3OIZA

Crystal structure of antisigma-factor antagonist, stas domain from rhodobacter sphaeroides
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
SNALFGVTSELSKDGRERIYRVEGQLFYASVEDFMAAFDFREALDRVVIDVSRAHIWDISSVQALDMAVLKFRREGAEVRIVGMNEASETMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Antisigma-factor antagonist, STAS
publication title Crystal structure of antisigma-factor antagonist, STAS domain from Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Membrane protein
total genus 26
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3oizA00
5EUSA 2KLNA 1H4YA 4QTPA 3T6OA 1T6RA 3IH8A 3AGEA 3IHBA 4DGFA 3OIZA 1H4XA 3NY7A 3IHAA 1TH8B 3IF5A 1H4ZA 3LKLA 5EZBA 4HYLA 1THNB 5EUXA 3F43A 1BUZA 2KA5A 3MGLA 3AGDA 3LLOA 3IH9A 1AUZA 5EUWA 3ZTBA 3OIRA 2VY9A 5EUUA 4DGHA 1SBOA 1TIDB 3ZXNA 4XS5A 1VC1A 1TILB 5EUZA
chains in the Genus database with same CATH superfamily
1T6RA 1V0FA 3AGEA 3IHBA 3JU4A 1WXWA 3OIZA 4DMGA 3V8VA 3LDFA 1TH8B 2ZO9B 2CWWA 3IH9A 1AUZA 1WXXA 3ZTBA 3GK7A 3GVJA 2VY9A 1SBOA 1TIDB 3V97A 1FC7A 1VC1A 1TILB 5EUSA 1N6DA 4AEJA 4QTPA 2ZOAA 3GHFA 3IH8A 1FC6A 2B78A 3DORA 3GVKA 3VSEA 3IHAA 3IF5A 2OASA 4HYLA 1THNB 5EUXA 3F43A 1BUZA 3MGLA 3LLOA 2DXLA 1BPLA 3ZXNA 3EH7A 2RRLA 3DJAA 4HIZA 4XS5A 5EUZA 3T6OA 1HF2A 4DGFA 3DUPA 3NY7A 1J7XA 1K32A 5EZBA 1H4ZA 1V0EA 1FC9A 2KA5A 3AGDA 4JC0A 3OIRA 2AS0A 3QDQA 3D3UA 5EUWA 2KLNA 1H4YA 4L1CA 3MOGA 1H4XA 3LKLA 3GVLA 3D03A 1N6EA 4L8KA 3GMFA 3K50A 4AE2A 5EUUA 4DGHA 1FCFA 4GHNA 1N6FA 3C0KA 2DXNA
chains in the Genus database with same CATH topology
5EUSA 2KLNA 1H4YA 4QTPA 3T6OA 1T6RA 3IH8A 3AGEA 3IHBA 4DGFA 3OIZA 1H4XA 3NY7A 3IHAA 1TH8B 3IF5A 1H4ZA 3LKLA 5EZBA 4HYLA 1THNB 5EUXA 3F43A 1BUZA 2KA5A 3MGLA 3AGDA 3LLOA 3IH9A 1AUZA 5EUWA 3ZTBA 3OIRA 2VY9A 5EUUA 4DGHA 1SBOA 1TIDB 3ZXNA 4XS5A 1VC1A 1TILB 5EUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EUS A;  2KLN A;  1H4Y A;  4QTP A;  3T6O A;  1T6R A;  3IH8 A;  3AGE A;  3IHB A;  4DGF A;  3OIZ A;  1H4X A;  3NY7 A;  3IHA A;  1TH8 B;  3IF5 A;  1H4Z A;  3LKL A;  5EZB A;  4HYL A;  1THN B;  5EUX A;  3F43 A;  1BUZ A;  2KA5 A;  3MGL A;  3AGD A;  3LLO A;  3IH9 A;  1AUZ A;  5EUW A;  3ZTB A;  3OIR A;  2VY9 A;  5EUU A;  4DGH A;  1SBO A;  1TID B;  3ZXN A;  4XS5 A;  1VC1 A;  1TIL B;  5EUZ A; 
#chains in the Genus database with same CATH topology
 1T6R A;  1V0F A;  3AGE A;  3IHB A;  3JU4 A;  1WXW A;  3OIZ A;  4DMG A;  3V8V A;  3LDF A;  1TH8 B;  2ZO9 B;  2CWW A;  3IH9 A;  1AUZ A;  1WXX A;  3ZTB A;  3GK7 A;  3GVJ A;  2VY9 A;  1SBO A;  1TID B;  3V97 A;  1FC7 A;  1VC1 A;  1TIL B;  5EUS A;  1N6D A;  4AEJ A;  4QTP A;  2ZOA A;  3GHF A;  3IH8 A;  1FC6 A;  2B78 A;  3DOR A;  3GVK A;  3VSE A;  3IHA A;  3IF5 A;  2OAS A;  4HYL A;  1THN B;  5EUX A;  3F43 A;  1BUZ A;  3MGL A;  3LLO A;  2DXL A;  1BPL A;  3ZXN A;  3EH7 A;  2RRL A;  3DJA A;  4HIZ A;  4XS5 A;  5EUZ A;  3T6O A;  1HF2 A;  4DGF A;  3DUP A;  3NY7 A;  1J7X A;  1K32 A;  5EZB A;  1H4Z A;  1V0E A;  1FC9 A;  2KA5 A;  3AGD A;  4JC0 A;  3OIR A;  2AS0 A;  3QDQ A;  3D3U A;  5EUW A;  2KLN A;  1H4Y A;  4L1C A;  3MOG A;  1H4X A;  3LKL A;  3GVL A;  3D03 A;  1N6E A;  4L8K A;  3GMF A;  3K50 A;  4AE2 A;  5EUU A;  4DGH A;  1FCF A;  4GHN A;  1N6F A;  3C0K A;  2DXN A; 
#chains in the Genus database with same CATH homology
 5EUS A;  2KLN A;  1H4Y A;  4QTP A;  3T6O A;  1T6R A;  3IH8 A;  3AGE A;  3IHB A;  4DGF A;  3OIZ A;  1H4X A;  3NY7 A;  3IHA A;  1TH8 B;  3IF5 A;  1H4Z A;  3LKL A;  5EZB A;  4HYL A;  1THN B;  5EUX A;  3F43 A;  1BUZ A;  2KA5 A;  3MGL A;  3AGD A;  3LLO A;  3IH9 A;  1AUZ A;  5EUW A;  3ZTB A;  3OIR A;  2VY9 A;  5EUU A;  4DGH A;  1SBO A;  1TID B;  3ZXN A;  4XS5 A;  1VC1 A;  1TIL B;  5EUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...