3GHFA

Crystal structure of the septum site-determining protein minc from salmonella typhimurium
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
PIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septum site-determining protein minC
publication title Crystal structure of the septum site-determining protein minC from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium lt2
molecule tags Cell cycle
total genus 27
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.120 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 3ghfA00
3GHFA 4L1CA
chains in the Genus database with same CATH superfamily
3V97A 4DGHA 3V8VA 5EUWA 3ZXNA 4DMGA 1N6EA 5EUZA 2ZOAA 3D03A 3DUPA 2OASA 1FC7A 2KA5A 3DJAA 3GMFA 3AGEA 3GK7A 2B78A 4DGFA 4XS5A 3C0KA 1THNB 1HF2A 1BUZA 3IHAA 5EZBA 1FCFA 1FC6A 1SBOA 3LKLA 3T6OA 2AS0A 3IH8A 4HYLA 3NY7A 3GVJA 3OIZA 4AE2A 1H4ZA 1T6RA 4GHNA 1VC1A 2VY9A 3IHBA 1K32A 3MOGA 3GVKA 1TILB 1H4XA 3ZTBA 3D3UA 3IF5A 5EUUA 3QDQA 4QTPA 1J7XA 2RRLA 3F43A 5EUSA 3IH9A 4AEJA 3MGLA 1FC9A 3GHFA 3LLOA 3JU4A 2DXLA 3K50A 1TH8B 1BPLA 5EUXA 3GVLA 4JC0A 4L8KA 1H4YA 2DXNA 3LDFA 3VSEA 1V0EA 1N6FA 3DORA 1V0FA 3OIRA 1N6DA 2ZO9B 1TIDB 4HIZA 1WXWA 3AGDA 4L1CA 2CWWA 2KLNA 3EH7A 1AUZA 1WXXA
chains in the Genus database with same CATH topology
1FCFA 3K50A 1FC6A 1BPLA 1N6EA 2ZOAA 3D03A 1J7XA 4JC0A 2RRLA 4L8KA 3DUPA 2DXNA 1FC7A 3DJAA 3GMFA 1N6FA 3DORA 4AE2A 4GHNA 1N6DA 4AEJA 2ZO9B 1FC9A 4L1CA 1K32A 3GHFA 3MOGA 2DXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHF A;  4L1C A; 
#chains in the Genus database with same CATH topology
 3V97 A;  4DGH A;  3V8V A;  5EUW A;  3ZXN A;  4DMG A;  1N6E A;  5EUZ A;  2ZOA A;  3D03 A;  3DUP A;  2OAS A;  1FC7 A;  2KA5 A;  3DJA A;  3GMF A;  3AGE A;  3GK7 A;  2B78 A;  4DGF A;  4XS5 A;  3C0K A;  1THN B;  1HF2 A;  1BUZ A;  3IHA A;  5EZB A;  1FCF A;  1FC6 A;  1SBO A;  3LKL A;  3T6O A;  2AS0 A;  3IH8 A;  4HYL A;  3NY7 A;  3GVJ A;  3OIZ A;  4AE2 A;  1H4Z A;  1T6R A;  4GHN A;  1VC1 A;  2VY9 A;  3IHB A;  1K32 A;  3MOG A;  3GVK A;  1TIL B;  1H4X A;  3ZTB A;  3D3U A;  3IF5 A;  5EUU A;  3QDQ A;  4QTP A;  1J7X A;  2RRL A;  3F43 A;  5EUS A;  3IH9 A;  4AEJ A;  3MGL A;  1FC9 A;  3GHF A;  3LLO A;  3JU4 A;  2DXL A;  3K50 A;  1TH8 B;  1BPL A;  5EUX A;  3GVL A;  4JC0 A;  4L8K A;  1H4Y A;  2DXN A;  3LDF A;  3VSE A;  1V0E A;  1N6F A;  3DOR A;  1V0F A;  3OIR A;  1N6D A;  2ZO9 B;  1TID B;  4HIZ A;  1WXW A;  3AGD A;  4L1C A;  2CWW A;  2KLN A;  3EH7 A;  1AUZ A;  1WXX A; 
#chains in the Genus database with same CATH homology
 1FCF A;  3K50 A;  1FC6 A;  1BPL A;  1N6E A;  2ZOA A;  3D03 A;  1J7X A;  4JC0 A;  2RRL A;  4L8K A;  3DUP A;  2DXN A;  1FC7 A;  3DJA A;  3GMF A;  1N6F A;  3DOR A;  4AE2 A;  4GHN A;  1N6D A;  4AEJ A;  2ZO9 B;  1FC9 A;  4L1C A;  1K32 A;  3GHF A;  3MOG A;  2DXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...