2VY9A

Molecular architecture of the stressosome, a signal integration and transduction hub
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
b'PILKVDDYWVVAIEETLHDQSVIQFKEELLHNITGVAGKGLVIDISALEVVDSFVTRVLIEISRLAELLGLPFVLTGIKPAVAITLTEMGLDLRGMATALNLQKGLDKLKNLARM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-SIGMA-FACTOR ANTAGONIST
publication title Molecular Architecture of the "Stressosome," a Signal Integration and Transduction Hub
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Gene regulation
total genus 35
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 2vy9A00
3NY7A 2KA5A 1BUZA 3IH9A 4XS5A 1T6RA 3AGDA 4HYLA 1H4ZA 1THNB 4DGHA 3ZXNA 2VY9A 1TH8B 5EZBA 3AGEA 3LKLA 3IF5A 1H4XA 1TIDB 3IH8A 3F43A 3LLOA 3MGLA 3T6OA 1AUZA 5EUZA 2KLNA 1TILB 5EUWA 1SBOA 4DGFA 3OIZA 5EUXA 5EUSA 3OIRA 5EUUA 4QTPA 1VC1A 3ZTBA 1H4YA 3IHAA 3IHBA
chains in the Genus database with same CATH superfamily
1FCFA 3IH9A 3GVKA 1T6RA 3C0KA 4DGHA 3ZXNA 2VY9A 3AGEA 1H4XA 3MGLA 4DGFA 5EUSA 1FC6A 4QTPA 3IHBA 3GHFA 3D03A 1V0FA 3DJAA 1WXXA 4XS5A 3AGDA 2RRLA 4DMGA 3V97A 2DXNA 3GK7A 5EZBA 3T6OA 1TIDB 4AEJA 1V0EA 2KLNA 4L8KA 3OIZA 4L1CA 1H4YA 3JU4A 3NY7A 2KA5A 1BUZA 2ZOAA 4HIZA 1THNB 3DORA 1TH8B 1BPLA 3IF5A 3GMFA 3LLOA 3F43A 4AE2A 5EUZA 1WXWA 3GVLA 4JC0A 1SBOA 2OASA 1K32A 5EUXA 3MOGA 3OIRA 5EUUA 3ZTBA 3IHAA 3VSEA 3QDQA 2ZO9B 1N6EA 1J7XA 3EH7A 3D3UA 3GVJA 4HYLA 2AS0A 1H4ZA 3LKLA 1N6DA 1HF2A 1FC9A 3IH8A 4GHNA 1AUZA 3LDFA 1TILB 2B78A 3K50A 5EUWA 1FC7A 3V8VA 2DXLA 2CWWA 1VC1A 3DUPA 1N6FA
chains in the Genus database with same CATH topology
3NY7A 2KA5A 1BUZA 3IH9A 4XS5A 1T6RA 3AGDA 4HYLA 1H4ZA 1THNB 4DGHA 3ZXNA 2VY9A 1TH8B 5EZBA 3AGEA 3LKLA 3IF5A 1H4XA 1TIDB 3IH8A 3F43A 3LLOA 3MGLA 3T6OA 1AUZA 5EUZA 2KLNA 1TILB 5EUWA 1SBOA 4DGFA 3OIZA 5EUXA 5EUSA 3OIRA 5EUUA 4QTPA 1VC1A 3ZTBA 1H4YA 3IHAA 3IHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NY7 A;  2KA5 A;  1BUZ A;  3IH9 A;  4XS5 A;  1T6R A;  3AGD A;  4HYL A;  1H4Z A;  1THN B;  4DGH A;  3ZXN A;  2VY9 A;  1TH8 B;  5EZB A;  3AGE A;  3LKL A;  3IF5 A;  1H4X A;  1TID B;  3IH8 A;  3F43 A;  3LLO A;  3MGL A;  3T6O A;  1AUZ A;  5EUZ A;  2KLN A;  1TIL B;  5EUW A;  1SBO A;  4DGF A;  3OIZ A;  5EUX A;  5EUS A;  3OIR A;  5EUU A;  4QTP A;  1VC1 A;  3ZTB A;  1H4Y A;  3IHA A;  3IHB A; 
#chains in the Genus database with same CATH topology
 1FCF A;  3IH9 A;  3GVK A;  1T6R A;  3C0K A;  4DGH A;  3ZXN A;  2VY9 A;  3AGE A;  1H4X A;  3MGL A;  4DGF A;  5EUS A;  1FC6 A;  4QTP A;  3IHB A;  3GHF A;  3D03 A;  1V0F A;  3DJA A;  1WXX A;  4XS5 A;  3AGD A;  2RRL A;  4DMG A;  3V97 A;  2DXN A;  3GK7 A;  5EZB A;  3T6O A;  1TID B;  4AEJ A;  1V0E A;  2KLN A;  4L8K A;  3OIZ A;  4L1C A;  1H4Y A;  3JU4 A;  3NY7 A;  2KA5 A;  1BUZ A;  2ZOA A;  4HIZ A;  1THN B;  3DOR A;  1TH8 B;  1BPL A;  3IF5 A;  3GMF A;  3LLO A;  3F43 A;  4AE2 A;  5EUZ A;  1WXW A;  3GVL A;  4JC0 A;  1SBO A;  2OAS A;  1K32 A;  5EUX A;  3MOG A;  3OIR A;  5EUU A;  3ZTB A;  3IHA A;  3VSE A;  3QDQ A;  2ZO9 B;  1N6E A;  1J7X A;  3EH7 A;  3D3U A;  3GVJ A;  4HYL A;  2AS0 A;  1H4Z A;  3LKL A;  1N6D A;  1HF2 A;  1FC9 A;  3IH8 A;  4GHN A;  1AUZ A;  3LDF A;  1TIL B;  2B78 A;  3K50 A;  5EUW A;  1FC7 A;  3V8V A;  2DXL A;  2CWW A;  1VC1 A;  3DUP A;  1N6F A; 
#chains in the Genus database with same CATH homology
 3NY7 A;  2KA5 A;  1BUZ A;  3IH9 A;  4XS5 A;  1T6R A;  3AGD A;  4HYL A;  1H4Z A;  1THN B;  4DGH A;  3ZXN A;  2VY9 A;  1TH8 B;  5EZB A;  3AGE A;  3LKL A;  3IF5 A;  1H4X A;  1TID B;  3IH8 A;  3F43 A;  3LLO A;  3MGL A;  3T6O A;  1AUZ A;  5EUZ A;  2KLN A;  1TIL B;  5EUW A;  1SBO A;  4DGF A;  3OIZ A;  5EUX A;  5EUS A;  3OIR A;  5EUU A;  4QTP A;  1VC1 A;  3ZTB A;  1H4Y A;  3IHA A;  3IHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...