5EUZA

Rat prestin stas domain in complex with iodide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
130
Chain Sequence
SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYENIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Prestin,Prestin
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 40
structure length 130
sequence length 143
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5euzA00
5EUUA 3AGDA 3IH9A 4QTPA 4DGFA 3F43A 2KLNA 4DGHA 1H4XA 2VY9A 3AGEA 3LLOA 4HYLA 5EUWA 3IF5A 1SBOA 1VC1A 5EZBA 3MGLA 1BUZA 1THNB 1TH8B 3ZTBA 2KA5A 5EUXA 1H4YA 3IHAA 1AUZA 3IH8A 3ZXNA 5EUZA 5EUSA 3OIRA 3OIZA 4XS5A 1TILB 1T6RA 3T6OA 3NY7A 3LKLA 1TIDB 3IHBA 1H4ZA
chains in the Genus database with same CATH superfamily
4QTPA 4DGHA 5EUWA 1FC6A 3GHFA 5EZBA 1BUZA 3ZTBA 2KA5A 1H4YA 3C0KA 4DMGA 3OIZA 4AE2A 4GHNA 3T6OA 2ZO9B 3DORA 1H4ZA 3V8VA 3GMFA 3IH9A 2AS0A 1H4XA 3V97A 3LLOA 4HYLA 3IF5A 3D03A 4JC0A 1V0FA 2DXLA 1THNB 1WXWA 5EUXA 1N6FA 5EUSA 3OIRA 4XS5A 3JU4A 1TILB 3GK7A 1N6DA 3LDFA 3LKLA 1FCFA 3IHBA 4HIZA 5EUUA 4DGFA 3D3UA 2B78A 3MGLA 1J7XA 1HF2A 1TH8B 3GVKA 1BPLA 1V0EA 3IH8A 5EUZA 3ZXNA 3EH7A 4L1CA 3K50A 3QDQA 3GVLA 1TIDB 2CWWA 1K32A 3NY7A 3AGDA 2OASA 4L8KA 4AEJA 3F43A 2KLNA 3VSEA 2VY9A 3AGEA 1SBOA 2DXNA 1VC1A 3DUPA 3MOGA 3IHAA 3GVJA 1WXXA 1AUZA 1FC7A 2ZOAA 1T6RA 1FC9A 1N6EA 3DJAA 2RRLA
chains in the Genus database with same CATH topology
5EUUA 3AGDA 3IH9A 4QTPA 4DGFA 3F43A 2KLNA 4DGHA 1H4XA 2VY9A 3AGEA 3LLOA 4HYLA 5EUWA 3IF5A 1SBOA 1VC1A 5EZBA 3MGLA 1BUZA 1THNB 1TH8B 3ZTBA 2KA5A 5EUXA 1H4YA 3IHAA 1AUZA 3IH8A 3ZXNA 5EUZA 5EUSA 3OIRA 3OIZA 4XS5A 1TILB 1T6RA 3T6OA 3NY7A 3LKLA 1TIDB 3IHBA 1H4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EUU A;  3AGD A;  3IH9 A;  4QTP A;  4DGF A;  3F43 A;  2KLN A;  4DGH A;  1H4X A;  2VY9 A;  3AGE A;  3LLO A;  4HYL A;  5EUW A;  3IF5 A;  1SBO A;  1VC1 A;  5EZB A;  3MGL A;  1BUZ A;  1THN B;  1TH8 B;  3ZTB A;  2KA5 A;  5EUX A;  1H4Y A;  3IHA A;  1AUZ A;  3IH8 A;  3ZXN A;  5EUZ A;  5EUS A;  3OIR A;  3OIZ A;  4XS5 A;  1TIL B;  1T6R A;  3T6O A;  3NY7 A;  3LKL A;  1TID B;  3IHB A;  1H4Z A; 
#chains in the Genus database with same CATH topology
 4QTP A;  4DGH A;  5EUW A;  1FC6 A;  3GHF A;  5EZB A;  1BUZ A;  3ZTB A;  2KA5 A;  1H4Y A;  3C0K A;  4DMG A;  3OIZ A;  4AE2 A;  4GHN A;  3T6O A;  2ZO9 B;  3DOR A;  1H4Z A;  3V8V A;  3GMF A;  3IH9 A;  2AS0 A;  1H4X A;  3V97 A;  3LLO A;  4HYL A;  3IF5 A;  3D03 A;  4JC0 A;  1V0F A;  2DXL A;  1THN B;  1WXW A;  5EUX A;  1N6F A;  5EUS A;  3OIR A;  4XS5 A;  3JU4 A;  1TIL B;  3GK7 A;  1N6D A;  3LDF A;  3LKL A;  1FCF A;  3IHB A;  4HIZ A;  5EUU A;  4DGF A;  3D3U A;  2B78 A;  3MGL A;  1J7X A;  1HF2 A;  1TH8 B;  3GVK A;  1BPL A;  1V0E A;  3IH8 A;  5EUZ A;  3ZXN A;  3EH7 A;  4L1C A;  3K50 A;  3QDQ A;  3GVL A;  1TID B;  2CWW A;  1K32 A;  3NY7 A;  3AGD A;  2OAS A;  4L8K A;  4AEJ A;  3F43 A;  2KLN A;  3VSE A;  2VY9 A;  3AGE A;  1SBO A;  2DXN A;  1VC1 A;  3DUP A;  3MOG A;  3IHA A;  3GVJ A;  1WXX A;  1AUZ A;  1FC7 A;  2ZOA A;  1T6R A;  1FC9 A;  1N6E A;  3DJA A;  2RRL A; 
#chains in the Genus database with same CATH homology
 5EUU A;  3AGD A;  3IH9 A;  4QTP A;  4DGF A;  3F43 A;  2KLN A;  4DGH A;  1H4X A;  2VY9 A;  3AGE A;  3LLO A;  4HYL A;  5EUW A;  3IF5 A;  1SBO A;  1VC1 A;  5EZB A;  3MGL A;  1BUZ A;  1THN B;  1TH8 B;  3ZTB A;  2KA5 A;  5EUX A;  1H4Y A;  3IHA A;  1AUZ A;  3IH8 A;  3ZXN A;  5EUZ A;  5EUS A;  3OIR A;  3OIZ A;  4XS5 A;  1TIL B;  1T6R A;  3T6O A;  3NY7 A;  3LKL A;  1TID B;  3IHB A;  1H4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...