 2K14A 3L7ZC 3I56A 3K80C 4BXXG 2UUCQ 3TEHB 3TQYA 3CMEA 1PH2A 3AEVA 4LFCL 3GO5A 5IWAL 3PIOA 1TWCH 3EN2A 3PGZA 1N36Q 2Y0SG 1UEBA 4YCUA 4LWCA 4DUYQ 1VQFA 2IHFA 4A3JG 1WCMH 4BY1H 1XNRL 1KAWA 4A3DH 1VQIA 4C3HH 2ZM6Q 1CKMA 2DGYA 3AYHB 3H15A 3WWVA 2Y0SE 2ASBA 3UDGA 4JI7L 2KHIA 3PUVA 3HOVH 1HZAA 5IY0A 5M5WH 1NE3A 1HJPA 4GNXC 4DR5Q 4JG2A 1FL0A 1YITA 3GTOH 1I50H 3MXNB 4IPGA 3F2DA 2Q2TA 5IYDG 4JBWA 5FJ8H 2Q2UA 4LF8L 4IFDG 2WFWA 4X6AH 3PF5A 2AWNA 2NZHA 1KQSA 1HR0Q 3JC66 4YHHL 4A3KH 1MJEA 4LFBL 2UXBQ 2VS1A 2Z0SA 3I4NG 4JI6Q 1U0LA 3G4SA 4DR3Q 2N78A 1EOVA 4LUZA 1JB7A 3KF6A 5IT9c 5IP7H 4DUZQ 3U4VA 2R93H 2K50A 2UXDL 4B3RL 4X65L 1IXRA 1OXTA 1PH1A 4NXMQ 1V9PA 2H5XA 3J7ZC 1XJVA 2HQLA 1L0WA 3TS0A 1Y1VG 5HY6A 4B3TL 4LF4L 2HT1A 3S17H 4DR7L 2MO0A 4KLKA 3HKSA 3CXCA 1NTGA 3GTGH 4LW1A 1PFSA 1N32Q 1KHIA 1VQOA 1PH7A 3E0EA 3ER0A 2VQEQ 3CCJA 3TRZA 1Q1BA 1W2BA 3ICEA 3PCOB 2IY5B 1L1OA 3RR5A 1SLJA 2HHHQ 1Y14B 1IBLQ 1Q8KA 4DV1Q 1HZ9A 1GKHA 4R4TA 5EAYA 3OTOQ 1KD1C 2D62A 3VDYA 1XNQL 5IYDH 1YNXA 3FKIG 5IYCG 2IX0A 1S3OA 4OWXB 4KHZA 4RMFA 3BZCA 4HIKA 3E9HA 1TWHH 4NPSA 4JI1Q 4DV0Q 3I4NH 5C44G 3GTPH 4DR1Q 2KCMA 1IBMQ 4JBJA 2R7DA 4GN5A 4JI3Q 1X3EA 2UUAQ 2JA6H 4X62L 2XTIA 4GLAC 1J6QA 1OXUA 4HJAA 4LUOA 4A75A 4R4OA 4LF6Q 3GTQH 4PG3A 5LMNL 5HGQA 4BA2I 1N9WA 4A3EG 1VQ8A 2F3IA 1CKNA 2MQHA 3KDFB 3HOXG 1Y1VH 4JOIC 4X64L 4GLXA 4JYAQ 3D31A 1HNWQ 4R4IA 3RN2A 1PA6A 1K8GA 2JA8G 1CKOA 1XMQQ 3STBD 2DUDA 3H3VH 5GADC 1WFQA 3CP0A 3Q8DA 5M3MH 1JMCA 2R7ZG 2WAQG 3U50C 2K5HA 4P73A 4DV3L 2MFIA 1U5KA 4YWMA 1XPUA 2RF4A 3CCSA 1HNZQ 2A8VA 2D0OA 4HJ7A 1WCMG 4BY1G 4A3DG 2GN5A 4QL5A 1JJ2A 2B3GA 2RHQB 4LFAL 4HJ8A 1SMXA 1VQAA 3HOVG 4GOPA 3T1YL 5IYBG 3A5ZB 4DAYB 1HNXQ 1VQPA 4APVA 4KI0A 1E7ZA 1HZBA 2QA4A 4DV5L 4A3GG 2ZTDA 1OXSC 5IE8A 5FJ8G 1JE5A 3F1ZA 1O7IA 3RNUA 4IFDI 3M4QA 2E2IH 4KHPL 1L2FA 4TQUS 2MO1A 3STBC 3ERSX 4XIGS 5AJ3L 3CC2A 1DGSA 2EXDA 4A3BH 4A3KG 4NXNL 2PQAB 4YCVA 2AKWB 4PZ6A 4YY3L 5C0XJ 2A19A 1YHAA 3AFPA 1Q1EA 1QVFA 1E1OA 2UUBL 3HOXH 2UXCL 4AH6A 5IP7G 3K0XA 4DV6L 1K83H 2Z6KC 5JEAJ 3ULJA 3S14H 3CMAA 4EX5A 1SE8A 4K0KL 1E1TA 2R93G 1A63A 4C3JH 4R4QA 3PUWA 4AYBG 3HFZB 1N8RC 3BZKA 4X66Q 1Z9FA 2R7ZH 1HZCA 3S16H 1VQMA 4P71A 4DPGA 1WI5A 1YVCA 1AE3A 3U4ZA 4DAMA 1X56A 4JI8L 4AYBE 3M9BA 3TREA 2JQOA 1C0AA 3H0GH 1XMOL 1A0IA 1N36L 4OXPA 2Q2HA 4DUYL 3PSIA 4JI4Q 2JA5G 1VQNA 1FVIA 2ZM6L 2I0QA 1I94L 1W3SA 4DNIA 1JJGA 3I2ZA 3GTMH 4MNOA 5IYBH 3BU2A 2E5LQ 1PH9A 5H1SE 2R6GA 1L1OC 4BBRH 3M3YH 1X54A 4DR5L 4A3GH 3HOYG 1KIXA 1RIPA 5C4XG 3RLNA 4LFCQ 2D0PA 5IWAQ 2IT1A 3OW2A 2I5LX 4GKKL 4GS3A 1S72A 1WJJA 1X9NA 4POFA 5DLQE 1HR0W 5M3FH 1N33Q 2UXBL 4JI6L 3J80c 2EIFA 4DR3L 2K52A 2JEAI 2Q2IA 3CCMA 3NEMA 5BR8Q 4AIMA 2JA6G 4JC0A 4DR4Q 3W1GA 4DR6Q 3G71A 4QQBX 1H95A 3IRBA 1T9HA 3J80i 1OXXK 4LF7L 4UP8A 4OONA 2CKZB 2LSSA 3KJOA 1EQQA 2FXQA 1A8VA 2JJQA 1NMGA 4DK6C 4NXML 4DV4L 2YTYA 2IHEA 1C7YA 1A62A 2ID0A 4IPHA 2K4KA 3UDFA 4LFBQ 1YZ6A 4IFDJ 2I5HA 2VL6A 4JI5L 1HH2P 3S2HH 4POGA 3PV0A 5M3MG 3RLFA 2JA5H 4JI0L 4R1JA 2VQEL 1VQEA 4EQ5A 1YIJA 1X65A 4GKJQ 1Q46A 3CQZH 5C0XI 1AH9A 2YV5A 2E2JH 2UXDQ 3T1HL 1VS0A 1EUJA 4B3RQ 5E7NA 4X65Q 4JBMA 4MTNA 4DR2L 1YJ9A 1N34L 1IBLL 4L5QA 3KYHC 4DV1L 3OTOL 1IYJB 3A5UA 3OYYA 2KENA 4B3TQ 3HOYH 3M4PA 4B3MQ 5C4XH 3I4MH 4BBSG 4DR7Q 1K9MC 1VQ9A 3ULPA 4DV7L 3UDXA 4P74A 2CWAA 5LMUQ 3NELA 1K8AC 4DV0L 4GOPC 4O2DA 1ASZA 1MJCA 3HOUH 4DR1L 3J81c 3TS2A 4GNXA 4AQYQ 4QGUA 4HJ9A 4JI3L 3M85A 1PH5A 1VQKA 2UUAL 1QVCA 3S1MH 2VY3A 4A3BG 1TWAH 3KF8B 4L5SA 3J81i 1L1OB 3KDFA 1XNQQ 2ZJPA 2JK8A 1B70B 4YCWA 4LF6L 3D0FA 1Q86C 1BKBA 2CWPA 1PV4A 3EIVA 2JA9A 4NB3A 2E8GA 4B3SL 3K8AA 2B63G 1HNWL 4L5RC 1KC8C 3NBHB 1QUQA 1KRSA 1VQCA 1XMQL 2VQFL 5M5XH 2NN6G 4X62Q 3GD7A 1YI2A 3FP9A 1Y1WH 1P16A 2UU9L 2ALYB 3H0GG 2JA7H 1G6PA 1CUKA 2NVYH 5LMNQ 3S1NH 1LTLA 2EQSA 1YHQA 4QJFA 1CSQA 4X64Q 2OQKA 4BBSH 4PMWA 2VW9A 4MZ9A 2PI2E 3K81C 4LF9L 1CKNB 2L15A 3J81j 3G48A 4BBRG 4A3LG 1HNXL 1SN8A 1V43A 3L0OA 1M1KC 3CF5A 1IBKQ 1FJGL 3S2DH 2YTVA 3LGJA 2NVXH 4IJLA 1J5EQ 1MKHA 4OX9Q 1SROA 2K75A 1LM0A 2RCNA 4DK3C 4J15A 5M3FG 4DV2L
chains in the Genus database with same CATH superfamily
3NDPA 4NU6A 4ZN6A 1GV0A 1FTYA 4P1ZA 3R5FA 3LDGA 4F92B 2YVQA 1Z82A 1G5FA 1U3DA 3SC3A 1PTOH 4K46A 1LYLA 1ZVVA 1UM8A 2M00A 4C2MB 4KACA 1JBQA 3AFMA 3E18A 3CW9A 2OKCA 5H4GA 1GPMA 4KMUC 4K5VA 2X14A 3C1TA 3VJLA 2AF3C 6REQA 3T6OA 5CFZA 3VKUA 5A5FA 5LOVB 3VNBA 2NZYA 1GD1O 3V8PA 4LJ7A 3S2IA 4IPTA 1BBWA 5DH9A 2MNAA 5DLQC 4ZZ2A 3DLIA 1G7CA 4V0ME 4HCEA 5C5CA 2DHQA 4DPMA 2VHXA 4EBFA 1NAIA 2DY0A 1T8WA 3SSNA 3R5KA 3Q6MA 2VA8A 4ZC8A 3V48A 1QLWA 5KCZA 2X0DA 4AQYL 2XZOA 3L1VA 3P32A 3E3XA 2UYQA 4LJKA 2ZIEA 1T4MA 4DQDA 2GYWA 4JU8A 5DI3A 4ILEA 5I7VA 1KDRA 5LBTA 4QF4A 2ZDQA 4G8BA 3EEQA 2XDYA 4PNPA 1ZK2A 1A97A 2DLDA 3U7JA 4M0CA 5IASA 5ELEA 3O93A 1TQOA 2EQAA 2QL6A 1N9GA 3KZNA 2JE6I 1MG0A 1MA3A 4XDZA 5L3SB 3GTQB 4YXFA 3CG4A 2NQ8A 5K9ZA 2X5JO 2Z2IA 3UAZA 1PHJA 5K03A 2UXCQ 4X6LA 1XXLA 1NUCA 2GZ2A 1KZ6A 3GEMA 5C4JH 2J4XA 5DNVA 3C3PA 1G8GA 4IUUA 2GCNA 2HBYA 4X71A 2ZSKA 4AKHA 4CCSA 4CKEA 1WDLA 1E3LA 1T8YA 2VJAA 4Q1EA 1J00A 3QKSB 3PI6A 2GT1A 2OGUA 5IAKA 1KMIY 3QP9A 2B2TC 3CEPB 3CX7A 1LBEA 2ZRQA 3H0GB 1PSDA 5REQA 1E2MA 2O52A 4MW9A 4X1OA 3QG5A 3NWTA 4LF4L 1Y1VG 4WE3A 3GEGA 4KQJA 2Q2WA 1SA0B 1D4OA 5K51A 2VWPA 1EIWA 4RMFA 1B6GA 1A8QA 4IZHA 3BKXA 4U6NA 3DT9A 4CF7A 4XQEA 1B3RA 1QNFA 3I04A 3WFJA 1T9CA 2QGFA 2Q3EA 1OIVA 1NU6A 2RB5A 5K2OA 3H3VH 3H2ZA 1ZK1A 3NCTA 3HS3A 3A1TA 3S2ZA 1M8KA 5CAEA 1TIPA 3BILA 4LOIA 2RHJA 4QFBA 5CIYA 4KUGA 1SMXA 2OCGA 5JZBA 4HGRA 1SSOA 1MW8X 3OZXA 2DY7A 4EMTA 5ADHA 4O5AA 1Y3FE 2QLTA 5JEAJ 4YJ3F 2BFBA 4TKVB 2HZBA 4OAPA 4DNFA 4L4UA 4MWBA 1R16A 4I1SA 2WNSA 3D6WA 2PRZA 4DF3A 1NX9A 4C89A 2EP7A 5IBRA 3IQIX 2O2EA 3IMCA 1UPBA 5H1SE 2HV9A 3OTGA 2FCRA 4BZPA 1D5XC 1ZSNA 1WTQA 2VYQA 1OH7A 5KWEA 4KJOA 3ISJA 3LNTA 3PPYA 1IBSA 5EMNA 1N1MA 3E4CA 1P8JA 5BSWA 5I45A 2HYIC 2VF7A 4EQ5A 2MOKA 3TR5A 3W90A 5E7QA 1MEOA 1WXEA 1UDCA 5C4XH 1GLVA 4IQ0A 4JUIA 2BZ1A 5LMUQ 4K6CA 1IK4A 1CF4A 2BC9A 4IALA 4BP8A 3A3YA 3T7JA 4BLRA 2ZGVA 1XRSB 2SNSA 5EMJA 3HCEA 3ZLBA 4IICA 1Y7IA 2QX4A 1OC4A 1UXIA 1E6CA 2O5JC 2QT0A 3C98A 2GA9A 3HKDB 1LSUA 1IY8A 2QE7D 3DZ8A 1TKAA 1YVDA 4BLQA 4PAGA 1M0WA 1N1GA 3U6KA 1C5KA 3T06B 4HFMA 2E89A 5DE3A 2BGRA 5DLYA 3C1UA 1E2FA 3P20A 3P71T 3OKCA 5KTKA 2F4VQ 3KYDB 5CT6A 3H9EO 5JCOC 3G5UA 2Q9CA 2YWJA 4WKBA 1U8YA 4I5EA 2KVMA 1J56A 1XO1A 4E5SA 3IILA 2VKTA 3CH4B 4QDZA 4H08A 3DF9A 4WJ4A 5DTRA 1BDHA 4GHWA 4KAJA 4LY9A 4JI4L 3OWEB 5AI0A 3BT7A 5B36A 3RVQA 1LO5D 1LNSA 1D7QA 1F1BA 3SQDA 3BOSA 3N0WA 1RWBA 5F2DA 1NQXA 2P9QA 1WLSA 2G4CA 3R23A 1FJ2A 2HIVA 4RQTA 3K2BA 1MSHA 1Y8CA 2OUIA 4URYR 3KPUA 3NENA 1PNRA 3DBHB 2BBWA 3FWZA 2H51A 1EAMA 4G01B 4JWKA 1SCDA 3ZXNA 1S3GA 3OT1A 2VPQA 4OO3A 3E9MA 3CX6A 4Y8VA 1UAPA 1TW2A 2PV0A 3PPWA 1WPGA 2KSQA 1QOPB 1H5UA 2XVXA 2GM4A 1V1RA 3BK1A 5BQ3A 1J2RA 3B6EA 2G28A 3GMTA 1B53A 2WJIA 4H16A 1Y7PA 4H3VA 4PAQA 1NLYA 4B3SQ 3HBLA 3W3ZB 3H5LA 2Q5FA 4KXXA 2FVYA 5FTNA 2O0HA 3N28A 4BJ3A 1SOUA 5JPNC 3EDMA 1WW2A 4J6FA 1VYHA 2Y66A 1NUSA 4PNYA 1DIGA 2QG4A 5AIBA 1FS5A 1Y42X 2VEDA 1F7VA 4KIGA 2O7SA 2VJKA 1KLUD 5I4IA 4ZAYA 4CODB 2APJA 4IYRA 1D04A 3TNJA 4ZGBA 1RL2A 1CIJA 4FUQA 3HVKA 2NTTA 4CM8A 2NMVA 3UMCA 1YA4A 5DGXA 4A3JG 2A0KA 3NOQA 3Q3GE 4LMQD 4QXOA 3MS2A 3LJKA 1PJLA 3PP8A 3JU3A 4RGOS 2ZIFA 4DUYB 5AUPB 2Q6TA 1Q1AA 3WYFA 2UYGA 2HFKA 3ZHOA 3FHLA 2F1KA 3BWMA 3VVLA 4BVKA 4B76A 3GTJB 1X7GA 1R6UA 2D9UA 2CYAA 3SJ7A 2BFCB 2P7IA 3OP1A 3KD3A 2AVNA 3DE1X 2DPHA 4XJXA 2NWGA 4Q01A 4US0R 4WJLA 5I4DA 4D0LB 1W46A 4CT0A 4DDUA 1C1DB 4LMAA 1TT7A 2VOJA 3LGXA 3U81A 1ISRA 3UJNA 3J7AV 3LYHA 1GNQA 4RORA 4HTFB 4JI1B 4S2UA 3Q87B 1ZXLA 2DU8A 3CGWA 3LX5A 4ETIA 4CQLA 4B3CA 2R65A 1JH9A 3F2VA 1JN0A 2WDPA 4RCOA 2NU6A 2GN5A 1Y9DA 1BU8A 3RRJA 3IQEA 2IVFA 2XIJA 3MWDB 2YWEA 3X43A 4MQBA 4QTYA 1D5ZC 1HCZA 5C0XJ 4EI9A 2YWCA 3ZY2A 4AJPA 4O8CA 1R4QB 5FBHA 3GP7A 2VJQA 1E5QA 3S1AB 2R00C 1S2OA 4MV8A 4MITA 4EPRA 1NPYA 4PPQA 1E89A 3H2JA 4R2LA 3PO3B 5J23A 3P0RA 2CE2X 4QGFA 4NYMR 1Z17A 4JOQA 4RCNA 3OY2A 1OAOC 2NPOA 4I1UA 5EQ0A 2I5HA 3IAM6 2Q7XA 5CYFA 3I83A 4RXTA 1K7FB 4MW5A 4H0FA 2Z5GA 2EV9A 2CLCX 2IEZA 1KHTA 4QJBA 4ZVVA 4P5PA 3GW8A 3CLRD 1BMQA 1ESNA 3OEWA 2YX1A 1RXYA 5TDHA 2F0SA 4L28A 3HWWA 4JA0A 1JLRA 3MS4A 2VVTA 5EJWA 5HA5A 1XPJA 1CR4A 1AQYA 5MN6A 1XMQL 3M4OB 5CFRA 1R9GA 3IODA 4K7JA 4Y98A 2VAXA 4XSHA 2CLSA 4QX6A 1RRKA 4ARCA 1HMPA 1YVUA 3D8NA 1SROA 3LT0A 3PEFA 4ON9A 2BW0A 2MSKA 4FGJA 5I6DA 1Y1TA 1RKVA 1E1LA 1Z08A 4KR7A 2P9HA 3K0CC 2XE8A 5FAXA 1OYYA 1V5WA 2GF2A 3LUPA 1XJ5A 5K1ZA 2AG5A 2BZ0A 2ZR9A 4HH1A 1FP4B 3F1LA 2ORIA 1L5QA 3MBOA 1MAVA 4RHUA 2WU4A 3UMFA 1UWVA 4JB0A 4JP3A 3AJAA 3ROTA 5AOCA 5AQEA 1GUOA 4II7A 5B1DA 3G8BA 2A3RA 4W5WA 4EATA 4LF7Q 3E1SA 1NUQA 4CIAA 2BP7B 1P3JA 1R5JA 4BVJA 4F7XA 4I9HA 4F2WA 3KKOA 3LL7A 2IE8A 3R3XA 3CCUA 1ZFNA 4IG4A 4A3GB 4YJHB 4OY3A 1EPUA 2RI0A 1T5XD 3SX4A 5DXJA 3LUFA 1U3TA 2EX1A 1TEHA 2RSOA 3TAHA 1MCZA 2VUMG 3FRIA 1X8JA 3D43A 1L5VA 2O7NA 5FWXB 1O0CA 2YASA 1D5CA 2CD7A 1I5OA 4Q05A 2IEGA 1JC7A 2FWNA 4GPIB 4MWGA 1NYQA 1LRLA 2A0FA 4BKMA 1XN1A 2GPSA 2VN8A 4BMXA 1Z6TA 2FE4A 3IQZA 1VQJA 1NQWA 5ENDA 3O1LA 5E6SB 1R0YA 1RXWA 1CFMA 1Z7EA 1YI8A 3BMQB 5HOQA 4KV6A 1LDNA 5GMOA 4ESHA 1TM3E 3MYYA 2VDKB 1VXRA 4JBNA 2P4UA 4BY1H 5JAIA 2P2DA 2QRQA 1TA0A 4QUJA 3MGCA 3TKLA 4M9UA 1I3LA 4G86A 1NL3A 1IUOA 5HKOA 5JH7A 3BH0A 3GNLA 1QIIA 4C7OB 2QX8A 4FMCF 1UEIA 4MLDA 2MWMA 4UM9D 4YI3A 3OFKA 4B74A 1SNMA 4CTJA 1EFVB 5DN9A 2BUBA 2AMJA 5AJWA 4FEYA 1QP8A 1C9EA 3THWB 2ASEA 3CR8A 5ITZB 1TCAA 2BKEA 4HTAA 4HAWA 1EMDA 1HFKA 1B93A 1ZBDA 3MTAA 1QAOA 3SG0A 4CJ1B 3E6AA 4F4JA 4F4FA 2OHOA 2UYYA 4Z3KA 3RT1A 4PR0A 4YJ2B 5JXIA 4X64L 1ENZA 4I2NA 1W6KA 4WCFB 2KX7A 1YRHA 3Q8DA 4BWVA 5IC6A 2RBKA 3PIIA 3K05A 4E21A 3W5UA 2I1WA 4ZD6A 1ZIYA 3KAPA 3ZU4A 1L0BA 1K5DA 1PS9A 1UZLA 1NP6A 2X5KO 4JOCA 1NLUA 1Q57A 3STTA 2H9AA 1JEYA 4PX2A 2A57A 1FYFA 3F47A 1CQVA 1PU2A 3WHKA 2AOUB 5CVEA 3CPEA 3KLRA 4TM7A 2G9DA 2VJOA 4UU8A 1QXSA 4M86A 5AM1A 3WLTA 1W88B 4QYSA 3QKUA 3GZTB 1P1CA 2LIVA 4C7JA 1NLMA 5A5VA 1U2SA 1WTPA 4XXEA 3ED5A 4EJ2A 1D1SA 1S2MA 3NEMA 1PGQA 5IGGA 4OCZA 2I34A 3Q7RA 2C3YA 2FXQA 4XYEA 3U39A 5DB4A 4GRDA 3ROZA 2Z8XA 4RDCA 3HZHA 2ZSBA 4C3ZA 4GAEA 1QIKA 3P4UA 3S1SA 3JSAA 5CLQA 2C4VA 4BY7B 1P81A 2EYFA 4OXIA 1HHVA 2ZB7A 3I1YA 3HOVB 1QVZA 5FR2A 4HTHA 3QVSA 1O03A 1Z28A 1LBHA 3L02A 1ACMA 1SMYC 3TUJC 2B1RA 5BPHA 5K6TA 1JTVA 2N55A 3KDFA 2AYYA 4O8ZA 2PKQP 2WIFA 1FUIA 1XMJA 1FGBD 4NPAA 1Y1WH 5EHXA 1BO0A 3R6GA 4ID9A 4Y9DA 1KQPA 4K5QA 2QRZA 1DO2A 5P8WA 3A3PA 1Y4DE 4NU5A 5KX5F 1QUFA 4BB0A 3T3NA 1EB9A 2W6ID 1E2WA 4F2PA 3LBYA 4GF5A 2GPTA 3Q98A 2JGJA 3FHOA 4G0QA 3VPCA 4FQ5A 3T1OA 4KMRA 1TZ2A 3S55A 3SI7A 1E2JA 3J7A5 2GZ3A 1T8RA 3DEYX 3H99A 4URVR 5DGIA 4H3KB 1ZGZA 4ZA2A 2VTVA 4AO8A 4PZ8A 4EHIA 3UDIA 5K36G 2WICA 4FKZA 1JWSD 3UTCA 1X92A 3HB9A 3LVRE 2AR9A 1P7CA 3P27A 4I3GA 1K83B 4OGGA 2AMCB 1PLJA 4O2RA 1ID1A 3MTBA 3N2KB 2QGQA 3A6JA 3V2TA 1Q83A 2XRYA 3I2KA 3ILYA 2Y1XA 2I78A 4C4YA 2J9FA 1W5BA 4IOAA 4RTRA 3W2HA 3RIMA 4YASA 4HUJA 2PMEA 2F90A 3I64A 4P2GA 5FKAC 4FINA 4TOIA 4CQMA 1KDZA 1MO3A 2VRCA 1WSBA 5IBQA 1KAGA 5IULC 3UW1A 3OC6A 1C3VA 5F76A 3PO2G 1IPEA 3ZHQA 2CFMA 4Y3UA 2O3QA 2R86A 1LUAA 2JA6B 4A3FH 3E9EA 4QPNA 4PO9A 3U80A 1N78A 1P5ZB 3A06A 4AG3A 1OZAA 2VKQA 1DLIA 5CFPA 4N6NA 2XVMA 3SHVA 2XCUA 1T8SA 3K1TA 5M5XB 4UUQA 1KJIA 1HV8A 3E22A 3DS8A 1NG1A 1L3CA 4RVOA 2NU7B 4L9WA 3LF1A 3K9QO 4QQ8A 1CKMA 1NTRA 2Z6UA 2Q5HA 3OZSA 4KR9A 2BIFA 1HLPA 3AVUA 2NXNA 1YOBA 4ZAXA 3EZYA 1E0BA 4DR7L 3UK7A 2F0DA 4DUZB 4HWOA 2DR0A 3T3HA 1K7EB 3TQQA 2ZRDA 4QYXA 3ZXYA 4H3SA 4BTLA 3X1XA 3SYLA 3F9IA 2ATVA 3NOXA 3WDNA 1RLUA 2E4YA 4G1MB 5EE0A 4F8EA 2HBZA 4XUCA 1FEZA 2RI6A 5LXTF 4UM5A 3ANSA 1RXIA 1HRDA 4OREX 3HZZA 4D6XA 4QBKA 3DTVD 1Q7RA 1EFCA 1Y9ZA 5B53A 2PKEA 2J33A 4A91A 1HXHA 3IRUA 4DUPA 1TYDE 1NBEA 3F1KA 4AROA 3HOVG 1YBHA 4M7PA 1KP9A 7REQB 3F4LA 4FF1A 1V0JA 1RIIA 3CF4A 1JPNA 2ZVDA 2WMYA 1N0HA 1BOFA 3CKIB 3ZD7A 4H4CA 4HMJA 3O8OB 3OZEA 1B8UA 3O8CA 3L41A 3F5SA 1G2OA 3ZHCA 1QTNA 3M9BA 5LP6F 3CRZA 2PT7A 1U8FO 4FGSA 4OXPA 1V8DA 4LECA 5A02A 1NI5A 1VJTA 3M3YH 1KZGB 4Y2XA 5JIBA 4B9EA 5LUBA 3LUJA 4Y2QA 1E0SA 5L51A 3V2HA 4P08A 3QQ5A 3TNDA 2Q2IA 4ZAZA 3R5HA 2Q4TA 1HH4A 1Q44A 4EEKA 2CK3A 2YTYA 2PUJA 2QGZA 4AUEA 3QXXA 2NTEA 2PZKA 1H0KA 4LXYA 5EPLA 5CP8A 4B3RQ 4IMRA 4GOOD 4I6JA 2VOEA 1NT2A 3P5BA 3UDXA 1WG8A 4D8TA 1XRJA 1W8DA 3RVJA 4KE8A 1L1OB 2YZ2A 3GZNA 3M6AA 3R0QA 5CBAE 4PXSA 4AS3A 3OSZA 1LTLA 4IJMA 1K86A 3P4XA 4KIWA 1J9GA 4PTLA 3ACBA 3FCYA 4EARA 5KYWA 2HSWA 3DBRB 2C7PA 3DEPA 1PJBA 3VPHA 2RDMA 4INAA 2YMLA 3GGDA 5BOSB 4TKOB 2ISQA 1QZTA 2P2ZA 1FS4A 3ASZA 4NNJA 1JDBC 3CC4A 4Q03A 4WL0A 1EXNA 1N3IA 5JDIC 1OF1A 1PVOA 1XTTA 1Q82C 2QLMA 5IVDA 1N6EA 4BVLA 3ABZA 2ZWOA 1K8OA 3FJYA 4D4MA 1J8DA 3KQLA 1I6HH 1DE0A 2DX7A 3HXTA 3G7NA 3OQJA 1Z5ZA 4HATA 2ZUWA 3JQ9A 3WI7A 1AGPA 4QKQA 2YS7A 3SIWA 1PBTA 4AZVA 1Z62A 3LW8A 2Y1OA 1UBHS 3N70A 4OQZA 3KF6B 1I1OA 1RVDA 2E4XA 4UU7A 3DMFA 5DYGA 1ZKDA 1PJQA 4ZZ0A 5E3FA 4MXDA 1CCWA 4BFWA 3IOMA 4QDOA 5AOAA 1J7XA 4TV8F 3TKYA 1V6AA 4TWJA 4Y9UA 1GSOA 3R5JA 1PS0A 5BSTA 4MR8B 1PDVA 2Z5FA 2BJHA 3DLHA 3F90A 1KO8A 5FBZA 3D4LA 1DAKA 3QU2A 4OMUA 3QPVA 4OIJA 2BBSA 4HMQA 3UJBA 3CGGA 4E5KA 2CMHA 4ARIA 1IBKL 2QV0A 2C7GA 1PJ4A 4MGKR 3EVEA 2NVUB 4GN3B 4IURA 5D2CA 1KVUA 2DPGA 4HP8A 3T5BA 2CBZA 1LTGD 3INTA 4BZZA 1WZ2A 3IVRA 1JALA 1DAEA 4IWXA 1N6DA 1SKYB 2JA8H 3EFOA 1UPFA 4TZ6A 1AN8A 1E1QD 4POOA 3FPKA 4DY6A 3U31A 3JASB 1P60A 1UKZA 2XSCA 1G4AE 4ARSA 4KU4A 4EJSA 1PCXA 3DOEA 3Q8WA 2O8DA 5TR9A 4KLCA 3NHPA 1KO1A 1PZHA 2K50A 3RF7A 5EZYF 2G77B 4NZYA 5SYNA 2WTMA 2JLWA 2Y1WA 1IEQA 1KRWA 1KBZA 3WDKA 3UXMA 2F7SA 3U3JA 1GQ2A 2GERA 2RH4A 4DC1A 4C29A 1V71A 2XA9A 3F97A 2WTAA 3AEYA 3X1ZA 2IZOA 5ALXA 4Z54A 2W2VA 3HKEB 3UC5A 5A2QE 5C4GB 4P3KA 4XRGA 5JS8A 1K3TA 1DC7A 2XB4A 2Q8RE 2D74A 1WCIA 3ESAA 4FC7A 4UOZA 2R1VB 4L0DA 2JGFA 2ZIUB 3M70A 1TMYA 1HURA 1A2OA 3L8EA 1QH9A 4P81A 1ZH2A 2CXHA 2NACA 1DBVO 4C1NK 2DUJA 1X7YA 3RMHA 2FUCA 4KHPL 3DVSX 2I54A 5CPBA 4ZCQA 2Q3JA 1RODA 2WTBA 4P3OA 3SF8A 4ROTA 3H7AA 3TLBA 5JSZA 3FW1A 2PXHA 3NYQA 4IS2A 3OQIB 5ALEA 4ZK9B 1Z9FA 2I03A 1IY0A 3SMVA 3T7KA 9ATCA 1FMJA 2GZAA 3E5MA 2ZTUA 1E60A 3F67A 1WCV1 2BTQB 4F8JA 1Y6QA 4EYKA 1UKEA 3DWFA 3HA5A 3TLAA 3S99A 4EB8A 1MOZA 2B5VA 3ZY3A 1P3Y1 1R5BA 5JV5A 1U6IA 2ZYTX 1SKQA 3VDRA 1JPUA 2JK1A 2IHEA 3A6PC 4WK6A 2XCIA 1VXOA 3I92A 4JLDA 4D26A 2UXDQ 1T91A 2GS9A 1UBCA 2IYXA 3AFGA 4OAOA 5F7OA 4NP6A 1XB2A 3KPJA 3AUFA 3ULPA 5GGYA 3BK2A 2RAVA 3D3JA 1LB1B 2J3QA 4A8JB 3KF8B 3RS3A 1K5HA 1JDZA 1JKIA 4B6OA 3T3DA 4Z3DA 2ZSUA 4AVYA 3LY5A 2YYAA 4QDUA 3V33A 4J7AA 3CEJA 3PJFA 5DHUA 4AAYA 4WWHA 1E9DA 2BOVA 5JATA 4N82A 4AWBA 3V8EA 4BAZA 4EP1A 3ESDA 3J81j 2FRDA 3MD9A 3L1HA 4IJLA 3N86A 5K3CA 2ZRBA 4ARZA 3G5AA 2PZUA 4QGGA 2ZI5A 1E2EA 4X7MA 2GN8A 1EINA 4P2BA 1ES9A 2V6JA 1S40A 4H4DA 4P0TA 1ZD8A 2B2UA 4Q82A 3S15B 3R2IA 5AXDA 2QW8A 4RA6A 1J8QA 1XEXA 2ENUA 1LPSA 4OO1G 4GW3A 2AC7A 3IBFA 3PUJA 2RHHA 4FOOA 4RFLA 1N33L 3QX8A 2C35B 1YQEA 1KI9A 3N59A 2EL7A 3MELA 4EHFA 2E0IA 4RTMA 4DSAA 3BWVA 4X8OA 2FTKE 4FT2A 3DEHA 1PH8A 4IOCA 4XAQA 5IXYA 3DPUA 5J4KA 3HE3A 3CNEA 3DMDA 2ZCVA 3NM4A 1U8UA 4OM7A 1TB4A 3DDCA 1ZHOA 2VHYA 1EY7A 2HL6A 1E1RD 4C7MA 5JRZA 4AYBB 1YHBA 4EQ6A 3TO5A 1K0RA 2V7PA 1E6LA 2ZR7A 3WP1B 1SM4A 1Z74A 4BNFA 5EOVA 1USWA 4QIHA 1R0XA 3FDXA 1QF6A 1AE1A 4NCKA 4WZBB 1E3JA 5GOZA 4OHWA 1FP6A 3ICQB 1W1UA 3S1MB 1WQ3A 3SHOA 2HZ7A 3WJ7A 4U2KA 3GD5A 3DWQA 4GP6A 3TWOA 5CV5A 4S1PA 3SK5A 1GKIA 4N01A 3Q9LA 1EWIA 3W5DA 4R8LA 4IW3B 4RF3A 4PYOA 1NQTA 2Q5EA 3H65A 1P0PA 3AC0A 4MV7A 3K1ZA 1IRIA 2J6CA 2Y0SG 3OIRA 4KXYA 1UQRA 1WA5A 1Z7TA 1H3NA 3RYIA 1G41A 1TLLA 4BX9A 1I14A 4OHMA 5E0KB 4H7HA 3RGGA 1RYZA 1KMHB 4I1RA 5F1OA 4BBPA 1PT5A 1JL3A 1MFZA 5JXGA 4RKBA 2C4KA 4LDAA 1NQVA 2DFPA 4L5BA 4RX1A 3UEOA 5KTNA 3EGOA 4C01A 4HB3A 3ZCXA 3OTOQ 3EC7A 3S2EA 1H2AS 1R3DA 2JGRA 1N32B 4F86A 5GV8A 3D8UA 1RWKA 3G49A 1X94A 1CR0A 1Y3HA 3K58A 5LQAA 1P5FA 4ASUD 1CVIA 3COPA 4WPGA 1O95C 4R4IA 2PHZA 3PUKA 4XJTA 1YZUA 4QT0A 3ZTBA 4Z5XA 1WVGA 4TXJA 2RB4A 1HTBA 4QUFA 3HHPA 1UMBA 4IGFA 1P9NA 3FFAA 4QVKA 3U19A 2X9LA 4D81A 4P2CB 3L0IB 5KVSA 3BXEA 3SX0A 2DCMA 5DNWA 2KPOA 4DV6L 2CHVA 3EZLA 4X20B 2V7UA 3SLGA 1R2QA 4DJTA 3I5YA 4F4IA 4CLOA 4E2XA 1CX9B 1X70A 5DLDA 3C6MA 4L15A 3LGSA 5IOCA 4N7RA 1NMYA 1EQ2A 4Q6BA 4C0AC 1LVGA 3TLKA 5AYVA 3FN4A 5CA1F 1PT9A 2L4NA 2X9QA 4JC0A 3SXHA 2FMKA 3GXBA 3DZFA 5FKJA 3NHLA 3FCCA 3IT0A 2BDTA 5TQ0B 4KE7A 1SMYD 2FQ1A 2VQ3A 3KOWA 4I4CA 1NVAA 3I6IA 4CEHB 2VF8A 3EFXD 2AK3A 2QPAA 4KEAA 2VHTA 3HP4A 3BXPA 3T5AA 4TSSA 1NOKA 5TGZA 2VUIB 1KFJB 1JA0A 2HHJA 2Q4OA 1G2TA 4B3TB 5EHIA 2GVDC 3D0FA 2WB2A 1TU3A 2JA9A 3NEAA 1SWVA 1AC5A 1Q0QA 1DWUA 4TMTA 4U5QA 3RRNA 1DWPA 2VA9A 3U09A 3FP9A 1LK5A 1ZK3A 1OAAA 1WVIA 3CSDA 1NDQA 2GYYA 4S1VA 1CT9A 3D7SA 3OC0A 3WC4A 1VCNA 2QY9A 2VF2A 1NVUQ 2F0UA 5FI0B 2SKEA 2HF7A 4IPDA 4FWTA 3CVVA 4PCUA 2IP4A 8MHTA 3T35A 1PJ3A 4ZZ1A 1TT2A 3UMVA 2ZT7A 3N2EA 2ERCA 2F55A 3PPVA 2OD2A 4B3JA 3Q7PA 2R2AA 3SCZA 3QOLA 1OJ7A 2HMUA 1EDBA 5AKXA 4JV5B 5B7QA 4ZCPA 1DOZA 2BM9A 4K0KB 3ODGA 5AFSA 3UE0A 5ETJA 4D2IA 4QTTB 4PG5A 3ZGZA 2QMOA 2G9NA 4CKZA 3RVDA 1U7WA 4GOMD 3KIPA 1BX3A 3KT8A 3NAZA 3EVZA 13PKA 1KJ8A 1RMQA 1E7WA 2PLFA 3KWMA 4YQZA 1MJ5A 5KPDA 1Z4QA 4X7PA 3I01A 3C43A 4JZKA 4QEKA 2PSHA 3L0YA 1JYEA 1ZH8A 3ZWYA 3UXEA 5CYPA 4CW7A 1G291 5KKAA 1TTPB 2XGTA 2PPLA 5A0VA 1UIRA 5KO2A 1QPZA 4URUR 2BM1A 4HNVA 4J3FA 1I3NA 2PVSA 3R9XA 3OOHA 1YI0A 2C4WA 4L8KA 3KT0A 1TXYA 1RQNA 4KK7A 2YS6A 1GM5A 1PO7A 1JHPA 4G5SA 4ABYA 3HG7A 5BQPA 1Q7GA 2R7AA 4C4SA 1M2FA 5K09A 2JYOA 2K2WA 1YMVA 3C24A 1PTJA 4AU1A 3RI3A 5JTTA 4BBSB 5B1HA 4GZ3A 5EUZA 2PX6A 1JXMA 4CG0A 1I1NA 4DXFA 1FL0A 3IQWA 3F0TA 2O05A 2OG1A 1E58A 3X2EA 3RS5A 1ZA1A 2ZDGA 1CFZA 3H2SA 1P44A 2JVIA 3DV9A 5F73A 4QEDA 1DZ1A 4HQFA 3AF0A 4ZV7A 5M5YB 4FXGC 2O0MA 3M3DA 1PH7A 3PCOB 4LOHA 2PN1A 2QHXA 1ICWA 4DKJA 3FKIG 2P90A 1RBQA 4IXDA 1NVVR 1V7QA 2V1UA 4YJDA 3DAPA 4HN4B 2IS1A 1DAOA 5AVJA 5F3WB 4QUHA 2PKRA 3BVMA 4GQAA 5EUMA 4ZPXA 1HA6A 5ESWA 1VBFA 2HUNA 1QE5A 5CM8B 3WGTA 1DDIA 1TMOA 4BU1A 2PGLA 3DM5A 4HWPA 1KORA 1UC8A 4BO0A 4D9IA 2WFMA 5FULA 1YSCA 1GZ4A 1GPNA 4REMA 5TQJA 4X1IB 3WIBA 5JNWA 2A19A 2O14A 5HX7A 4M49A 1SBBB 1A9XB 3RSFA 1YU9A 2GZHA 2R68A 4JH0A 3HGTA 4A92A 3DGEC 1CZKA 2N75A 4LMPA 1R4MA 2O23A 4HAEA 3NTQA 4F1KA 3I61A 2J9XB 1N3BA 1L9KA 4ZKBB 4TRNA 2G9UA 1A5TA 1RYYA 3HSKA 3LZDA 1SNYA 2OVBA 4GKJQ 4REQB 1KBOA 4XYOA 3WR5A 3R5SA 2PMCA 4HDQB 4PHTA 2WHEA 3JW8A 4KO3S 1AH2A 5FO7B 4AMVA 4R81A 5C1IA 1Q22A 1COWD 3UMSA 3C7KA 1D6JA 3AVWA 3U4IA 4JNCA 4KVGA 4RABA 2ORED 1A5SB 1N5DA 4QEZA 2G5DA 2G7ZA 4XEHA 4UUBA 2V4ZA 4PO1A 1ORTA 4LF9L 3DUFB 2YQ5A 4EG3A 2XYRA 2EQ5A 3MYRA 3ZW7A 1TE2A 4KE6A 4DK3C 3OG9A 2ODWA 2BTEA 3VI4B 5DWDA 4HYTA 4U39A 4R2MA 2R8OA 4EFMA 4MGEA 1AHNA 1QO9A 2XUDA 5ALYA 2WP0A 2N8NA 5EEGA 1QV6A 3VNSA 1IUKA 2C4NA 2KHJA 3S70A 1Q0TA 1XGKA 1HRKA 2H17A 2DXIA 3HPQA 3RNOA 3EWIA 4A0GA 2WYVA 1OWNA 3BFPA 3A4NA 3KZVA 1QR2A 1FVFA 1Z4PX 3B78A 3L8HA 1B1ZA 4FKMA 1R64A 1CP2A 3D0RA 1X6OA 1G21A 4LF8B 2O7VA 2VC2B 3VO1A 3R0VA 1JHQA 3G7UA 3QU7A 3SFZA 4V0OA 4LNQA 4MW4A 3RQIA 3D0KA 1C0EA 3DZGA 2GVAA 3VTKA 1IBML 4JK1C 1GADO 2RC5A 3VPAA 1O58A 4OFXA 4Z6KA 1WD5A 4RPLA 4BQSA 3SGIA 4NW2A 1VE3A 4R83A 3EXG1 3UUEA 4R8IA 1ZUNB 2IYNA 4PZCA 4DV1B 1E4EA 3NTVA 5HRUA 4YAFA 3BGDA 2DPYA 1RHQA 4WKNA 2G1JA 4KVFA 2E6KA 3ZDRA 1QUQB 1L5LA 3JVUA 4L6CA 4CBVA 4FDVA 5LCXA 5ES3A 1ODTC 4QE3A 4LNUB 2VLIA 1MHTA 1RM3A 3CYFA 2PRJA 3CVWA 1KXZA 5CCDA 3HA2A 3NETA 3WWYA 5MGBA 4MIOA 5K0JA 3R7SA 1OX4A 5B6IA 2BF4A 1OXKB 3T54A 2IEDA 3VR1A 1U63A 3BMNA 2QYHA 1QGUB 3PITA 3TUIC 1PZKD 2ASBA 4JI7L 3KP1A 2WWGA 4IX9A 3GTOH 3KB1A 4L8GA 4X6AH 3P4YA 3IAYA 4ERNA 4WMLA 1QX4A 1DBSA 1MAUA 5CW2A 1EYAA 1J6UA 3KK7A 3MFQA 4KGZA 1LDYA 4JLJA 5JAZA 2Q3MA 2OQRA 4FYYA 3U3ZA 4A3IB 2F0FA 3NTHA 3RZDB 2EFJA 5EBDA 4IEIA 5K8UA 3NBHA 1CUCA 4DV0Q 3I4NH 1WS6A 2H1HA 2QM7A 3WTCA 4B80A 1BMTA 1FFXA 4BVGA 2YBDA 4HL6A 3A04A 1MC5A 1AQUA 3KBGA 3FDZB 5BVGA 3BYZA 2FXIA 3HKZB 5DU2A 1R8QA 4TYWA 4WDRA 3T1QA 1B0PA 3F7MA 1D3AA 2NPIA 2OHFA 3OCUA 4KDCA 2UVDA 1SQSA 4C7XA 4HDSA 1Z2AA 2WHPB 3MTGA 2OE2A 3RGWS 2SEBD 1SCBA 4DPKA 1RM5A 3EXEB 3B3GA 5IYZF 3DAHA 1MOPA 5IP7G 3UFXB 2PEYA 4J0HA 1SIUA 2HPAA 2YL2A 2BGMA 3A1EA 1X56A 4YDRA 2MR5A 3K0YA 1N36L 1H2YA 2O0JA 4WEOA 1J33A 3E3OA 2AJDA 4LRQA 2JKYA 1S72A 3UHPA 1US8B 2UXBL 3GVJA 1JWLA 4EG5A 2R5FA 1TIID 1BHSA 3DQPA 1OWLA 5TMBA 2I1VB 4DQUA 4YS6A 3CEHA 1IPFA 5EY5B 4FPXA 4UVIA 3KEFA 3LOUA 1SNOA 3P1HA 3MBIA 1AKVA 2F0QA 3OMXA 4G3XA 4GRAA 1GXSB 4HD8A 1CULC 3QLUA 3C6KA 4MUYA 2AC4A 2NTSA 1JXOA 4DSNA 1NXWA 1BMFA 2O06A 4HB4A 4NBRA 1T9KA 5JSQA 3RK0A 2ACWA 4LV5B 3H0GG 2ZI7A 2B0JA 4RYDA 5H4HA 2J0UB 1CVLA 3R3UA 1PUIA 1V5EA 1RKBA 3GGSA 2RIRA 1SN8A 4OMCA 5JROA 3BF8A 4DT1A 1LQTA 2VQDA 4ZQ3A 4KIFA 1G21E 3S8MA 4P0QB 4ETNA 4BX3A 4L78A 1RQGA 2AD5A 2ZBQA 4NXNQ 2RKOA 1R5NA 2Q6KA 1RKUA 1WHSB 1WOCA 4CTNA 2Y0CA 2C00A 4UATA 2OHVA 5EIOA 4OI0A 4GVLA 3WOEA 5D65A 3RHZA 4FE7A 5M04A 4U8GA 2WAYA 5J2UB 4NJEA 4JYPA 3IDQA 4B48A 2VPYA 3IHLA 1P39A 3JAWB 5G0UA 3HZOA 4Q9LA 3QO2A 3HOWH 2W6CX 4DV4Q 1VDMA 2N47A 3STHA 4YC7A 1JOKA 1QU2A 2K5NA 2Q28A 1NVKA 3GJZA 4CCYA 2QK4A 4RLSA 4BMOB 2XB8A 5FTKA 4EBBA 2R93B 3TOXA 4D98A 3ZJYC 5EEHA 4FE4A 2OHGA 2YUIA 3RNLA 4ZHQA 4D3ZA 2J31A 2ZUFA 4NAVA 6CHYA 4CTOA 1UXGA 4QGHA 3ND9A 3NHHA 4WHMA 2F3VA 1GZ3A 3D4NA 5FADA 3CLKA 1KOFA 1Z26A 4YROA 3HOYB 4UOQA 3KJEA 4KLNA 1RABA 2B98A 4TVKA 4L2IB 1YRLA 4A3IG 1ECBA 2W6JD 4IKEA 2QIOA 2ZJ8A 4I55F 1NC1A 1FJGQ 4NR0A 4KPUB 2A78A 1C1YA 4DVGA 5HFJA 2YWHA 4RNDB 2Z9HA 3T0IA 2AF4C 3I30X 3CVXA 3RZOH 1QO7A 4YY3B 1O0SA 1GUWA 3S8YA 2FKAA 4TWRA 2VYCA 3W7BA 2NZ2A 5CJPA 4BQRA 1F9QA 4QUBA 4JG2A 2Y93A 4IPGA 2O1EA 1AKYA 3L06A 4WCFC 3WL6A 2LS01 4YJFA 2IZZA 5HYVA 4BZXA 1Z4LA 4UFPA 3VR3D 1UBJS 3ADKA 3A58B 4BBRB 4MPDA 9LDBA 2ZAYA 1O95D 3T5DA 1XNQL 1SY7A 2JNWA 1CDZA 4BRWA 3EIUA 3X1YA 5AVYA 1AVTA 1RFGE 2MYTA 2BFDB 2QVLA 4WBNA 2C61A 4HQRA 4URXR 3E58A 4Q3CA 3IB3A 1CKNA 2MQHA 2FEPA 4Q3OA 4JLNA 3MTDA 1NOJA 1M2KA 4LK1C 1KMQA 4ZYLA 4WCDA 1W0KD 3HRIA 5ICFA 1U0JA 1Z25A 1CJKC 1NKVA 2WYWA 2HRCA 1I7NA 1DGSA 1XRLA 3JYNA 2EE1A 3V7UA 1K27A 1P9WA 3AY3A 3I37X 1EY5A 3ES9A 5K7SA 2VNKA 4NZMA 3WLPA 5F2OA 5GTDA 2GXQA 3MXUA 5HE8A 3D0OA 1NXXA 2WUDA 4NFHA 4ZUIA 1XD8A 1BMDA 5FNVA 4BN4A 3I12A 4YCDA 2B8FA 2I3GA 2HPHA 1DD2A 4KLRA 1SCUB 1JU4A 1VJ0A 4IPHA 4O2AA 2O1SA 3RD5A 4ZVKA 3B3FA 1FQOA 1YC2A 3SJZA 5PGMA 2IELA 1H3EA 1L7AA 1IUPA 4MNTA 4BV3A 1SZCA 1WX1A 4MRNA 4MTNA 4HB0A 3JYOA 2LKDA 1RLTA 2AXNA 2YWGA 5ICMA 3B2EA 4GL4A 3CA8A 2JW5A 4E6PA 2DB3A 1UT8A 5AVZA 4J16A 2ZJPA 5F78A 4CM4B 2JAWA 4I1PA 4HBGA 2R60A 4JEUA 2P2YA 4JC8A 5L7TA 3IDZA 4IUNA 2DR2A 2BM0A 1E6EA 2QP9X 4YH1A 3DZKA 3GVCA 4R1PA 1WBBA 4H1HA 3V6LA 4UHKA 5K0GA 1R8YA 3UPDA 2R1UA 3K0AB 4H0LC 4BATA 1V3TA 2B5OA 1A72A 2OT3B 3OX4A 3K94A 4LZLA 4P3NA 3PIO3 1RBMA 1NONA 2H52A 1FS6A 4G36A 2WWTA 1D4AA 1ZITA 3O75A 1NUAA 5JI2E 1YVEI 2JEBI 2QIPA 3I6BA 2QLJA 3OAAA 4QJ4A 2FFAA 2TMPA 5G53C 3H0EA 1WL8A 3KOXA 2P6MA 5I9OA 4BQIA 1SD2A 4Q3NA 4H59A 2C2HA 1V11B 1LVHA 2C5HA 2DFVA 4GICA 3WIUA 2D0PB 4Q3LA 3K6SB 5IZCA 4XX0B 5LZ2A 4ZT7A 4HNRA 2JFQA 5AJXA 4RCYA 4L27A 2TSSA 2B4AA 5D5PA 4JGBA 1H6DA 4EY4A 1Q0LA 1ACJA 3GJ0A 1T5OA 4RTJA 2UVPA 3LYLA 2G9HD 1V6CA 4GXNA 3R77A 3DJAA 1CE8A 2FX3A 3OZUA 2G4VA 5HIKA 3KELA 4TTVA 4ALJA 3PO3G 4WXEA 3F6SA 4NMLA 5I7SA 4FVTA 3AETA 1T2VA 4A4IA 1KTVA 4PRLA 3CCRA 1PNVA 1WXFA 1YJXA 3QVWA 1HPLA 4N5HX 5ELCA 1MU0A 2IPXA 1E7SA 3EDOA 5JEAG 3KOOA 2PZTA 2QU7A 2WT9A 4EB3A 3VR0A 5IANA 3F3MA 5A4AA 3ZWCA 4CKCB 4CR6A 1DINA 1Z5VA 2IHKA 1N57A 5AJ3Q 4CNQA 2HXGA 3DSRA 1O9BA 4KGDA 2HBQA 2XMBA 1KJNA 5F7JA 3AR7A 3HVJA 1O3YA 3RRBA 1DB3A 2BFFA 1WUJS 3JTMA 5JRJA 1R50A 3FYDA 5JC1A 1KAWA 2EP5A 2ZM6Q 4L22A 3D4IA 3YASA 4Q93A 3K9FC 2DTEA 4L5JA 3H6KA 3SXUA 1P4GA 2I2BA 1EUDB 5EJEA 4HS4A 1BS1A 3AHIA 1Q2UA 2PPVA 1AXEA 1FBTA 4RTPA 1TJ4A 2NYAA 2PRIA 5BMVB 3EC1A 3KU1A 1JR3D 3NP9A 1IKMA 3DP7A 1QE0A 3E0EA 4KTAA 2Q45A 4Q16A 4EZIA 1YB7A 2WM8A 4PSCA 3OTQA 3AEKA 2YHSA 1TWHH 3EUFA 1XDWA 3WQBA 4X3SA 2F0WA 5HG0A 5E1BA 4F4UA 4QICA 4DR1B 2FCAA 3EVQA 2JC3A 1TQ6A 3JWGA 1JHOA 1T1GA 5FUMA 4P73A 4Z9AA 4B2IA 3CCSA 3T3IA 4LXIA 1CQIB 2AXQA 2OYRA 3M5DA 1PR6A 2EY2A 2JXMB 2RHQB 1QBKC 4A3GG 4G5GA 1W6JA 2EZ9A 3QOXA 1AX9A 4MVJH 3NBMA 3VR6A 1JIKA 4C1BA 2H1EA 2X0FA 3CZQA 4PNHA 1MP0A 2XNDA 2R47A 3U26A 4ID3A 4AC9A 2IYWA 3GB9A 2Q4EA 2PVCA 4X61A 2O3SA 4N8FA 1L1OC 5AM2A 2KHZA 3OQ1A 3IXMA 4EPVA 1WNTA 5G1OA 1CNEA 1OPRA 5JAMA 2IYYA 3AF3A 4EGJA 1M6VA 1OXXK 1BW9B 4FD3A 3K5HA 1XRMA 4AY5A 4PIMA 1A8VA 4IOKA 1PDOA 5H81A 1S01A 1BE8A 1SULA 3LO5A 1FXWF 2FSFA 1WKCA 1CHPD 1W9MA 2WAQB 1QO0D 2AR7A 3IPXA 2FQWA 2VTBB 1OGYA 5C32A 5I51A 1N6NA 4O63O 1VQ9A 3ZHBA 4EJFA 2ZAOA 4IDPA 4YT8A 2PQ0A 2VP2A 4XYGA 3UK2A 3IHAA 1K8MA 2C77A 3NHSA 2V55B 1HNWL 5CHEA 4I65A 5H5JA 1ZVKA 3EEFA 5T8KA 2ZS8A 1X9IA 4LK3A 4E08A 1Y0BA 3WGQA 1F2TB 3EIHA 2ZWIA 4QJFA 1CJCA 3L1IA 1E7MA 3KVYA 3FRHA 1BS2A 1R6VA 2JCBA 3M5CA 3KFUA 2QMQA 1WB9A 1E9RA 2ZKIA 3ZHVA 2JLRA 3FMIA 3W8RA 1F1JA 3SP1A 3TX6A 4HCJA 5CK5A 2WQ7A 2H4OA 2VWQA 3DP9A 2WFZA 4E5VA 3EA6A 5ITSA 5CDHA 2XXJA 1KAEA 5KB3A 2IJ0A 2FPIB 2DECA 3AG6A 3HUFA 1MT0A 3MCTA 4HUQA 5JAHA 4DR6L 4BMSA 4IUQA 3I9V1 3OJOA 1W85B 2YNMC 2GM9A 1LW7A 4YMIA 4E31A 2HRRA 3K31A 2XT6A 3QQPA 4CUZA 4BFCA 1GO3E 1F2UA 1IWBB 3M6VA 4R31A 1V4VA 3SLRA 4Q4HA 3U61B 2QJTA 4CIVA 4WNAB 5T4HA 1XZMA 3C3BA 3TLCA 1IEXA 1KK1A 5CNJA 2OCEA 3FGZA 1K28A 5JCJD 5DPMA 1P1IA 2DTXA 4C3UA 5LQCA 3FCOA 3MTEA 2PGDA 4CMEC 5IP9G 2BSAA 3WX0A 4LQ4A 4I66A 2ZDHA 4GZMA 3OT4A 3T9CA 2AR0A 2P79A 1UT5A 4MQ5A 1JHAA 1I5FA 4AZWA 1Z0JA 1X1CA 5C0XG 3UUWA 5FOUA 2W93A 3Q41A 4XPZA 1L7BA 4BY7G 4B44A 3ZCTA 5AHRA 1HX7A 1ZRMA 4FDMA 4YMSA 2VHCA 2SECE 3CO0S 3GFTA 2BT4A 1OAKA 3N2YA 2JSOA 3CE9A 2QMHA 4DSOA 3S1NB 3PC8C 4GKBA 3N2ZB 1TQ8A 2YN4A 4OIMA 4BNGA 3L0ZA 4FB5A 2CVRA 1KS9A 4ECAA 4RKLA 4JLAA 2LKVA 2B94A 1KVTA 5JZSA 3D7NA 2QPLA 4TPKA 2QMEA 1U2QA 4DCGA 3NHUA 1KJZA 1RQXA 1RTNA 4NAUA 4KN4C 5AK0A 4AP5A 2A6HC 3I42A 4MW0A 1V9PA 3B12A 2FZGA 5LVAA 5BVHB 2W71A 1DOAA 3BGVA 5DYTA 4L16A 1ELOA 4G85A 5I7EA 1JSLA 1V1JA 1BOSA 3E8MA 4MLCA 4QPDA 4DJEC 1P29A 3QVTA 3WLOA 2MCFA 2DXNA 4QM6A 4NYMQ 3LY7A 1Y1VH 4BNXA 4C5CA 1EP9A 5AWFC 1TUBB 5M3MH 3PLNA 2WAQG 3R2TA 3HCCA 3CB4A 3ONVA 1SUWA 5JD5A 1VGVA 5AUQA 5FPTA 3L8MA 3D9QX 2H2WA 4NK4A 3IPYA 4Z99A 1KFCB 4IQ4A 1J8YF 3WY9A 3ZDDA 1LC0A 4UTXA 4IH4A 3ZI7A 3C85A 4FB4A 3LLVA 4JI8L 1YZFA 1MDFA 4KX3A 2BHSA 2PCFB 3KTAB 2GBLC 2AMYA 3A2NA 3GAZA 2AUKA 4IJUA 5BQOA 5A9SA 4A8JC 4Q1FA 2R5WA 2VK8A 4MINA 4C5AA 1LQUA 2HT6A 1PFBA 2VB3X 1T4CA 1EI9A 2VTKA 5C1BA 2JA6G 1FUYB 4UDOA 2QGNA 5IZ4A 3L3BA 2GTIA 4H7FA 4ZIRA 2EERA 4BX2A 1QILA 2JAQA 3AKDA 2O8EA 1GRRA 1VP9A 2KENA 4GHNA 3LCRA 1KH2A 1S89A 4A82A 5B57C 2WE7A 3PC6A 2ZYRA 4RZIA 2WJJA 4JI3L 3GRAA 1JSXA 1YJAA 2HDMA 1FL9A 3T1TA 4NBNA 4XIYA 1P19A 1KC8C 2RARA 3RTCA 2AZDA 2PZMA 1T1EA 4YRZA 3W6UA 2EBHX 2R1TB 4RKFA 5H3HA 5J4YA 3OETA 2ZJZA 2WINB 1C3OA 1DC4A 1GSHA 3FCXA 2HX1A 3E5RA 1J5EQ 4C05A 1RRPA 4V3BA 1EIZA 2ID9A 5GINE 2TS1A 1U8EA 3Q0TA 5JUWA 1AURA 5JANA 3VQTA 3QBTA 2FPWA 2VQ6A 2FJ2A 2HIMA 2DFTA 2R5NA 1TDJA 3E23A 3IPAA 3V1LA 5C7IO 1NXOA 4ZUJA 1EFKA 3HDJA 4QBTA 3B9RA 2L42A 5GROA 5HGJA 1T2AA 1I3MA 2IYSA 2Y99A 5CB6A 3ANMA 2ZP1A 3KYCB 4CGYA 3VZBA 4EUEA 3AUXA 3SJCA 4IUTA 3OEYA 5C3WA 4X95A 4BCCA 1XDSA 1GPBA 5J1TB 3RJZA 2XMSA 2YFHA 4X8LA 1S5PA 3EQ9A 1DAMA 4M36A 1DZ3A 3DDNA 2ZRMA 1KY4A 3L79A 1UJ4A 1YZQA 5AVSA 1XCOA 1D0VA 1YAHA 1PWYE 4PYMA 5IMBA 4R5HA 1V0EA 1VF7A 4HDNA 1H8EA 3UYKA 2WV6D 2AI3A 1XJWA 4ZTBA 4JI5B 4OEMB 1OV6A 1OH6A 2NVWA 5CBEE 3MINA 1VKOA 1GEEA 5IM4A 3GNQA 1OE0A 1ECFA 3U7FB 4IF4A 1ZH4A 3K7AH 4X3KA 5JJZA 1ZG3A 1YMUA 2EJBA 1XKLA 1QV9A 4IHAA 3QMPA 4XCXA 3L7JA 3AZPA 4R1LA 4IQGA 3HXQA 5HCIA 1KVSA 3TL2A 1J2EA 2W00A 3LKZA 2W83A 5IAGA 1LDMA 2POCA 4YRPA 3DEFA 3P97A 1DPGA 3IFDA 2O50A 4YP5A 1ISHA 5DK6A 4G1CA 5HM8A 1VMEA 3FZYA 4L6TB 1YU6A 3ESYA 1O5TA 1E2GA 2A0YA 3DMTC 4MDEA 3OM9A 3B5JA 4KH1A 4QMGA 2P9CA 3VMMA 3M2PA 1ZQ9A 2QTVA 4A3KH 2NSYA 5A5EA 4OK6A 4UXHA 5TVKA 3U3OA 1Z6XA 5FWYB 1FU7A 5IJWA 5TXGA 1NTGA 2ACKA 4TTSA 5AXBA 1T4DA 2YVKA 1CU1A 1LVUA 3SNKA 4A3EB 3OI7A 4N9PA 1PYGA 5K0CA 2I7DA 4D45A 3LGAA 2IX0A 3A1SA 1OI7A 1QP7A 1AV6A 5DNFA 1K6XA 3P9CA 3LXUX 3SJUA 3WYAA 3PI7A 4WZAB 3FVVA 4JYAQ 4KQWA 2GDJA 3A6EA 4DMFA 2FMHA 5CH3A 1K66A 5IUNC 3GJXC 4ZANA 1DOKA 3LCUA 2QTMA 4KO1S 4DMGA 3OZTA 1KYZA 2C8LA 1CYEA 2NV2B 2YXEA 3COYA 1JE5A 4IHJB 1HYEA 1GOTA 3T4PA 4P3YA 3DC2A 1TCUA 4TS9A 4MB2A 1MB3A 2FHPA 3KL4A 3R7WA 1U5BB 3QVVA 4EI7A 2V9ZA 1WV0A 2O0KA 1G63A 3LUDA 2BKVA 2AIRA 2Y77A 3TW8B 5I3CA 2TMDA 3HU1A 3PLAE 2HTFA 3MXNA 5ERYA 3NBKA 1YZGA 1EAYA 1RIPA 3W8DA 4QUIA 3ROQA 3BPSA 2CF6A 1S2IA 4JI6L 1UZAA 1U7ZA 4LVCA 4Y9TA 3ZNQA 1SIBE 3TSCA 1DBQA 3G1WA 3KSAC 3D7MA 1SHUX 3LC0A 3DVAB 2YWXA 4QDJA 1G5PA 3MT9A 4QQNA 2ZXUA 3OESA 2CNWD 4B8WA 2IPLA 3HL0A 4Q3KA 1YFKA 2F0KA 5BSFA 2QPTA 2RGEA 3IESA 1DOMA 1PFUA 5ILOA 4LJ8A 3UNXA 3QY9A 3C3AA 4QYWA 2QT1A 5G41A 2JASA 3A3KA 3V2UA 4XD2A 3EH1A 3F6BX 2YQ4A 4FYJA 2KEDA 4KD4A 4QJ3A 1VA5A 2WE8A 2V5AA 3TNYA 2ZRIA 5SY4A 3W3AA 5FCDA 3KQTA 2VJNA 2UYOA 1A71A 5FLYA 4ARUA 5FLMH 1EHCA 4NLLA 2YZGA 3OZBA 1Z2DA 4LFAB 1R12A 3IRVA 2VYVA 2WP8J 5ELNA 4BA1I 2EW1A 3NIBA 1UBUS 1XZKA 3ZXXA 4YMTA 5EJ7A 3HJGA 4WIAA 2IL8A 3O03A 3L18A 2JFOA 5IGFA 4DCJA 5GJWC 1AKRA 1XZQA 1DT3A 3FGPA 3FYUA 5LQMA 1XNRB 3DYBA 1SFOB 2X0RA 3WLKX 5JMPA 2OWOA 2OF1A 4R2IA 3FTEA 4AFNA 4TVOA 1Y8ZA 4MI6A 2FHTA 3OF3A 2B37A 1T3LA 4D4GA 2YZ7A 5LJIA 3EF0A 3PQEA 1SYFA 3UXYA 3BSSA 1UXJA 2QKYA 2AE1A 5I9TA 3MIIA 5DVZA 2MIIA 3H42B 3GTGB 1OWOA 4RVGA 1FC0A 4F21A 4Z3OA 2J48A 1U8AA 5EXTA 1O6ZA 4RJ2A 3DLBA 1C41A 3OCWA 1IXYA 3U3DA 1KH1A 3QKRA 3WGIA 1EVJA 4YAOA 4ARBA 3O9VA 3LT4A 5J5VA 2DH6A 3ZU3A 2O8BA 2QUZA 4PRKA 3HRHA 1P5JA 2OSBA 1KI6A 1ZJ4A 5FPQA 4BXOB 4Y2YA 4UARA 1EKXA 2N0SA 1YR6A 2IQ5A 5F51A 1KE1A 3NUCA 1H9CA 4R2JA 4IDHA 3C3LA 4X85A 3BMCB 4FJ2A 5FF9A 2JLVA 5EUXA 3H11B 4LRSB 1UAYA 2ZXFA 3AIMA 5I01A 1FYXA 3E0JA 1RF2D 1QC5B 2AEMA 4KXQA 521PA 3GTKB 4FJ0A 3IMEA 2DUUA 1EU3A 1N6PA 1DG3A 3ERCA 3AKEA 2WVGA 3PXGA 4GE3A 3C8DA 1QYIA 4L7VA 2B4TO 3CCCA 3N76A 2W8ZA 2MDTA 1JHXA 4J2HA 1P6UA 5DNDA 3CW2A 4MYUA 4PLWA 2GRAA 1RSZA 1O7JA 2K5WA 1K8GA 4OOFA 5CFLA 2ZRJA 5IBCA 2WA1A 3GAFA 4NBWA 2BFEB 3Q7QA 3QLVA 2ORVA 4KDFA 1SN7A 1AJEA 4CMIB 1KO4A 3M1YA 2ZE6A 3REQB 2VYND 1W4ZA 5LQSA 1L2FA 3L05A 2YMQA 4FFSA 2ODEA 3EE6A 3WQRA 1P9RA 4L4XA 2JA7B 1PFVA 1XCMA 4D8VA 4ZEOA 4AYBG 2WZQA 4XIFA 1FZTA 4FF2A 1FBNA 3JQAB 1P4SA 1CT1D 4YJGB 1ZONA 3SIXA 1CJMA 4GMGA 2OM2A 1XTUA 3RFUA 3AEXA 4BX8A 4P80A 4DQKA 2X3YA 2R6GA 1O94A 4LMBA 4Z1OA 5JBQA 4KOAA 3WADA 4Q1BA 1NV8A 1DFHA 3BTUA 3GTLB 2YU9B 3T0FA 3AHGA 4YR7A 1NR7A 4C3IB 3HKBB 4IOMA 4HYEA 3IAM1 3TS1A 4DGQA 2UZ1B 3KM0A 1ENCA 4AB1A 1NBIA 1L5HA 2A74C 1JIXA 1OLUB 1W44A 3O7WA 3LCJA 221PA 4CU2A 3L8ZA 4M55A 3P0IA 1THGA 2ZZNA 2FQXA 1EY0A 3JAKB 1TKWB 5FOBB 4AQYQ 2FSIA 2VY3A 3MOIA 5BWNA 4ZCIA 2NX2A 5T5QA 3O7MA 3FIJA 3WGGA 4JIGA 3ZE8A 2GDZA 2W58A 1LF0A 2JKZA 2WFLA 1BKSB 1F4LA 1T4BA 3H91A 2FSVC 4Q24A 2VP4A 1WQ1R 2A5GA 4LBWA 3BVPA 3VHXB 3ZY6A 4RK7A 1H9SB 1EL0A 4PYNA 3TQTA 4NCBA 4ZYSA 5EPJA 4MRPA 1DBPA 2M9MA 3PQ8A 4HG2A 4NS4A 1RBYA 1EWRA 3B53X 1ABFA 5CM2Z 2XA1A 3MTIA 2VXYA 1J2JA 4MYCA 4KQFA 5ALPA 4I5FA 1T6XA 1CZLA 2YNMD 3BE6A 3VDQA 5EE1A 3AF2A 1FRQA 4DMKA 2LWIA 2E5LL 2ID4A 1M5TA 5E8JA 2J08A 4D79A 3FMOB 3EW7A 4R9SA 2RG1A 3NJRA 3OCZA 3TIFA 4UHJA 3FMPB 3UH1A 4MKXA 2PMWB 4RGQA 1EYZA 2FN3A 4B9XA 2IIQA 2MYNA 4ZZ3A 2HA5A 2EWMA 4YBZA 3W8NA 2RRLA 3MMXA 5D6OA 4LF4Q 1BYIA 2FWBA 4BXXH 4UVHA 1CB7A 1QE3A 1CVRA 4DKAC 3LUCA 5BSMA 3O8QA 1W34A 3VRHA 1VKZA 4L5AA 1XI2A 1MO6A 1XWIA 4KNYA 1N8SA 2EYQA 3JD1A 1LS6A 2I5MX 4EM6A 1ZJ5A 1UMDB 3COWA 2EVWX 4A26A 5IARA 1RE1A 3RG8A 4TTTS 3PQ7A 3M5PA 2DCUA 5I2XA 2UUAB 2GJKA 3JD3A 4NOLA 2PPBC 4LDQA 4G0MA 1WULS 1O5OA 3KOMA 5HGXA 4HGPA 1BXTA 4EPXA 3BTVA 5IAAA 1DXYA 1WQ4A 5AW1A 3FNQA 1I0LA 3F2CA 1QIDA 3UT0A 3QWHA 5TPWB 4DA2A 4IUDS 3OD1A 1EGHA 2RKBA 3L7ZC 3VFDA 3I1IA 1DG1G 1ZAYA 2RSLA 5IT0A 3WMWA 4ISBA 2C96A 2A6HD 3DV0B 3R3HA 1HZAA 5IY0A 2W2TA 1YZHA 4TWBA 1EXVA 4OFZA 2OLKA 2F0JA 1U1DA 3G0GA 4RV5A 4TQAA 2GILA 2ES4A 3G4SA 2REQA 4ENWA 1R00A 3W5JA 2E18A 1I8TA 3KKZA 1EE9A 5DN6A 4FIZA 5JZOA 2A0XA 2N3ZA 4DSZA 1HDXA 2JHFA 3RDPA 4QTZA 4H1TA 1G9XA 1RJEA 1P8AA 5CDSA 3TFWA 5AT1A 4KHZA 4D0GA 4D44A 4C0LA 1LV8A 2X3UA 4JQCA 1X3EA 3N74A 2A92A 3EN0A 5EVJA 2R92B 2H08A 4UU0A 4TT3A 1U2TA 4C3IG 5C81A 2DTDA 4ZVNA 5CMDA 1IUNA 4H13C 5A1JA 3ZU6A 2OBLA 1TO1E 4KG7A 1V3QE 2FN7A 4C76A 2C2MA 5DULA 2PUWA 3PNLA 4B3XA 3AOEC 1R0RE 1P45A 2VUSA 3CZ4A 4FDUA 4XSGA 3VR5D 3DXYA 2E2HB 1C7EA 3IE2A 2XECA 4PNEA 1MG5A 4HJXA 2R61A 4RK6A 2C88A 4IQ8A 5D3IB 1DAIA 3UWKA 3GVKA 4RPJA 4JVSB 3DBOB 5FO8B 2AH5A 4A8TA 3G2IA 2JQOA 2BEWA 5JZVA 2VPIA 4JI4Q 5EWMA 1SPBS 3R20A 3IUSA 1DX4A 3V34A 2BE7A 1CY2A 1A69A 5GVRA 3QEOA 1UM9A 2JHGA 4ZYVA 1RPJA 4QREA 1L3BA 1CHQD 3KJIA 4K6KA 1RI3A 1BKDR 4PBRA 3GEBA 4Q9KA 2PT5A 3RW9A 1X42A 1JFFA 2NQ2C 3MJEA 2DBYA 3BXXA 1L7QA 2H6EA 1AKQA 1XQXA 3AT1A 1I0ZA 5IT9L 2IDJA 1PE0A 4GNKA 5K0ZA 4BBSG 2WM3A 1W8IA 1GA1A 2NU8B 4DTCA 3HUEA 1R5OA 3ENNA 4GNXA 1T5LA 1RWOA 4F3KA 1D2BA 1T5EA 3MRXA 2E8GA 2EYHA 3C2PA 4BQOA 4OX9Y 1XN4A 2H5IA 2OBMA 3ILXA 4KXNA 2C20A 2VSYA 3W2TA 2PZAA 3Q8MA 1N1DA 2A6EC 1XVUA 2FEXA 3UGJA 3KBOA 4AKGA 5I47A 4A0RA 1JHYA 4ZV9A 1O6FA 1C9YA 3L77A 3BM5A 1KXJA 1ST3A 2OFFA 3GR6A 1X1BA 2GCPA 6YASA 3EVFA 4H31A 3KYJB 3QEKA 1IQ0A 1POXA 3DEIA 3TZQA 1ADJA 3FD8A 4MRMA 1DKOA 4HAIA 1SKUA 3OH8A 3VTFA 1HEIA 4ZC1A 1Z38A 5FOVA 2CLMB 3FHTA 2IVZA 2B99A 1JSRA 1V5FA 3IUMA 3CV3A 2PS9A 1UMKA 5F1PA 2YICA 4PQRA 2QD1A 4ZKDA 4H0NA 5IAJA 1L0YB 4CDCC 2W48A 1ABBA 4RNCA 5LKAA 2G83A 1Q77A 3UKJA 4JMLA 3KJHA 2NSHA 1MVOA 2I2WA 2HCCA 2BRUA 4I4TA 2G5CA 3OQOA 1L5FA 1AM4D 1DXOA 3DFKA 2HGSA 2HQSA 1X1TA 1JA1A 2JLUA 1JYSA 4Q0FA 4LISA 2OXTA 1UEJA 5DX8A 4EDHA 4TYQA 2I67A 2ZJ4A 2OP0A 2YW2A 1H4TA 1BXRB 1S02A 5DBHX 3VC1A 1FC9A 2HEIA 3CH5A 4FILA 3RS9A 1YDWA 1QIMA 1QX3A 4PGGA 2GAOA 5KYNA 3T7EA 2VRBA 1X14A 4W8GA 3RVOA 1YNNC 4O4IF 2A9RA 1DUSA 3H2GA 1P2UA 4LF5L 2QI9F 5FO0A 1EBFA 2UU9B 1VMPA 3T1VA 1ZH0A 1HDCA 4MS1B 2PSSA 3IHWA 4MEJA 3B9PA 1P4RA 3IOBA 1B8PA 2D3TA 4J75A 2KM1A 4OUDB 1NR4A 1OT3A 3OJXA 3EN2A 4P7KA 2ZZMA 4YXWA 3V8MA 2JFGA 1JAYA 1HJPA 3CSUA 3M9XA 5LL6X 4RTNA 1K0SA 5JZMA 1TTQB 4N3GA 1SBNE 2AUNA 5DM70 2CEAA 3RUAA 3AJRA 1SZDA 3E82A 1W4CA 3IE1A 4I5DA 3GT4A 5LZ5A 1QS0A 1KVQA 3OFNA 3VR4H 1BEEA 4MN3A 2MSNA 4GU5A 3ZYZA 1DTWB 1U7TA 4YPVA 3TQSA 2XGGA 1J20A 2Y27A 1WPRA 1XMQQ 4XB6B 1NA5A 2Z30A 3I4MB 1ZC4A 1P2TA 3FPAA 3ZNOA 1QNKA 2QZPA 2CXXA 1E61A 2YOFA 5DW0A 1T43A 4R8SA 1T1JA 1XROA 2AYXA 3IAEA 4KAFA 3KLOA 4FYVA 2A68C 4OHKA 1QUEA 1NTOA 1V4NA 4WLUA 4H7PA 1L4LA 5DM2A 4FMCB 1ZO8A 3PUWA 2BBTA 5BR4A 3IBSA 2WHQA 2PNJA 2B8NA 3ZH2A 2DEUA 1EFRD 1J0XO 4ABTA 2V9PA 4KOEC 3SQLA 1Z0FA 3OZVA 3WQSB 3VC2A 1ZWKA 3IEXA 4RD0A 4ICIA 2QEJC 3L7AA 1KQGA 1T6RA 2XE4A 1J39A 3KOYA 1WD7A 2LSSA 3PFWO 4NXML 9GPBA 5IKPA 2B9VA 1PFQA 2PW7A 3R4VA 2JBWA 3PA6A 4JYMA 4UEJA 3KYHC 4X91A 3K59A 3GUZA 2EXXA 1BJRE 4E88A 4C6TA 2A88A 3PE6A 5BN5A 3BAZA 4KW7A 3UA4A 5TRTA 3J7YW 3MC1A 1Q86C 3ICCA 2B2WC 2YFKA 5JFGA 1J2UA 5D84A 3TIXB 2PZLA 3U4CA 3CKMA 5K01A 1QOHA 1K4MA 2NVYH 4TLDA 4JA2A 2O5CA 2BFNA 4R16A 4WQMA 4X62B 1HNXL 4L76A 3L4BA 1GCOA 4C7KA 1EQVA 3PF5A 1MOSA 1PK7A 4DADA 4OYHA 4ZRMA 2AQ1B 3H1BA 3NTLA 4JS0A 2KA7A 4PG6A 3G88A 3CPJB 2LW7A 4BQFA 3ZXUB 3S1LA 4YGXB 3LUAA 2YIDA 1YHNA 3PEEA 2HSGA 3KB6A 3U62A 3T1YB 4OH1A 2WTUA 4DILA 2JPDA 4Q1AA 3HKZG 2O1XA 4ANFA 1SBYA 5IKXA 4UDNA 1VMCA 3UJPA 2IFTA 1S2GA 4E1BA 2GZ1A 1E7QA 1XMOB 1FQWA 2WG2A 3C3MA 3IQHX 1J5PA 5FX2A 4N0MA 1JQYD 1AHHA 4XWYA 3RS2A 4LQCA 2PY6A 3GUCA 1WE2A 2GZSA 1TKBA 2H4HA 1TMGE 5JLJA 3RBXA 5EKDA 2A7XA 5KX5B 2PW5A 3PR3A 3EF1A 1N34Q 4MMYB 4H77A 1EXMA 1JIIA 5K8LA 3GJYA 3E4DA 3DLAA 4YB8A 1ET9A 3U7HB 3LUHA 1PH4A 3UJ8A 2R7FA 4IINA 4TZ0A 1RYDA 4UBLA 2OMEA 2P1RA 1STAA 4RMHA 5A3QA 4TRDA 4NOMA 4ACBA 5AVKA 4MA4A 3FR7A 1NVVQ 1Z4JA 1QSGA 1DWOA 4Y6QA 1RE0A 5B12A 5A4IS 3THXA 1PYSB 2JLXA 5K0TA 1FP7A 3H8VA 3CVYA 3GDEA 5FWAA 4WNIA 2HADA 1CZGA 3CNNA 5GJVC 1EOTA 3TW6A 1DKQA 1E3MA 5ABPA 1EWYA 1VQIA 3PCXA 5CV9A 3C5VA 2ZRNA 2NUAB 3UDGA 4MGYR 3THOA 1NBWB 4I5IA 3TSYA 4R8KA 3JQ8A 5E4YA 3C8MA 4AIRA 2PA0A 3MB8A 3THSA 3NMUF 4WXMA 4BBAA 1VE9A 4YRDA 4DMCA 2PUHA 3B6MA 3BZWA 1VRCA 5T64A 2EX0A 1AHPA 2ZYWX 2QYOA 1RLMA 1HLGA 4F8YA 4OHOA 5TY0A 4CQJA 2HDHA 3ZYYX 2EDAA 2JGDB 1WTVA 4RKWA 5ALTA 3VVCA 4QDKA 3W6ZA 4GLAC 4EY7A 4R05A 3CF2A 3RRZA 3SHWA 4BUZA 3QU5A 5BNIA 2FA9A 4LCJA 3NVMB 1K5PA 3JARA 1D1TA 3ENKA 3OZ7A 3VDNB 3AERB 3NT2A 3ZQ4A 4LY0A 4CEIA 2AW3A 1B43A 1H9RA 5EUBA 4AZ3A 1LI5A 2BD0A 4U02A 1MX5A 3NVAA 4PSUA 5B1SA 5IN4A 4G0UA 5TPZA 3A70A 3USES 3FPHA 2W6OA 4DMRA 2UZ4A 1E94E 1DC3A 1FRZA 3PENA 1CUDA 4L0QA 4AH6A 1WM1A 2R93G 1SE8A 1CZWA 1PNOA 4HSGA 3RAPR 4AYXA 1H2ZA 4GIBA 3HRKA 5AKLA 1XXHA 4H6WA 1V1MA 3VYVA 1K9VF 1USGA 4PAWA 1IIRA 3HOYG 1Y8OB 4Q4JA 4TRJA 4H7DA 2OORC 3VHQA 2HBRA 2Q0SA 1P1FA 1Y6ZA 1IM2A 5LXTB 1MX3A 4PGMA 4TLMB 3A8IE 2REOA 4PW0A 4TSFD 4R7TA 2OKGA 1HYHA 2FOLA 1Z7WA 4IQZA 1TMKA 3GLIA 4JI0L 4R1JA 5BWCA 2YCBA 3GLTA 3B8EA 2P6NA 4X65Q 4HFNA 2YMMA 4XWKA 4BLVA 4OJMX 1Y6RA 2H7CA 4CNBA 5FDFA 4FGUA 3M85A 2YJGA 3MN1A 1F8XA 2KBFA 2IA5A 4R7GA 4AY3A 1NI4B 3JRNA 3O8BA 4J07A 2F67A 5LP6B 2V6IA 5IC5A 1ZW6A 1AY0A 3JZDA 1SG9A 4L8LA 9MHTA 3M6XA 3K4QA 1GUZA 5GJBA 3PXCX