5EUZA

Rat prestin stas domain in complex with iodide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
130
Chain Sequence
SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYENIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prestin,Prestin
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 40
structure length 130
sequence length 143
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5euzA00
3NY7A 3MGLA 1TILB 3IF5A 5EUZA 3IHAA 1TH8B 3LLOA 2VY9A 3IH8A 4DGHA 5EUUA 2KLNA 3IH9A 3ZTBA 1H4XA 4QTPA 5EUWA 2KA5A 3OIRA 1H4YA 4HYLA 3AGDA 3ZXNA 1THNB 3AGEA 1SBOA 3LKLA 3T6OA 1AUZA 4DGFA 1BUZA 5EUSA 5EZBA 1H4ZA 1TIDB 3F43A 3IHBA 4XS5A 3OIZA 1VC1A 1T6RA 5EUXA
chains in the Genus database with same CATH superfamily
1TILB 3IF5A 3EH7A 4GHNA 3K50A 3V97A 3DORA 2VY9A 3IH9A 3ZTBA 3C0KA 2DXLA 1H4YA 4HYLA 3ZXNA 3D3UA 1J7XA 1HF2A 3LKLA 1BPLA 5EZBA 1H4ZA 4DMGA 4XS5A 1FC6A 5EUXA 3GK7A 3NY7A 3GVKA 3QDQA 4AEJA 1N6EA 3IH8A 3VSEA 4DGHA 3GVLA 3DJAA 3D03A 2CWWA 3OIRA 4L1CA 1THNB 3T6OA 3GHFA 1FC7A 1N6DA 1TIDB 3F43A 3V8VA 1WXWA 3GMFA 4HIZA 3MGLA 2AS0A 3GVJA 5EUUA 2KLNA 1H4XA 5EUWA 2KA5A 2B78A 3AGDA 3LDFA 1SBOA 1K32A 3MOGA 1V0FA 4DGFA 1BUZA 3DUPA 3IHBA 1AUZA 1N6FA 1V0EA 5EUZA 3IHAA 1TH8B 4L8KA 3LLOA 2OASA 1FC9A 2ZOAA 4QTPA 3AGEA 4AE2A 1WXXA 2RRLA 4JC0A 5EUSA 2ZO9B 3JU4A 1FCFA 3OIZA 1VC1A 2DXNA 1T6RA
chains in the Genus database with same CATH topology
3NY7A 3MGLA 1TILB 3IF5A 5EUZA 3IHAA 1TH8B 3LLOA 2VY9A 3IH8A 4DGHA 5EUUA 2KLNA 3IH9A 3ZTBA 1H4XA 4QTPA 5EUWA 2KA5A 3OIRA 1H4YA 4HYLA 3AGDA 3ZXNA 1THNB 3AGEA 1SBOA 3LKLA 3T6OA 1AUZA 4DGFA 1BUZA 5EUSA 5EZBA 1H4ZA 1TIDB 3F43A 3IHBA 4XS5A 3OIZA 1VC1A 1T6RA 5EUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NY7 A;  3MGL A;  1TIL B;  3IF5 A;  5EUZ A;  3IHA A;  1TH8 B;  3LLO A;  2VY9 A;  3IH8 A;  4DGH A;  5EUU A;  2KLN A;  3IH9 A;  3ZTB A;  1H4X A;  4QTP A;  5EUW A;  2KA5 A;  3OIR A;  1H4Y A;  4HYL A;  3AGD A;  3ZXN A;  1THN B;  3AGE A;  1SBO A;  3LKL A;  3T6O A;  1AUZ A;  4DGF A;  1BUZ A;  5EUS A;  5EZB A;  1H4Z A;  1TID B;  3F43 A;  3IHB A;  4XS5 A;  3OIZ A;  1VC1 A;  1T6R A;  5EUX A; 
#chains in the Genus database with same CATH topology
 1TIL B;  3IF5 A;  3EH7 A;  4GHN A;  3K50 A;  3V97 A;  3DOR A;  2VY9 A;  3IH9 A;  3ZTB A;  3C0K A;  2DXL A;  1H4Y A;  4HYL A;  3ZXN A;  3D3U A;  1J7X A;  1HF2 A;  3LKL A;  1BPL A;  5EZB A;  1H4Z A;  4DMG A;  4XS5 A;  1FC6 A;  5EUX A;  3GK7 A;  3NY7 A;  3GVK A;  3QDQ A;  4AEJ A;  1N6E A;  3IH8 A;  3VSE A;  4DGH A;  3GVL A;  3DJA A;  3D03 A;  2CWW A;  3OIR A;  4L1C A;  1THN B;  3T6O A;  3GHF A;  1FC7 A;  1N6D A;  1TID B;  3F43 A;  3V8V A;  1WXW A;  3GMF A;  4HIZ A;  3MGL A;  2AS0 A;  3GVJ A;  5EUU A;  2KLN A;  1H4X A;  5EUW A;  2KA5 A;  2B78 A;  3AGD A;  3LDF A;  1SBO A;  1K32 A;  3MOG A;  1V0F A;  4DGF A;  1BUZ A;  3DUP A;  3IHB A;  1AUZ A;  1N6F A;  1V0E A;  5EUZ A;  3IHA A;  1TH8 B;  4L8K A;  3LLO A;  2OAS A;  1FC9 A;  2ZOA A;  4QTP A;  3AGE A;  4AE2 A;  1WXX A;  2RRL A;  4JC0 A;  5EUS A;  2ZO9 B;  3JU4 A;  1FCF A;  3OIZ A;  1VC1 A;  2DXN A;  1T6R A; 
#chains in the Genus database with same CATH homology
 3NY7 A;  3MGL A;  1TIL B;  3IF5 A;  5EUZ A;  3IHA A;  1TH8 B;  3LLO A;  2VY9 A;  3IH8 A;  4DGH A;  5EUU A;  2KLN A;  3IH9 A;  3ZTB A;  1H4X A;  4QTP A;  5EUW A;  2KA5 A;  3OIR A;  1H4Y A;  4HYL A;  3AGD A;  3ZXN A;  1THN B;  3AGE A;  1SBO A;  3LKL A;  3T6O A;  1AUZ A;  4DGF A;  1BUZ A;  5EUS A;  5EZB A;  1H4Z A;  1TID B;  3F43 A;  3IHB A;  4XS5 A;  3OIZ A;  1VC1 A;  1T6R A;  5EUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...