3F43A

Crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
117
structure length
117
Chain Sequence
HHHHHMFPYKIVDDVVILMPNKELNIENAHLFKKWVFDEFLNKGYNKIFLVLSDVESIDSFSLGVIVNILKSISSSGGFFALVSPNEKVERVLSLTNLDRIVKIYDTISEAMEEVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative anti-sigma factor antagonist TM1081
publication title Crystal structure of Putative anti-sigma factor antagonist TM1081 (TM1081) from THERMOTOGA MARITIMA at 1.59 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 34
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3f43A01
3MGLA 5EUUA 2KLNA 3F43A 5EUWA 5EUZA 3T6OA 1T6RA 1H4XA 4DGHA 5EUXA 1H4YA 3OIRA 4DGFA 3IHBA 1THNB 1SBOA 4XS5A 3OIZA 3NY7A 3LKLA 3IF5A 1TILB 1BUZA 4HYLA 5EZBA 1TH8B 3IHAA 3ZTBA 3IH9A 2VY9A 1H4ZA 3AGDA 4QTPA 5EUSA 3ZXNA 1TIDB 3AGEA 1AUZA 3IH8A 2KA5A 1VC1A 3LLOA
chains in the Genus database with same CATH superfamily
5EUUA 4L8KA 1H4XA 5EUXA 1V0FA 1N6EA 4DGFA 1WXXA 3IHBA 4GHNA 4L1CA 3OIZA 3D03A 1BUZA 3IH9A 3ZXNA 4QTPA 5EUSA 3DORA 1TIDB 2DXNA 2OASA 1V0EA 4AEJA 2KLNA 4DMGA 1J7XA 3GVLA 1N6FA 1H4YA 2RRLA 3QDQA 2ZO9B 3OIRA 1SBOA 3NY7A 3LKLA 3GVJA 1FCFA 3AGDA 3DUPA 2B78A 4JC0A 4HIZA 3VSEA 3MGLA 3LDFA 1FC6A 3F43A 2AS0A 2ZOAA 2DXLA 1THNB 1WXWA 3V97A 3IF5A 1FC7A 5EZBA 1FC9A 1TH8B 3C0KA 3IHAA 3ZTBA 2VY9A 3MOGA 1BPLA 3GMFA 3V8VA 3IH8A 2KA5A 1VC1A 2CWWA 5EUWA 5EUZA 3T6OA 1T6RA 4AE2A 4DGHA 3JU4A 1N6DA 1HF2A 3GK7A 4XS5A 1K32A 1TILB 3GVKA 3D3UA 4HYLA 3K50A 1H4ZA 3GHFA 3EH7A 3DJAA 3AGEA 1AUZA 3LLOA
chains in the Genus database with same CATH topology
3MGLA 5EUUA 2KLNA 3F43A 5EUWA 5EUZA 3T6OA 1T6RA 1H4XA 4DGHA 5EUXA 1H4YA 3OIRA 4DGFA 3IHBA 1THNB 1SBOA 4XS5A 3OIZA 3NY7A 3LKLA 3IF5A 1TILB 1BUZA 4HYLA 5EZBA 1TH8B 3IHAA 3ZTBA 3IH9A 2VY9A 1H4ZA 3AGDA 4QTPA 5EUSA 3ZXNA 1TIDB 3AGEA 1AUZA 3IH8A 2KA5A 1VC1A 3LLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGL A;  5EUU A;  2KLN A;  3F43 A;  5EUW A;  5EUZ A;  3T6O A;  1T6R A;  1H4X A;  4DGH A;  5EUX A;  1H4Y A;  3OIR A;  4DGF A;  3IHB A;  1THN B;  1SBO A;  4XS5 A;  3OIZ A;  3NY7 A;  3LKL A;  3IF5 A;  1TIL B;  1BUZ A;  4HYL A;  5EZB A;  1TH8 B;  3IHA A;  3ZTB A;  3IH9 A;  2VY9 A;  1H4Z A;  3AGD A;  4QTP A;  5EUS A;  3ZXN A;  1TID B;  3AGE A;  1AUZ A;  3IH8 A;  2KA5 A;  1VC1 A;  3LLO A; 
#chains in the Genus database with same CATH topology
 5EUU A;  4L8K A;  1H4X A;  5EUX A;  1V0F A;  1N6E A;  4DGF A;  1WXX A;  3IHB A;  4GHN A;  4L1C A;  3OIZ A;  3D03 A;  1BUZ A;  3IH9 A;  3ZXN A;  4QTP A;  5EUS A;  3DOR A;  1TID B;  2DXN A;  2OAS A;  1V0E A;  4AEJ A;  2KLN A;  4DMG A;  1J7X A;  3GVL A;  1N6F A;  1H4Y A;  2RRL A;  3QDQ A;  2ZO9 B;  3OIR A;  1SBO A;  3NY7 A;  3LKL A;  3GVJ A;  1FCF A;  3AGD A;  3DUP A;  2B78 A;  4JC0 A;  4HIZ A;  3VSE A;  3MGL A;  3LDF A;  1FC6 A;  3F43 A;  2AS0 A;  2ZOA A;  2DXL A;  1THN B;  1WXW A;  3V97 A;  3IF5 A;  1FC7 A;  5EZB A;  1FC9 A;  1TH8 B;  3C0K A;  3IHA A;  3ZTB A;  2VY9 A;  3MOG A;  1BPL A;  3GMF A;  3V8V A;  3IH8 A;  2KA5 A;  1VC1 A;  2CWW A;  5EUW A;  5EUZ A;  3T6O A;  1T6R A;  4AE2 A;  4DGH A;  3JU4 A;  1N6D A;  1HF2 A;  3GK7 A;  4XS5 A;  1K32 A;  1TIL B;  3GVK A;  3D3U A;  4HYL A;  3K50 A;  1H4Z A;  3GHF A;  3EH7 A;  3DJA A;  3AGE A;  1AUZ A;  3LLO A; 
#chains in the Genus database with same CATH homology
 3MGL A;  5EUU A;  2KLN A;  3F43 A;  5EUW A;  5EUZ A;  3T6O A;  1T6R A;  1H4X A;  4DGH A;  5EUX A;  1H4Y A;  3OIR A;  4DGF A;  3IHB A;  1THN B;  1SBO A;  4XS5 A;  3OIZ A;  3NY7 A;  3LKL A;  3IF5 A;  1TIL B;  1BUZ A;  4HYL A;  5EZB A;  1TH8 B;  3IHA A;  3ZTB A;  3IH9 A;  2VY9 A;  1H4Z A;  3AGD A;  4QTP A;  5EUS A;  3ZXN A;  1TID B;  3AGE A;  1AUZ A;  3IH8 A;  2KA5 A;  1VC1 A;  3LLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...