2VY9A

Molecular architecture of the stressosome, a signal integration and transduction hub
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
PILKVDDYWVVAIEETLHDQSVIQFKEELLHNITGVAGKGLVIDISALEVVDSFVTRVLIEISRLAELLGLPFVLTGIKPAVAITLTEMGLDLRGMATALNLQKGLDKLKNLARM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-SIGMA-FACTOR ANTAGONIST
publication title Molecular Architecture of the "Stressosome," a Signal Integration and Transduction Hub
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Gene regulation
total genus 35
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 2vy9A00
5EUSA 3F43A 3AGEA 3IHAA 1BUZA 3LKLA 2KA5A 1SBOA 5EZBA 1H4YA 4DGHA 1H4ZA 3LLOA 5EUZA 1AUZA 1TILB 2KLNA 3OIRA 5EUUA 4QTPA 1T6RA 3T6OA 3IHBA 2VY9A 3MGLA 3OIZA 4HYLA 3ZTBA 1TIDB 4DGFA 1VC1A 3ZXNA 3IF5A 5EUXA 1H4XA 3IH9A 3AGDA 3IH8A 4XS5A 1THNB 3NY7A 5EUWA 1TH8B
chains in the Genus database with same CATH superfamily
4AEJA 4L1CA 1V0EA 3AGEA 3IHAA 4DMGA 3LKLA 3D3UA 5EZBA 1AUZA 1J7XA 3V97A 1N6EA 2ZOAA 3GVKA 1FC9A 4HYLA 4L8KA 1VC1A 3ZXNA 2ZO9B 3IF5A 2AS0A 3GVLA 3D03A 5EUWA 3F43A 3V8VA 2DXNA 3C0KA 1N6FA 1TILB 3EH7A 5EUUA 3DORA 2OASA 3GMFA 3OIZA 3ZTBA 3DJAA 1V0FA 4AE2A 1H4XA 3AGDA 3IH8A 3NY7A 1HF2A 4GHNA 3K50A 1K32A 3MOGA 2B78A 1BPLA 1H4ZA 3LLOA 2DXLA 2KLNA 3OIRA 3JU4A 2RRLA 1T6RA 3T6OA 1TIDB 3IH9A 3QDQA 4JC0A 3VSEA 1FC6A 5EUSA 3GVJA 1BUZA 3LDFA 2KA5A 2CWWA 1SBOA 1H4YA 1N6DA 5EUZA 4DGHA 4QTPA 1WXWA 3IHBA 2VY9A 1WXXA 3GHFA 1FCFA 3MGLA 4DGFA 3GK7A 5EUXA 4XS5A 1THNB 4HIZA 3DUPA 1FC7A 1TH8B
chains in the Genus database with same CATH topology
5EUSA 3F43A 3AGEA 3IHAA 1BUZA 3LKLA 2KA5A 1SBOA 5EZBA 1H4YA 4DGHA 1H4ZA 3LLOA 5EUZA 1AUZA 1TILB 2KLNA 3OIRA 5EUUA 4QTPA 1T6RA 3T6OA 3IHBA 2VY9A 3MGLA 3OIZA 4HYLA 3ZTBA 1TIDB 4DGFA 1VC1A 3ZXNA 3IF5A 5EUXA 1H4XA 3IH9A 3AGDA 3IH8A 4XS5A 1THNB 3NY7A 5EUWA 1TH8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EUS A;  3F43 A;  3AGE A;  3IHA A;  1BUZ A;  3LKL A;  2KA5 A;  1SBO A;  5EZB A;  1H4Y A;  4DGH A;  1H4Z A;  3LLO A;  5EUZ A;  1AUZ A;  1TIL B;  2KLN A;  3OIR A;  5EUU A;  4QTP A;  1T6R A;  3T6O A;  3IHB A;  2VY9 A;  3MGL A;  3OIZ A;  4HYL A;  3ZTB A;  1TID B;  4DGF A;  1VC1 A;  3ZXN A;  3IF5 A;  5EUX A;  1H4X A;  3IH9 A;  3AGD A;  3IH8 A;  4XS5 A;  1THN B;  3NY7 A;  5EUW A;  1TH8 B; 
#chains in the Genus database with same CATH topology
 4AEJ A;  4L1C A;  1V0E A;  3AGE A;  3IHA A;  4DMG A;  3LKL A;  3D3U A;  5EZB A;  1AUZ A;  1J7X A;  3V97 A;  1N6E A;  2ZOA A;  3GVK A;  1FC9 A;  4HYL A;  4L8K A;  1VC1 A;  3ZXN A;  2ZO9 B;  3IF5 A;  2AS0 A;  3GVL A;  3D03 A;  5EUW A;  3F43 A;  3V8V A;  2DXN A;  3C0K A;  1N6F A;  1TIL B;  3EH7 A;  5EUU A;  3DOR A;  2OAS A;  3GMF A;  3OIZ A;  3ZTB A;  3DJA A;  1V0F A;  4AE2 A;  1H4X A;  3AGD A;  3IH8 A;  3NY7 A;  1HF2 A;  4GHN A;  3K50 A;  1K32 A;  3MOG A;  2B78 A;  1BPL A;  1H4Z A;  3LLO A;  2DXL A;  2KLN A;  3OIR A;  3JU4 A;  2RRL A;  1T6R A;  3T6O A;  1TID B;  3IH9 A;  3QDQ A;  4JC0 A;  3VSE A;  1FC6 A;  5EUS A;  3GVJ A;  1BUZ A;  3LDF A;  2KA5 A;  2CWW A;  1SBO A;  1H4Y A;  1N6D A;  5EUZ A;  4DGH A;  4QTP A;  1WXW A;  3IHB A;  2VY9 A;  1WXX A;  3GHF A;  1FCF A;  3MGL A;  4DGF A;  3GK7 A;  5EUX A;  4XS5 A;  1THN B;  4HIZ A;  3DUP A;  1FC7 A;  1TH8 B; 
#chains in the Genus database with same CATH homology
 5EUS A;  3F43 A;  3AGE A;  3IHA A;  1BUZ A;  3LKL A;  2KA5 A;  1SBO A;  5EZB A;  1H4Y A;  4DGH A;  1H4Z A;  3LLO A;  5EUZ A;  1AUZ A;  1TIL B;  2KLN A;  3OIR A;  5EUU A;  4QTP A;  1T6R A;  3T6O A;  3IHB A;  2VY9 A;  3MGL A;  3OIZ A;  4HYL A;  3ZTB A;  1TID B;  4DGF A;  1VC1 A;  3ZXN A;  3IF5 A;  5EUX A;  1H4X A;  3IH9 A;  3AGD A;  3IH8 A;  4XS5 A;  1THN B;  3NY7 A;  5EUW A;  1TH8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...