3F43A

Crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
b'HHHHHMFPYKIVDDVVILMPNKELNIENAHLFKKWVFDEFLNKGYNKIFLVLSDVESIDSFSLGVIVNILKSISSSGGFFALVSPNEKVERVLSLTNLDRIVKIYDTISEAMEEVRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative anti-sigma factor antagonist TM1081
publication title Crystal structure of Putative anti-sigma factor antagonist TM1081 (TM1081) from THERMOTOGA MARITIMA at 1.59 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3f43A01
2VY9A 4DGFA 1AUZA 1SBOA 1THNB 3MGLA 3IF5A 1H4YA 3T6OA 5EUSA 2KA5A 5EUZA 3IHAA 3LKLA 1BUZA 3IHBA 3ZXNA 4DGHA 3IH9A 3F43A 1H4ZA 3OIZA 5EUXA 5EZBA 3IH8A 1TIDB 3AGDA 4XS5A 3OIRA 5EUWA 3AGEA 3LLOA 1TH8B 1H4XA 4HYLA 4QTPA 3ZTBA 2KLNA 5EUUA 1VC1A 3NY7A 1TILB 1T6RA
chains in the Genus database with same CATH superfamily
1HF2A 4HIZA 1SBOA 2OASA 3V8VA 2ZOAA 3MOGA 4AEJA 2KA5A 3LKLA 3C0KA 3D3UA 1V0FA 3IH9A 1H4ZA 2AS0A 3IH8A 3GHFA 1BPLA 1FC9A 1N6DA 3JU4A 3GVLA 1FC7A 1WXWA 3LLOA 2KLNA 2B78A 2DXLA 3MGLA 3LDFA 1H4YA 3T6OA 1FCFA 5EUSA 1BUZA 3GMFA 2CWWA 3ZXNA 4DGHA 4DMGA 2RRLA 4AE2A 3V97A 1TILB 1N6FA 2VY9A 1TH8B 3EH7A 1T6RA 1AUZA 1THNB 3DUPA 1K32A 5EUZA 3DORA 5EZBA 5EUXA 1WXXA 4XS5A 3OIRA 2ZO9B 1FC6A 1V0EA 5EUWA 3AGEA 3GVKA 4HYLA 4QTPA 3VSEA 3ZTBA 5EUUA 3D03A 3NY7A 4DGFA 4GHNA 3IF5A 2DXNA 3GK7A 3IHAA 4L8KA 4L1CA 3IHBA 3F43A 3K50A 3OIZA 1TIDB 3AGDA 3QDQA 3DJAA 1J7XA 1N6EA 1H4XA 3GVJA 1VC1A 4JC0A
chains in the Genus database with same CATH topology
2VY9A 4DGFA 1AUZA 1SBOA 1THNB 3MGLA 3IF5A 1H4YA 3T6OA 5EUSA 2KA5A 5EUZA 3IHAA 3LKLA 1BUZA 3IHBA 3ZXNA 4DGHA 3IH9A 3F43A 1H4ZA 3OIZA 5EUXA 5EZBA 3IH8A 1TIDB 3AGDA 4XS5A 3OIRA 5EUWA 3AGEA 3LLOA 1TH8B 1H4XA 4HYLA 4QTPA 3ZTBA 2KLNA 5EUUA 1VC1A 3NY7A 1TILB 1T6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VY9 A;  4DGF A;  1AUZ A;  1SBO A;  1THN B;  3MGL A;  3IF5 A;  1H4Y A;  3T6O A;  5EUS A;  2KA5 A;  5EUZ A;  3IHA A;  3LKL A;  1BUZ A;  3IHB A;  3ZXN A;  4DGH A;  3IH9 A;  3F43 A;  1H4Z A;  3OIZ A;  5EUX A;  5EZB A;  3IH8 A;  1TID B;  3AGD A;  4XS5 A;  3OIR A;  5EUW A;  3AGE A;  3LLO A;  1TH8 B;  1H4X A;  4HYL A;  4QTP A;  3ZTB A;  2KLN A;  5EUU A;  1VC1 A;  3NY7 A;  1TIL B;  1T6R A; 
#chains in the Genus database with same CATH topology
 1HF2 A;  4HIZ A;  1SBO A;  2OAS A;  3V8V A;  2ZOA A;  3MOG A;  4AEJ A;  2KA5 A;  3LKL A;  3C0K A;  3D3U A;  1V0F A;  3IH9 A;  1H4Z A;  2AS0 A;  3IH8 A;  3GHF A;  1BPL A;  1FC9 A;  1N6D A;  3JU4 A;  3GVL A;  1FC7 A;  1WXW A;  3LLO A;  2KLN A;  2B78 A;  2DXL A;  3MGL A;  3LDF A;  1H4Y A;  3T6O A;  1FCF A;  5EUS A;  1BUZ A;  3GMF A;  2CWW A;  3ZXN A;  4DGH A;  4DMG A;  2RRL A;  4AE2 A;  3V97 A;  1TIL B;  1N6F A;  2VY9 A;  1TH8 B;  3EH7 A;  1T6R A;  1AUZ A;  1THN B;  3DUP A;  1K32 A;  5EUZ A;  3DOR A;  5EZB A;  5EUX A;  1WXX A;  4XS5 A;  3OIR A;  2ZO9 B;  1FC6 A;  1V0E A;  5EUW A;  3AGE A;  3GVK A;  4HYL A;  4QTP A;  3VSE A;  3ZTB A;  5EUU A;  3D03 A;  3NY7 A;  4DGF A;  4GHN A;  3IF5 A;  2DXN A;  3GK7 A;  3IHA A;  4L8K A;  4L1C A;  3IHB A;  3F43 A;  3K50 A;  3OIZ A;  1TID B;  3AGD A;  3QDQ A;  3DJA A;  1J7X A;  1N6E A;  1H4X A;  3GVJ A;  1VC1 A;  4JC0 A; 
#chains in the Genus database with same CATH homology
 2VY9 A;  4DGF A;  1AUZ A;  1SBO A;  1THN B;  3MGL A;  3IF5 A;  1H4Y A;  3T6O A;  5EUS A;  2KA5 A;  5EUZ A;  3IHA A;  3LKL A;  1BUZ A;  3IHB A;  3ZXN A;  4DGH A;  3IH9 A;  3F43 A;  1H4Z A;  3OIZ A;  5EUX A;  5EZB A;  3IH8 A;  1TID B;  3AGD A;  4XS5 A;  3OIR A;  5EUW A;  3AGE A;  3LLO A;  1TH8 B;  1H4X A;  4HYL A;  4QTP A;  3ZTB A;  2KLN A;  5EUU A;  1VC1 A;  3NY7 A;  1TIL B;  1T6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...