1THNB

Crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
SLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDSSGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Anti-sigma F factor
publication title Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 37
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1thnB00
3T6OA 1T6RA 3MGLA 1TILB 3OIZA 5EZBA 1AUZA 4HYLA 5EUXA 1H4ZA 1H4XA 4XS5A 3IHAA 5EUZA 3ZXNA 1H4YA 3IH8A 4DGHA 4DGFA 5EUSA 1VC1A 5EUWA 1TH8B 3F43A 3IF5A 5EUUA 2VY9A 3AGDA 1THNB 3NY7A 3AGEA 3OIRA 1SBOA 3LKLA 1TIDB 2KA5A 3ZTBA 1BUZA 3LLOA 3IH9A 4QTPA 3IHBA 2KLNA
chains in the Genus database with same CATH superfamily
1J7XA 1N6DA 1TILB 2RRLA 4AE2A 3D03A 5EZBA 5EUXA 3IHAA 2DXNA 3GK7A 1H4YA 4DGFA 5EUSA 1K32A 3AGDA 4L1CA 3QDQA 2CWWA 2ZO9B 3LKLA 1TIDB 1WXWA 1BUZA 3C0KA 3D3UA 3K50A 4GHNA 1N6EA 2AS0A 3GVLA 3GVJA 1H4XA 4XS5A 3GMFA 3ZXNA 1VC1A 1WXXA 3GVKA 2VY9A 3GHFA 4AEJA 3DUPA 3V97A 3DORA 1FC6A 4JC0A 1T6RA 1FC7A 3OIZA 1AUZA 4HYLA 5EUZA 3IH8A 4DGHA 3VSEA 3F43A 5EUUA 3V8VA 3LDFA 3AGEA 3OIRA 1SBOA 3EH7A 1FC9A 1N6FA 3LLOA 3IHBA 3DJAA 2KLNA 3T6OA 3MGLA 2B78A 4HIZA 1H4ZA 3MOGA 1HF2A 5EUWA 4DMGA 1TH8B 3IF5A 4L8KA 1FCFA 1V0EA 2OASA 1THNB 3NY7A 1V0FA 2ZOAA 1BPLA 2DXLA 3JU4A 2KA5A 3ZTBA 3IH9A 4QTPA
chains in the Genus database with same CATH topology
3T6OA 1T6RA 3MGLA 1TILB 3OIZA 5EZBA 1AUZA 4HYLA 5EUXA 1H4ZA 1H4XA 4XS5A 3IHAA 5EUZA 3ZXNA 1H4YA 3IH8A 4DGHA 4DGFA 5EUSA 1VC1A 5EUWA 1TH8B 3F43A 3IF5A 5EUUA 2VY9A 3AGDA 1THNB 3NY7A 3AGEA 3OIRA 1SBOA 3LKLA 1TIDB 2KA5A 3ZTBA 1BUZA 3LLOA 3IH9A 4QTPA 3IHBA 2KLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6O A;  1T6R A;  3MGL A;  1TIL B;  3OIZ A;  5EZB A;  1AUZ A;  4HYL A;  5EUX A;  1H4Z A;  1H4X A;  4XS5 A;  3IHA A;  5EUZ A;  3ZXN A;  1H4Y A;  3IH8 A;  4DGH A;  4DGF A;  5EUS A;  1VC1 A;  5EUW A;  1TH8 B;  3F43 A;  3IF5 A;  5EUU A;  2VY9 A;  3AGD A;  1THN B;  3NY7 A;  3AGE A;  3OIR A;  1SBO A;  3LKL A;  1TID B;  2KA5 A;  3ZTB A;  1BUZ A;  3LLO A;  3IH9 A;  4QTP A;  3IHB A;  2KLN A; 
#chains in the Genus database with same CATH topology
 1J7X A;  1N6D A;  1TIL B;  2RRL A;  4AE2 A;  3D03 A;  5EZB A;  5EUX A;  3IHA A;  2DXN A;  3GK7 A;  1H4Y A;  4DGF A;  5EUS A;  1K32 A;  3AGD A;  4L1C A;  3QDQ A;  2CWW A;  2ZO9 B;  3LKL A;  1TID B;  1WXW A;  1BUZ A;  3C0K A;  3D3U A;  3K50 A;  4GHN A;  1N6E A;  2AS0 A;  3GVL A;  3GVJ A;  1H4X A;  4XS5 A;  3GMF A;  3ZXN A;  1VC1 A;  1WXX A;  3GVK A;  2VY9 A;  3GHF A;  4AEJ A;  3DUP A;  3V97 A;  3DOR A;  1FC6 A;  4JC0 A;  1T6R A;  1FC7 A;  3OIZ A;  1AUZ A;  4HYL A;  5EUZ A;  3IH8 A;  4DGH A;  3VSE A;  3F43 A;  5EUU A;  3V8V A;  3LDF A;  3AGE A;  3OIR A;  1SBO A;  3EH7 A;  1FC9 A;  1N6F A;  3LLO A;  3IHB A;  3DJA A;  2KLN A;  3T6O A;  3MGL A;  2B78 A;  4HIZ A;  1H4Z A;  3MOG A;  1HF2 A;  5EUW A;  4DMG A;  1TH8 B;  3IF5 A;  4L8K A;  1FCF A;  1V0E A;  2OAS A;  1THN B;  3NY7 A;  1V0F A;  2ZOA A;  1BPL A;  2DXL A;  3JU4 A;  2KA5 A;  3ZTB A;  3IH9 A;  4QTP A; 
#chains in the Genus database with same CATH homology
 3T6O A;  1T6R A;  3MGL A;  1TIL B;  3OIZ A;  5EZB A;  1AUZ A;  4HYL A;  5EUX A;  1H4Z A;  1H4X A;  4XS5 A;  3IHA A;  5EUZ A;  3ZXN A;  1H4Y A;  3IH8 A;  4DGH A;  4DGF A;  5EUS A;  1VC1 A;  5EUW A;  1TH8 B;  3F43 A;  3IF5 A;  5EUU A;  2VY9 A;  3AGD A;  1THN B;  3NY7 A;  3AGE A;  3OIR A;  1SBO A;  3LKL A;  1TID B;  2KA5 A;  3ZTB A;  1BUZ A;  3LLO A;  3IH9 A;  4QTP A;  3IHB A;  2KLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...