The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
147
|
structure length |
127
|
Chain Sequence |
FLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQSPPPPPSFCTV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis for the inhibition of porcine pepsin by Ascaris pepsin inhibitor-3.
pubmed doi rcsb |
molecule tags |
Hydrolase inhibitor
|
source organism |
Ascaris suum
|
molecule keywords |
MAJOR PEPSIN INHIBITOR PI-3
|
total genus |
33
|
structure length |
127
|
sequence length |
147
|
ec nomenclature | |
pdb deposition date | 2000-05-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF06394 | Pepsin-I3 | Pepsin inhibitor-3-like repeated domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | Pepsin inhibitor-3 | ||
Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | Pepsin inhibitor-3 |
#chains in the Genus database with same CATH superfamily 1F34 B; 1F32 A; #chains in the Genus database with same CATH topology 4NK7 A; 1E33 P; 1Q4O A; 4NKB A; 2N19 A; 4H5X A; 4CYS A; 3ED4 A; 4X9W A; 4O56 A; 4E67 A; 4CXK A; 3P35 A; 3Q1I A; 5DMS A; 4E9D A; 3BZI A; 4G7N A; 4O6W A; 4O9W A; 2I9Z A; 4FDI A; 3GYV A; 3FS3 A; 4LKL A; 4XB0 A; 1AUK A; 3LXQ A; 4WHH A; 4HY2 A; 1N2K A; 3KDR A; 3C5L A; 3HIK A; 1F32 A; 3P36 A; 4WHK A; 4DFW A; 2VKZ G; 4N7V A; 3P2Z A; 2OJX A; 4YYP A; 5AJ9 A; 1E1Z P; 1A87 A; 4RCP A; 5DMV C; 4X9R A; 3P37 A; 5LHZ A; 3HMJ G; 4J7B B; 1Q4K A; 1F34 B; 3FVH A; 3GYW A; 5J19 A; 1HDH A; 4E9C A; 4LKM A; 3HIH A; 2I9X A; 4HCO A; 1FSU A; 3HFD A; 5DAY A; 1N2L A; 3RQ7 A; 4CYR A; 2QZU A; 4CXS A; 3P2W A; 1E2T A; 1P49 A; 4WHL A; 2E50 A; 4HAB A; 2UV8 G; 1E3C P; 3P34 A; 4RS6 A; 2IA9 A; 3LM3 A; 4H71 A; 1E2S P; 4N7Z A; 2OGQ A; 4N9J A; 4CXU A; 1UMW A; 5DNJ A; 4FDJ A; 4X9V A; #chains in the Genus database with same CATH homology 1F34 B; 1F32 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...