1THNB

Crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
SLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDSSGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-sigma F factor
publication title Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 37
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1thnB00
1H4YA 1T6RA 5EUZA 4DGFA 1TIDB 5EUXA 2VY9A 5EUSA 4DGHA 4HYLA 3AGEA 5EUWA 3IHBA 5EZBA 3IF5A 3T6OA 3AGDA 3NY7A 3LLOA 3OIZA 1AUZA 3OIRA 3IHAA 1THNB 1H4ZA 3F43A 5EUUA 2KA5A 1BUZA 3ZXNA 1H4XA 4XS5A 3IH8A 3IH9A 1TH8B 3LKLA 3ZTBA 1VC1A 1SBOA 3MGLA 1TILB 2KLNA 4QTPA
chains in the Genus database with same CATH superfamily
1H4YA 2B78A 1BPLA 5EUZA 4JC0A 1V0EA 1J7XA 3MOGA 4HYLA 2CWWA 5EZBA 3T6OA 3OIZA 1HF2A 3GK7A 4AE2A 3F43A 5EUUA 1H4XA 3IH9A 1WXWA 4HIZA 3MGLA 4DGFA 2RRLA 5EUXA 1N6DA 5EUSA 3AGEA 4L8KA 3LLOA 3D03A 3OIRA 2ZO9B 3IHAA 1BUZA 3D3UA 3ZXNA 3VSEA 3DUPA 3GVJA 3DJAA 3GVLA 1N6EA 1TIDB 3GVKA 3JU4A 2VY9A 4DGHA 3EH7A 3IHBA 1V0FA 3GMFA 3LDFA 3IF5A 3GHFA 1FCFA 1THNB 1WXXA 2KA5A 3V8VA 4L1CA 4XS5A 3IH8A 1TH8B 1VC1A 1SBOA 3QDQA 4DMGA 1AUZA 3DORA 1K32A 1T6RA 3V97A 2OASA 1FC7A 4GHNA 5EUWA 3C0KA 3AGDA 3NY7A 2AS0A 1FC9A 1H4ZA 2DXLA 2DXNA 3K50A 1N6FA 1FC6A 3LKLA 3ZTBA 2ZOAA 1TILB 2KLNA 4QTPA 4AEJA
chains in the Genus database with same CATH topology
1H4YA 1T6RA 5EUZA 4DGFA 1TIDB 5EUXA 2VY9A 5EUSA 4DGHA 4HYLA 3AGEA 5EUWA 3IHBA 5EZBA 3IF5A 3T6OA 3AGDA 3NY7A 3LLOA 3OIZA 1AUZA 3OIRA 3IHAA 1THNB 1H4ZA 3F43A 5EUUA 2KA5A 1BUZA 3ZXNA 1H4XA 4XS5A 3IH8A 3IH9A 1TH8B 3LKLA 3ZTBA 1VC1A 1SBOA 3MGLA 1TILB 2KLNA 4QTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4Y A;  1T6R A;  5EUZ A;  4DGF A;  1TID B;  5EUX A;  2VY9 A;  5EUS A;  4DGH A;  4HYL A;  3AGE A;  5EUW A;  3IHB A;  5EZB A;  3IF5 A;  3T6O A;  3AGD A;  3NY7 A;  3LLO A;  3OIZ A;  1AUZ A;  3OIR A;  3IHA A;  1THN B;  1H4Z A;  3F43 A;  5EUU A;  2KA5 A;  1BUZ A;  3ZXN A;  1H4X A;  4XS5 A;  3IH8 A;  3IH9 A;  1TH8 B;  3LKL A;  3ZTB A;  1VC1 A;  1SBO A;  3MGL A;  1TIL B;  2KLN A;  4QTP A; 
#chains in the Genus database with same CATH topology
 1H4Y A;  2B78 A;  1BPL A;  5EUZ A;  4JC0 A;  1V0E A;  1J7X A;  3MOG A;  4HYL A;  2CWW A;  5EZB A;  3T6O A;  3OIZ A;  1HF2 A;  3GK7 A;  4AE2 A;  3F43 A;  5EUU A;  1H4X A;  3IH9 A;  1WXW A;  4HIZ A;  3MGL A;  4DGF A;  2RRL A;  5EUX A;  1N6D A;  5EUS A;  3AGE A;  4L8K A;  3LLO A;  3D03 A;  3OIR A;  2ZO9 B;  3IHA A;  1BUZ A;  3D3U A;  3ZXN A;  3VSE A;  3DUP A;  3GVJ A;  3DJA A;  3GVL A;  1N6E A;  1TID B;  3GVK A;  3JU4 A;  2VY9 A;  4DGH A;  3EH7 A;  3IHB A;  1V0F A;  3GMF A;  3LDF A;  3IF5 A;  3GHF A;  1FCF A;  1THN B;  1WXX A;  2KA5 A;  3V8V A;  4L1C A;  4XS5 A;  3IH8 A;  1TH8 B;  1VC1 A;  1SBO A;  3QDQ A;  4DMG A;  1AUZ A;  3DOR A;  1K32 A;  1T6R A;  3V97 A;  2OAS A;  1FC7 A;  4GHN A;  5EUW A;  3C0K A;  3AGD A;  3NY7 A;  2AS0 A;  1FC9 A;  1H4Z A;  2DXL A;  2DXN A;  3K50 A;  1N6F A;  1FC6 A;  3LKL A;  3ZTB A;  2ZOA A;  1TIL B;  2KLN A;  4QTP A;  4AEJ A; 
#chains in the Genus database with same CATH homology
 1H4Y A;  1T6R A;  5EUZ A;  4DGF A;  1TID B;  5EUX A;  2VY9 A;  5EUS A;  4DGH A;  4HYL A;  3AGE A;  5EUW A;  3IHB A;  5EZB A;  3IF5 A;  3T6O A;  3AGD A;  3NY7 A;  3LLO A;  3OIZ A;  1AUZ A;  3OIR A;  3IHA A;  1THN B;  1H4Z A;  3F43 A;  5EUU A;  2KA5 A;  1BUZ A;  3ZXN A;  1H4X A;  4XS5 A;  3IH8 A;  3IH9 A;  1TH8 B;  3LKL A;  3ZTB A;  1VC1 A;  1SBO A;  3MGL A;  1TIL B;  2KLN A;  4QTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...