1TH8B

Crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
b'SLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDSSGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-sigma F factor
publication title Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 40
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1th8B00
5EUWA 3AGDA 3IH9A 3IHBA 5EZBA 1AUZA 2KA5A 3NY7A 3MGLA 1VC1A 5EUUA 1H4XA 4QTPA 1BUZA 1TIDB 2KLNA 2VY9A 5EUSA 1H4YA 3IH8A 3IHAA 1T6RA 5EUZA 3ZXNA 4DGFA 3AGEA 3LKLA 3OIRA 3T6OA 1TILB 4HYLA 3OIZA 3F43A 3LLOA 1SBOA 4XS5A 4DGHA 1THNB 5EUXA 3ZTBA 1TH8B 1H4ZA 3IF5A
chains in the Genus database with same CATH superfamily
2AS0A 3NY7A 4AEJA 1VC1A 2ZO9B 2KLNA 2VY9A 5EUSA 3D03A 3IH8A 2DXLA 3LKLA 1V0EA 1FC6A 1SBOA 4DGHA 1V0FA 4GHNA 3IF5A 3GVKA 3MOGA 4L8KA 1TIDB 4DMGA 2DXNA 1BPLA 1N6FA 2B78A 3V97A 3AGEA 3K50A 3OIRA 3T6OA 4HYLA 3OIZA 1N6EA 2RRLA 4HIZA 3ZTBA 1K32A 3JU4A 5EUWA 3AGDA 3IH9A 4JC0A 1AUZA 2KA5A 3EH7A 4AE2A 2ZOAA 3DUPA 3DORA 4QTPA 1BUZA 2OASA 1WXXA 1H4YA 3GK7A 3IHAA 3ZXNA 4DGFA 2CWWA 3F43A 3V8VA 1FCFA 5EUXA 1J7XA 1N6DA 3D3UA 1HF2A 3IHBA 5EZBA 3MGLA 1FC7A 5EUUA 3LDFA 1H4XA 3GMFA 3QDQA 3GHFA 3DJAA 1T6RA 3GVJA 5EUZA 1FC9A 1TILB 3VSEA 4XS5A 3LLOA 1THNB 3GVLA 1TH8B 4L1CA 3C0KA 1WXWA 1H4ZA
chains in the Genus database with same CATH topology
5EUWA 3AGDA 3IH9A 3IHBA 5EZBA 1AUZA 2KA5A 3NY7A 3MGLA 1VC1A 5EUUA 1H4XA 4QTPA 1BUZA 1TIDB 2KLNA 2VY9A 5EUSA 1H4YA 3IH8A 3IHAA 1T6RA 5EUZA 3ZXNA 4DGFA 3AGEA 3LKLA 3OIRA 3T6OA 1TILB 4HYLA 3OIZA 3F43A 3LLOA 1SBOA 4XS5A 4DGHA 1THNB 5EUXA 3ZTBA 1TH8B 1H4ZA 3IF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EUW A;  3AGD A;  3IH9 A;  3IHB A;  5EZB A;  1AUZ A;  2KA5 A;  3NY7 A;  3MGL A;  1VC1 A;  5EUU A;  1H4X A;  4QTP A;  1BUZ A;  1TID B;  2KLN A;  2VY9 A;  5EUS A;  1H4Y A;  3IH8 A;  3IHA A;  1T6R A;  5EUZ A;  3ZXN A;  4DGF A;  3AGE A;  3LKL A;  3OIR A;  3T6O A;  1TIL B;  4HYL A;  3OIZ A;  3F43 A;  3LLO A;  1SBO A;  4XS5 A;  4DGH A;  1THN B;  5EUX A;  3ZTB A;  1TH8 B;  1H4Z A;  3IF5 A; 
#chains in the Genus database with same CATH topology
 2AS0 A;  3NY7 A;  4AEJ A;  1VC1 A;  2ZO9 B;  2KLN A;  2VY9 A;  5EUS A;  3D03 A;  3IH8 A;  2DXL A;  3LKL A;  1V0E A;  1FC6 A;  1SBO A;  4DGH A;  1V0F A;  4GHN A;  3IF5 A;  3GVK A;  3MOG A;  4L8K A;  1TID B;  4DMG A;  2DXN A;  1BPL A;  1N6F A;  2B78 A;  3V97 A;  3AGE A;  3K50 A;  3OIR A;  3T6O A;  4HYL A;  3OIZ A;  1N6E A;  2RRL A;  4HIZ A;  3ZTB A;  1K32 A;  3JU4 A;  5EUW A;  3AGD A;  3IH9 A;  4JC0 A;  1AUZ A;  2KA5 A;  3EH7 A;  4AE2 A;  2ZOA A;  3DUP A;  3DOR A;  4QTP A;  1BUZ A;  2OAS A;  1WXX A;  1H4Y A;  3GK7 A;  3IHA A;  3ZXN A;  4DGF A;  2CWW A;  3F43 A;  3V8V A;  1FCF A;  5EUX A;  1J7X A;  1N6D A;  3D3U A;  1HF2 A;  3IHB A;  5EZB A;  3MGL A;  1FC7 A;  5EUU A;  3LDF A;  1H4X A;  3GMF A;  3QDQ A;  3GHF A;  3DJA A;  1T6R A;  3GVJ A;  5EUZ A;  1FC9 A;  1TIL B;  3VSE A;  4XS5 A;  3LLO A;  1THN B;  3GVL A;  1TH8 B;  4L1C A;  3C0K A;  1WXW A;  1H4Z A; 
#chains in the Genus database with same CATH homology
 5EUW A;  3AGD A;  3IH9 A;  3IHB A;  5EZB A;  1AUZ A;  2KA5 A;  3NY7 A;  3MGL A;  1VC1 A;  5EUU A;  1H4X A;  4QTP A;  1BUZ A;  1TID B;  2KLN A;  2VY9 A;  5EUS A;  1H4Y A;  3IH8 A;  3IHA A;  1T6R A;  5EUZ A;  3ZXN A;  4DGF A;  3AGE A;  3LKL A;  3OIR A;  3T6O A;  1TIL B;  4HYL A;  3OIZ A;  3F43 A;  3LLO A;  1SBO A;  4XS5 A;  4DGH A;  1THN B;  5EUX A;  3ZTB A;  1TH8 B;  1H4Z A;  3IF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...