3GHFA

Crystal structure of the septum site-determining protein minc from salmonella typhimurium
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
PIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVNWPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Septum site-determining protein minC
publication title Crystal structure of the septum site-determining protein minC from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium lt2
total genus 27
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.120 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA Transcription Regulator spoIIAA 3ghfA00
3GHFA 4L1CA
chains in the Genus database with same CATH superfamily
4QTPA 1J7XA 3GVKA 2VY9A 3D03A 1WXWA 1AUZA 3GHFA 5EZBA 1WXXA 3GVLA 1FCFA 3IF5A 3EH7A 2AS0A 3VSEA 3C0KA 5EUUA 3JU4A 3LKLA 3LLOA 3D3UA 4L1CA 2B78A 3V97A 3MOGA 4AEJA 1BUZA 3AGDA 2DXLA 3AGEA 1TH8B 4HYLA 2ZOAA 4DGFA 1H4YA 3IHAA 3T6OA 1TILB 3DUPA 3GVJA 1HF2A 3IHBA 2OASA 1H4ZA 1K32A 3GMFA 1BPLA 3ZXNA 5EUZA 1V0EA 2KLNA 4HIZA 4DMGA 1T6RA 1N6EA 1SBOA 3F43A 3GK7A 2KA5A 4DGHA 1FC6A 1FC9A 2RRLA 3OIRA 2CWWA 1N6FA 3DORA 3V8VA 2DXNA 2ZO9B 1FC7A 4JC0A 3K50A 1V0FA 5EUSA 5EUWA 4AE2A 3ZTBA 4GHNA 3OIZA 1N6DA 1VC1A 3IH9A 1TIDB 3LDFA 1H4XA 5EUXA 4L8KA 3QDQA 3NY7A 3MGLA 3DJAA 1THNB 4XS5A 3IH8A
chains in the Genus database with same CATH topology
2DXLA 1J7XA 4AE2A 1N6EA 3D03A 4GHNA 1N6DA 3GHFA 2ZOAA 1FC6A 1FC9A 1FCFA 4L8KA 2RRLA 3DUPA 1N6FA 3DJAA 4L1CA 1K32A 3DORA 3GMFA 1BPLA 2DXNA 2ZO9B 1FC7A 3MOGA 4JC0A 4AEJA 3K50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHF A;  4L1C A; 
#chains in the Genus database with same CATH topology
 4QTP A;  1J7X A;  3GVK A;  2VY9 A;  3D03 A;  1WXW A;  1AUZ A;  3GHF A;  5EZB A;  1WXX A;  3GVL A;  1FCF A;  3IF5 A;  3EH7 A;  2AS0 A;  3VSE A;  3C0K A;  5EUU A;  3JU4 A;  3LKL A;  3LLO A;  3D3U A;  4L1C A;  2B78 A;  3V97 A;  3MOG A;  4AEJ A;  1BUZ A;  3AGD A;  2DXL A;  3AGE A;  1TH8 B;  4HYL A;  2ZOA A;  4DGF A;  1H4Y A;  3IHA A;  3T6O A;  1TIL B;  3DUP A;  3GVJ A;  1HF2 A;  3IHB A;  2OAS A;  1H4Z A;  1K32 A;  3GMF A;  1BPL A;  3ZXN A;  5EUZ A;  1V0E A;  2KLN A;  4HIZ A;  4DMG A;  1T6R A;  1N6E A;  1SBO A;  3F43 A;  3GK7 A;  2KA5 A;  4DGH A;  1FC6 A;  1FC9 A;  2RRL A;  3OIR A;  2CWW A;  1N6F A;  3DOR A;  3V8V A;  2DXN A;  2ZO9 B;  1FC7 A;  4JC0 A;  3K50 A;  1V0F A;  5EUS A;  5EUW A;  4AE2 A;  3ZTB A;  4GHN A;  3OIZ A;  1N6D A;  1VC1 A;  3IH9 A;  1TID B;  3LDF A;  1H4X A;  5EUX A;  4L8K A;  3QDQ A;  3NY7 A;  3MGL A;  3DJA A;  1THN B;  4XS5 A;  3IH8 A; 
#chains in the Genus database with same CATH homology
 2DXL A;  1J7X A;  4AE2 A;  1N6E A;  3D03 A;  4GHN A;  1N6D A;  3GHF A;  2ZOA A;  1FC6 A;  1FC9 A;  1FCF A;  4L8K A;  2RRL A;  3DUP A;  1N6F A;  3DJA A;  4L1C A;  1K32 A;  3DOR A;  3GMF A;  1BPL A;  2DXN A;  2ZO9 B;  1FC7 A;  3MOG A;  4JC0 A;  4AEJ A;  3K50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...