1TH8B

Crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
SLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDSSGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-sigma F factor
publication title Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 40
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1th8B00
1AUZA 5EUSA 3NY7A 2KLNA 1H4XA 3OIZA 1BUZA 4DGFA 3AGEA 4HYLA 1TIDB 2VY9A 3AGDA 4DGHA 1VC1A 1TH8B 3MGLA 4XS5A 1THNB 5EUZA 3LLOA 3T6OA 4QTPA 3IH9A 5EUXA 3OIRA 5EZBA 1SBOA 3ZXNA 1H4YA 3F43A 1H4ZA 1TILB 5EUUA 3IHBA 3ZTBA 3IF5A 3LKLA 2KA5A 5EUWA 3IH8A 3IHAA 1T6RA
chains in the Genus database with same CATH superfamily
3LDFA 4AE2A 1N6EA 1H4XA 1BPLA 2B78A 3C0KA 3AGDA 1K32A 3V97A 2RRLA 4XS5A 3LLOA 3D3UA 5EZBA 3ZXNA 1H4ZA 1TILB 5EUUA 3IF5A 2KA5A 3EH7A 1N6FA 4DGFA 4DMGA 2VY9A 4DGHA 1VC1A 2AS0A 1THNB 3T6OA 1HF2A 1FC7A 1H4YA 3F43A 4JC0A 3GVLA 3LKLA 3GVKA 3JU4A 3D03A 2ZO9B 1BUZA 2DXLA 4AEJA 1TIDB 1FC9A 3DJAA 3MGLA 1J7XA 3K50A 2ZOAA 1WXWA 3GVJA 3MOGA 4QTPA 1WXXA 3VSEA 5EUXA 3DUPA 1V0EA 1FCFA 2DXNA 3IHBA 4L8KA 5EUWA 3IHAA 1T6RA 1N6DA 2OASA 5EUSA 3NY7A 2KLNA 3OIZA 4GHNA 3AGEA 4HYLA 3QDQA 3DORA 1FC6A 1TH8B 2CWWA 5EUZA 4L1CA 3IH9A 3OIRA 4HIZA 1SBOA 1V0FA 3V8VA 3ZTBA 3GMFA 3IH8A 3GHFA 1AUZA 3GK7A
chains in the Genus database with same CATH topology
1AUZA 5EUSA 3NY7A 2KLNA 1H4XA 3OIZA 1BUZA 4DGFA 3AGEA 4HYLA 1TIDB 2VY9A 3AGDA 4DGHA 1VC1A 1TH8B 3MGLA 4XS5A 1THNB 5EUZA 3LLOA 3T6OA 4QTPA 3IH9A 5EUXA 3OIRA 5EZBA 1SBOA 3ZXNA 1H4YA 3F43A 1H4ZA 1TILB 5EUUA 3IHBA 3ZTBA 3IF5A 3LKLA 2KA5A 5EUWA 3IH8A 3IHAA 1T6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUZ A;  5EUS A;  3NY7 A;  2KLN A;  1H4X A;  3OIZ A;  1BUZ A;  4DGF A;  3AGE A;  4HYL A;  1TID B;  2VY9 A;  3AGD A;  4DGH A;  1VC1 A;  1TH8 B;  3MGL A;  4XS5 A;  1THN B;  5EUZ A;  3LLO A;  3T6O A;  4QTP A;  3IH9 A;  5EUX A;  3OIR A;  5EZB A;  1SBO A;  3ZXN A;  1H4Y A;  3F43 A;  1H4Z A;  1TIL B;  5EUU A;  3IHB A;  3ZTB A;  3IF5 A;  3LKL A;  2KA5 A;  5EUW A;  3IH8 A;  3IHA A;  1T6R A; 
#chains in the Genus database with same CATH topology
 3LDF A;  4AE2 A;  1N6E A;  1H4X A;  1BPL A;  2B78 A;  3C0K A;  3AGD A;  1K32 A;  3V97 A;  2RRL A;  4XS5 A;  3LLO A;  3D3U A;  5EZB A;  3ZXN A;  1H4Z A;  1TIL B;  5EUU A;  3IF5 A;  2KA5 A;  3EH7 A;  1N6F A;  4DGF A;  4DMG A;  2VY9 A;  4DGH A;  1VC1 A;  2AS0 A;  1THN B;  3T6O A;  1HF2 A;  1FC7 A;  1H4Y A;  3F43 A;  4JC0 A;  3GVL A;  3LKL A;  3GVK A;  3JU4 A;  3D03 A;  2ZO9 B;  1BUZ A;  2DXL A;  4AEJ A;  1TID B;  1FC9 A;  3DJA A;  3MGL A;  1J7X A;  3K50 A;  2ZOA A;  1WXW A;  3GVJ A;  3MOG A;  4QTP A;  1WXX A;  3VSE A;  5EUX A;  3DUP A;  1V0E A;  1FCF A;  2DXN A;  3IHB A;  4L8K A;  5EUW A;  3IHA A;  1T6R A;  1N6D A;  2OAS A;  5EUS A;  3NY7 A;  2KLN A;  3OIZ A;  4GHN A;  3AGE A;  4HYL A;  3QDQ A;  3DOR A;  1FC6 A;  1TH8 B;  2CWW A;  5EUZ A;  4L1C A;  3IH9 A;  3OIR A;  4HIZ A;  1SBO A;  1V0F A;  3V8V A;  3ZTB A;  3GMF A;  3IH8 A;  3GHF A;  1AUZ A;  3GK7 A; 
#chains in the Genus database with same CATH homology
 1AUZ A;  5EUS A;  3NY7 A;  2KLN A;  1H4X A;  3OIZ A;  1BUZ A;  4DGF A;  3AGE A;  4HYL A;  1TID B;  2VY9 A;  3AGD A;  4DGH A;  1VC1 A;  1TH8 B;  3MGL A;  4XS5 A;  1THN B;  5EUZ A;  3LLO A;  3T6O A;  4QTP A;  3IH9 A;  5EUX A;  3OIR A;  5EZB A;  1SBO A;  3ZXN A;  1H4Y A;  3F43 A;  1H4Z A;  1TIL B;  5EUU A;  3IHB A;  3ZTB A;  3IF5 A;  3LKL A;  2KA5 A;  5EUW A;  3IH8 A;  3IHA A;  1T6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...