1TH8B

Crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
SLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDSSGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Anti-sigma F factor
publication title Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 40
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1th8B00
3MGLA 2VY9A 3AGDA 1TH8B 3OIRA 1VC1A 5EUZA 5EUUA 1TILB 5EUXA 3LKLA 3IHAA 3NY7A 5EUSA 3ZXNA 1TIDB 3AGEA 3IHBA 4HYLA 4XS5A 3T6OA 1H4XA 3F43A 3IF5A 2KA5A 3LLOA 1H4YA 1THNB 3ZTBA 3OIZA 1SBOA 1T6RA 5EUWA 4DGHA 3IH9A 4DGFA 1H4ZA 4QTPA 2KLNA 1AUZA 5EZBA 1BUZA 3IH8A
chains in the Genus database with same CATH superfamily
2VY9A 3GHFA 2B78A 5EUXA 1TIDB 1BPLA 3GMFA 1J7XA 1FC9A 2OASA 3JU4A 1V0FA 3QDQA 4AE2A 1THNB 3GVLA 1H4ZA 4QTPA 2KLNA 2DXNA 3IH8A 3VSEA 1N6FA 1TH8B 3C0KA 3OIRA 4JC0A 1VC1A 4L8KA 5EUUA 1WXWA 1N6EA 2CWWA 5EUSA 2DXLA 2ZOAA 3ZXNA 2ZO9B 1V0EA 3F43A 1FC6A 3K50A 2KA5A 3LLOA 3GVJA 3DUPA 1H4YA 3V8VA 3EH7A 3IH9A 4L1CA 3LDFA 5EZBA 1BUZA 2RRLA 3MGLA 3AGDA 1N6DA 3LKLA 3AGEA 3IHBA 4AEJA 4XS5A 3IF5A 3GK7A 4DMGA 3OIZA 3MOGA 1SBOA 1T6RA 4GHNA 3D3UA 4DGHA 3DJAA 4DGFA 1AUZA 5EUZA 1TILB 3DORA 1HF2A 3IHAA 3NY7A 1FCFA 1FC7A 1K32A 4HYLA 3D03A 3T6OA 1H4XA 3GVKA 4HIZA 2AS0A 3ZTBA 1WXXA 3V97A 5EUWA
chains in the Genus database with same CATH topology
3MGLA 2VY9A 3AGDA 1TH8B 3OIRA 1VC1A 5EUZA 5EUUA 1TILB 5EUXA 3LKLA 3IHAA 3NY7A 5EUSA 3ZXNA 1TIDB 3AGEA 3IHBA 4HYLA 4XS5A 3T6OA 1H4XA 3F43A 3IF5A 2KA5A 3LLOA 1H4YA 1THNB 3ZTBA 3OIZA 1SBOA 1T6RA 5EUWA 4DGHA 3IH9A 4DGFA 1H4ZA 4QTPA 2KLNA 1AUZA 5EZBA 1BUZA 3IH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGL A;  2VY9 A;  3AGD A;  1TH8 B;  3OIR A;  1VC1 A;  5EUZ A;  5EUU A;  1TIL B;  5EUX A;  3LKL A;  3IHA A;  3NY7 A;  5EUS A;  3ZXN A;  1TID B;  3AGE A;  3IHB A;  4HYL A;  4XS5 A;  3T6O A;  1H4X A;  3F43 A;  3IF5 A;  2KA5 A;  3LLO A;  1H4Y A;  1THN B;  3ZTB A;  3OIZ A;  1SBO A;  1T6R A;  5EUW A;  4DGH A;  3IH9 A;  4DGF A;  1H4Z A;  4QTP A;  2KLN A;  1AUZ A;  5EZB A;  1BUZ A;  3IH8 A; 
#chains in the Genus database with same CATH topology
 2VY9 A;  3GHF A;  2B78 A;  5EUX A;  1TID B;  1BPL A;  3GMF A;  1J7X A;  1FC9 A;  2OAS A;  3JU4 A;  1V0F A;  3QDQ A;  4AE2 A;  1THN B;  3GVL A;  1H4Z A;  4QTP A;  2KLN A;  2DXN A;  3IH8 A;  3VSE A;  1N6F A;  1TH8 B;  3C0K A;  3OIR A;  4JC0 A;  1VC1 A;  4L8K A;  5EUU A;  1WXW A;  1N6E A;  2CWW A;  5EUS A;  2DXL A;  2ZOA A;  3ZXN A;  2ZO9 B;  1V0E A;  3F43 A;  1FC6 A;  3K50 A;  2KA5 A;  3LLO A;  3GVJ A;  3DUP A;  1H4Y A;  3V8V A;  3EH7 A;  3IH9 A;  4L1C A;  3LDF A;  5EZB A;  1BUZ A;  2RRL A;  3MGL A;  3AGD A;  1N6D A;  3LKL A;  3AGE A;  3IHB A;  4AEJ A;  4XS5 A;  3IF5 A;  3GK7 A;  4DMG A;  3OIZ A;  3MOG A;  1SBO A;  1T6R A;  4GHN A;  3D3U A;  4DGH A;  3DJA A;  4DGF A;  1AUZ A;  5EUZ A;  1TIL B;  3DOR A;  1HF2 A;  3IHA A;  3NY7 A;  1FCF A;  1FC7 A;  1K32 A;  4HYL A;  3D03 A;  3T6O A;  1H4X A;  3GVK A;  4HIZ A;  2AS0 A;  3ZTB A;  1WXX A;  3V97 A;  5EUW A; 
#chains in the Genus database with same CATH homology
 3MGL A;  2VY9 A;  3AGD A;  1TH8 B;  3OIR A;  1VC1 A;  5EUZ A;  5EUU A;  1TIL B;  5EUX A;  3LKL A;  3IHA A;  3NY7 A;  5EUS A;  3ZXN A;  1TID B;  3AGE A;  3IHB A;  4HYL A;  4XS5 A;  3T6O A;  1H4X A;  3F43 A;  3IF5 A;  2KA5 A;  3LLO A;  1H4Y A;  1THN B;  3ZTB A;  3OIZ A;  1SBO A;  1T6R A;  5EUW A;  4DGH A;  3IH9 A;  4DGF A;  1H4Z A;  4QTP A;  2KLN A;  1AUZ A;  5EZB A;  1BUZ A;  3IH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...