4WHLA

A new class of peptidomimetics targeting the polo-box domain of polo-like kinase 1
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
222
structure length
216
Chain Sequence
DCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITLARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A new class of peptidomimetics targeting the polo-box domain of polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
total genus 67
structure length 216
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4whlA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4whlA01
3HIHA 4LKMA 4X9RA 4RCPA 3P2ZA 3P35A 4HABA 4H71A 5DMSA 4E9CA 4WHKA 3RQ7A 3HIKA 3FVHA 5J19A 4HY2A 2OGQA 1UMWA 3P34A 5DNJA 5LHZA 3Q1IA 4DFWA 4X9WA 2N19A 1Q4OA 4E9DA 4YYPA 5DMVC 3P36A 4WHLA 1Q4KA 4E67A 4RS6A 4H5XA 4O9WA 3C5LA 4O6WA 4LKLA 4X9VA 4HCOA 3P37A 4WHHA 2OJXA 4XB0A 4J7BB 3P2WA 4O56A 3BZIA
chains in the Genus database with same CATH superfamily
2UV8G 4LKMA 1P49A 4RCPA 2IA9A 3P2ZA 1A87A 2QZUA 5AJ9A 4N7VA 4HY2A 1E3CP 4NKBA 4X9WA 2N19A 3GYVA 4NK7A 4CXKA 4H5XA 4O6WA 4LKLA 4X9VA 4N7ZA 4G7NA 2VKZG 3HMJG 4J7BB 4CXUA 3BZIA 1E2TA 1E1ZP 4HABA 5DMSA 4E9CA 3RQ7A 5J19A 2OGQA 1E2SP 1Q4OA 2E50A 4CYSA 4E67A 3LM3A 3P37A 3FS3A 5DAYA 2I9ZA 4FDIA 4X9RA 3P35A 4CYRA 1F34B 3FVHA 1E33P 5LHZA 5DNJA 2I9XA 1FSUA 4CXSA 3Q1IA 5DMVC 3GYWA 3P36A 3C5LA 1AUKA 4WHHA 2OJXA 4XB0A 3P2WA 4O56A 3HFDA 4FDJA 1HDHA 3HIHA 4N9JA 1F32A 3LXQA 4H71A 4WHKA 3HIKA 1UMWA 3P34A 4DFWA 4YYPA 4E9DA 3ED4A 4WHLA 1N2LA 1Q4KA 1N2KA 4RS6A 4O9WA 4HCOA 3KDRA
chains in the Genus database with same CATH topology
3HIHA 4LKMA 4X9RA 4RCPA 3P2ZA 3P35A 4HABA 4H71A 5DMSA 4E9CA 4WHKA 3RQ7A 3HIKA 3FVHA 5J19A 4HY2A 2OGQA 1UMWA 3P34A 5DNJA 5LHZA 3Q1IA 4DFWA 4X9WA 2N19A 1Q4OA 4E9DA 4YYPA 5DMVC 3P36A 4WHLA 1Q4KA 4E67A 4RS6A 4H5XA 4O9WA 3C5LA 4O6WA 4LKLA 4X9VA 4HCOA 3P37A 4WHHA 2OJXA 4XB0A 4J7BB 3P2WA 4O56A 3BZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIH A;  4LKM A;  4X9R A;  4RCP A;  3P2Z A;  3P35 A;  4HAB A;  4H71 A;  5DMS A;  4E9C A;  4WHK A;  3RQ7 A;  3HIK A;  3FVH A;  5J19 A;  4HY2 A;  2OGQ A;  1UMW A;  3P34 A;  5DNJ A;  5LHZ A;  3Q1I A;  4DFW A;  4X9W A;  2N19 A;  1Q4O A;  4E9D A;  4YYP A;  5DMV C;  3P36 A;  4WHL A;  1Q4K A;  4E67 A;  4RS6 A;  4H5X A;  4O9W A;  3C5L A;  4O6W A;  4LKL A;  4X9V A;  4HCO A;  3P37 A;  4WHH A;  2OJX A;  4XB0 A;  4J7B B;  3P2W A;  4O56 A;  3BZI A; 
#chains in the Genus database with same CATH topology
 2UV8 G;  4LKM A;  1P49 A;  4RCP A;  2IA9 A;  3P2Z A;  1A87 A;  2QZU A;  5AJ9 A;  4N7V A;  4HY2 A;  1E3C P;  4NKB A;  4X9W A;  2N19 A;  3GYV A;  4NK7 A;  4CXK A;  4H5X A;  4O6W A;  4LKL A;  4X9V A;  4N7Z A;  4G7N A;  2VKZ G;  3HMJ G;  4J7B B;  4CXU A;  3BZI A;  1E2T A;  1E1Z P;  4HAB A;  5DMS A;  4E9C A;  3RQ7 A;  5J19 A;  2OGQ A;  1E2S P;  1Q4O A;  2E50 A;  4CYS A;  4E67 A;  3LM3 A;  3P37 A;  3FS3 A;  5DAY A;  2I9Z A;  4FDI A;  4X9R A;  3P35 A;  4CYR A;  1F34 B;  3FVH A;  1E33 P;  5LHZ A;  5DNJ A;  2I9X A;  1FSU A;  4CXS A;  3Q1I A;  5DMV C;  3GYW A;  3P36 A;  3C5L A;  1AUK A;  4WHH A;  2OJX A;  4XB0 A;  3P2W A;  4O56 A;  3HFD A;  4FDJ A;  1HDH A;  3HIH A;  4N9J A;  1F32 A;  3LXQ A;  4H71 A;  4WHK A;  3HIK A;  1UMW A;  3P34 A;  4DFW A;  4YYP A;  4E9D A;  3ED4 A;  4WHL A;  1N2L A;  1Q4K A;  1N2K A;  4RS6 A;  4O9W A;  4HCO A;  3KDR A; 
#chains in the Genus database with same CATH homology
 3HIH A;  4LKM A;  4X9R A;  4RCP A;  3P2Z A;  3P35 A;  4HAB A;  4H71 A;  5DMS A;  4E9C A;  4WHK A;  3RQ7 A;  3HIK A;  3FVH A;  5J19 A;  4HY2 A;  2OGQ A;  1UMW A;  3P34 A;  5DNJ A;  5LHZ A;  3Q1I A;  4DFW A;  4X9W A;  2N19 A;  1Q4O A;  4E9D A;  4YYP A;  5DMV C;  3P36 A;  4WHL A;  1Q4K A;  4E67 A;  4RS6 A;  4H5X A;  4O9W A;  3C5L A;  4O6W A;  4LKL A;  4X9V A;  4HCO A;  3P37 A;  4WHH A;  2OJX A;  4XB0 A;  4J7B B;  3P2W A;  4O56 A;  3BZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...