2VY9A

Molecular architecture of the stressosome, a signal integration and transduction hub
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
PILKVDDYWVVAIEETLHDQSVIQFKEELLHNITGVAGKGLVIDISALEVVDSFVTRVLIEISRLAELLGLPFVLTGIKPAVAITLTEMGLDLRGMATALNLQKGLDKLKNLARM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords ANTI-SIGMA-FACTOR ANTAGONIST
publication title Molecular Architecture of the "Stressosome," a Signal Integration and Transduction Hub
pubmed doi rcsb
source organism Moorella thermoacetica
total genus 35
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 2vy9A00
3ZXNA 3IHBA 1H4ZA 5EUXA 3AGEA 1TILB 1BUZA 4QTPA 5EUSA 3T6OA 5EUWA 5EUUA 2KA5A 1T6RA 1TIDB 3LKLA 3OIRA 5EZBA 3OIZA 1VC1A 3MGLA 2KLNA 3LLOA 3NY7A 5EUZA 4DGHA 3IH8A 3ZTBA 1H4YA 4DGFA 3IHAA 3IH9A 4HYLA 3AGDA 3IF5A 1SBOA 2VY9A 1THNB 4XS5A 1TH8B 1H4XA 1AUZA 3F43A
chains in the Genus database with same CATH superfamily
1FC9A 3ZXNA 1K32A 3IHBA 3D03A 1J7XA 3GVLA 1WXWA 3T6OA 2RRLA 2DXLA 3LKLA 3GVJA 5EZBA 2B78A 3D3UA 1HF2A 2DXNA 1H4YA 3AGDA 2VY9A 3V8VA 1THNB 1TH8B 2AS0A 4GHNA 4AE2A 2ZOAA 1TILB 3JU4A 3QDQA 3GMFA 1T6RA 1VC1A 3K50A 3LLOA 3IH8A 3MOGA 1BPLA 4HYLA 3IF5A 1AUZA 3F43A 4L1CA 3V97A 1FCFA 3AGEA 4L8KA 2CWWA 3GK7A 1BUZA 1V0FA 4QTPA 3DJAA 5EUWA 5EUUA 2KA5A 1WXXA 1TIDB 3OIRA 3OIZA 3MGLA 3VSEA 1N6EA 3NY7A 4DGHA 3ZTBA 3LDFA 3GVKA 4XS5A 3DORA 1H4XA 1N6DA 1H4ZA 4HIZA 5EUXA 3DUPA 2OASA 3GHFA 3EH7A 5EUSA 4AEJA 1V0EA 3C0KA 1FC7A 4JC0A 2KLNA 5EUZA 4DMGA 1FC6A 4DGFA 3IHAA 3IH9A 1SBOA 1N6FA 2ZO9B
chains in the Genus database with same CATH topology
3ZXNA 3IHBA 1H4ZA 5EUXA 3AGEA 1TILB 1BUZA 4QTPA 5EUSA 3T6OA 5EUWA 5EUUA 2KA5A 1T6RA 1TIDB 3LKLA 3OIRA 5EZBA 3OIZA 1VC1A 3MGLA 2KLNA 3LLOA 3NY7A 5EUZA 4DGHA 3IH8A 3ZTBA 1H4YA 4DGFA 3IHAA 3IH9A 4HYLA 3AGDA 3IF5A 1SBOA 2VY9A 1THNB 4XS5A 1TH8B 1H4XA 1AUZA 3F43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZXN A;  3IHB A;  1H4Z A;  5EUX A;  3AGE A;  1TIL B;  1BUZ A;  4QTP A;  5EUS A;  3T6O A;  5EUW A;  5EUU A;  2KA5 A;  1T6R A;  1TID B;  3LKL A;  3OIR A;  5EZB A;  3OIZ A;  1VC1 A;  3MGL A;  2KLN A;  3LLO A;  3NY7 A;  5EUZ A;  4DGH A;  3IH8 A;  3ZTB A;  1H4Y A;  4DGF A;  3IHA A;  3IH9 A;  4HYL A;  3AGD A;  3IF5 A;  1SBO A;  2VY9 A;  1THN B;  4XS5 A;  1TH8 B;  1H4X A;  1AUZ A;  3F43 A; 
#chains in the Genus database with same CATH topology
 1FC9 A;  3ZXN A;  1K32 A;  3IHB A;  3D03 A;  1J7X A;  3GVL A;  1WXW A;  3T6O A;  2RRL A;  2DXL A;  3LKL A;  3GVJ A;  5EZB A;  2B78 A;  3D3U A;  1HF2 A;  2DXN A;  1H4Y A;  3AGD A;  2VY9 A;  3V8V A;  1THN B;  1TH8 B;  2AS0 A;  4GHN A;  4AE2 A;  2ZOA A;  1TIL B;  3JU4 A;  3QDQ A;  3GMF A;  1T6R A;  1VC1 A;  3K50 A;  3LLO A;  3IH8 A;  3MOG A;  1BPL A;  4HYL A;  3IF5 A;  1AUZ A;  3F43 A;  4L1C A;  3V97 A;  1FCF A;  3AGE A;  4L8K A;  2CWW A;  3GK7 A;  1BUZ A;  1V0F A;  4QTP A;  3DJA A;  5EUW A;  5EUU A;  2KA5 A;  1WXX A;  1TID B;  3OIR A;  3OIZ A;  3MGL A;  3VSE A;  1N6E A;  3NY7 A;  4DGH A;  3ZTB A;  3LDF A;  3GVK A;  4XS5 A;  3DOR A;  1H4X A;  1N6D A;  1H4Z A;  4HIZ A;  5EUX A;  3DUP A;  2OAS A;  3GHF A;  3EH7 A;  5EUS A;  4AEJ A;  1V0E A;  3C0K A;  1FC7 A;  4JC0 A;  2KLN A;  5EUZ A;  4DMG A;  1FC6 A;  4DGF A;  3IHA A;  3IH9 A;  1SBO A;  1N6F A;  2ZO9 B; 
#chains in the Genus database with same CATH homology
 3ZXN A;  3IHB A;  1H4Z A;  5EUX A;  3AGE A;  1TIL B;  1BUZ A;  4QTP A;  5EUS A;  3T6O A;  5EUW A;  5EUU A;  2KA5 A;  1T6R A;  1TID B;  3LKL A;  3OIR A;  5EZB A;  3OIZ A;  1VC1 A;  3MGL A;  2KLN A;  3LLO A;  3NY7 A;  5EUZ A;  4DGH A;  3IH8 A;  3ZTB A;  1H4Y A;  4DGF A;  3IHA A;  3IH9 A;  4HYL A;  3AGD A;  3IF5 A;  1SBO A;  2VY9 A;  1THN B;  4XS5 A;  1TH8 B;  1H4X A;  1AUZ A;  3F43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...