4WHLA

A new class of peptidomimetics targeting the polo-box domain of polo-like kinase 1
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
222
structure length
216
Chain Sequence
DCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITLARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
publication title A new class of peptidomimetics targeting the polo-box domain of polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 216
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4whlA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4whlA01
3C5LA 3Q1IA 4O6WA 4X9VA 4XB0A 5LHZA 4HABA 3P36A 2OGQA 1Q4KA 4E67A 3P34A 4RS6A 1UMWA 3HIKA 3RQ7A 4WHLA 4LKMA 1Q4OA 4H71A 3P35A 4WHHA 5DMSA 4RCPA 5DNJA 3BZIA 4E9CA 4H5XA 4YYPA 2N19A 4J7BB 4WHKA 4DFWA 4LKLA 3HIHA 4HCOA 4HY2A 3P37A 3P2WA 4X9RA 5J19A 4O9WA 2OJXA 4O56A 3FVHA 4X9WA 4E9DA 5DMVC 3P2ZA
chains in the Genus database with same CATH superfamily
3C5LA 3Q1IA 4XB0A 5LHZA 2OGQA 4FDIA 1A87A 3KDRA 1UMWA 3FS3A 1HDHA 4H71A 4NK7A 5DMSA 3BZIA 4E9CA 1E2SP 3LXQA 4YYPA 4J7BB 4G7NA 3HIHA 3P37A 2OJXA 3FVHA 5AJ9A 4HABA 3P36A 1E33P 4RS6A 3RQ7A 4LKMA 3HFDA 4WHHA 1F32A 5DAYA 4RCPA 1FSUA 3ED4A 4DFWA 4WHKA 2UV8G 4LKLA 1E3CP 4CYSA 3GYWA 3LM3A 4E9DA 1F34B 4N7ZA 2VKZG 4X9VA 4CXKA 2I9XA 1N2KA 3GYVA 4NKBA 3P34A 2IA9A 1Q4OA 2E50A 5DNJA 1N2LA 4HCOA 4HY2A 3P2WA 2QZUA 3HMJG 4O56A 5DMVC 1E1ZP 4CYRA 3P2ZA 4O6WA 4CXUA 1P49A 1Q4KA 4E67A 3HIKA 4WHLA 4CXSA 1E2TA 3P35A 4H5XA 2N19A 4FDJA 5J19A 4X9RA 4N9JA 4N7VA 4O9WA 1AUKA 2I9ZA 4X9WA
chains in the Genus database with same CATH topology
3C5LA 3Q1IA 4O6WA 4X9VA 4XB0A 5LHZA 4HABA 3P36A 2OGQA 1Q4KA 4E67A 3P34A 4RS6A 1UMWA 3HIKA 3RQ7A 4WHLA 4LKMA 1Q4OA 4H71A 3P35A 4WHHA 5DMSA 4RCPA 5DNJA 3BZIA 4E9CA 4H5XA 4YYPA 2N19A 4J7BB 4WHKA 4DFWA 4LKLA 3HIHA 4HCOA 4HY2A 3P37A 3P2WA 4X9RA 5J19A 4O9WA 2OJXA 4O56A 3FVHA 4X9WA 4E9DA 5DMVC 3P2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5L A;  3Q1I A;  4O6W A;  4X9V A;  4XB0 A;  5LHZ A;  4HAB A;  3P36 A;  2OGQ A;  1Q4K A;  4E67 A;  3P34 A;  4RS6 A;  1UMW A;  3HIK A;  3RQ7 A;  4WHL A;  4LKM A;  1Q4O A;  4H71 A;  3P35 A;  4WHH A;  5DMS A;  4RCP A;  5DNJ A;  3BZI A;  4E9C A;  4H5X A;  4YYP A;  2N19 A;  4J7B B;  4WHK A;  4DFW A;  4LKL A;  3HIH A;  4HCO A;  4HY2 A;  3P37 A;  3P2W A;  4X9R A;  5J19 A;  4O9W A;  2OJX A;  4O56 A;  3FVH A;  4X9W A;  4E9D A;  5DMV C;  3P2Z A; 
#chains in the Genus database with same CATH topology
 3C5L A;  3Q1I A;  4XB0 A;  5LHZ A;  2OGQ A;  4FDI A;  1A87 A;  3KDR A;  1UMW A;  3FS3 A;  1HDH A;  4H71 A;  4NK7 A;  5DMS A;  3BZI A;  4E9C A;  1E2S P;  3LXQ A;  4YYP A;  4J7B B;  4G7N A;  3HIH A;  3P37 A;  2OJX A;  3FVH A;  5AJ9 A;  4HAB A;  3P36 A;  1E33 P;  4RS6 A;  3RQ7 A;  4LKM A;  3HFD A;  4WHH A;  1F32 A;  5DAY A;  4RCP A;  1FSU A;  3ED4 A;  4DFW A;  4WHK A;  2UV8 G;  4LKL A;  1E3C P;  4CYS A;  3GYW A;  3LM3 A;  4E9D A;  1F34 B;  4N7Z A;  2VKZ G;  4X9V A;  4CXK A;  2I9X A;  1N2K A;  3GYV A;  4NKB A;  3P34 A;  2IA9 A;  1Q4O A;  2E50 A;  5DNJ A;  1N2L A;  4HCO A;  4HY2 A;  3P2W A;  2QZU A;  3HMJ G;  4O56 A;  5DMV C;  1E1Z P;  4CYR A;  3P2Z A;  4O6W A;  4CXU A;  1P49 A;  1Q4K A;  4E67 A;  3HIK A;  4WHL A;  4CXS A;  1E2T A;  3P35 A;  4H5X A;  2N19 A;  4FDJ A;  5J19 A;  4X9R A;  4N9J A;  4N7V A;  4O9W A;  1AUK A;  2I9Z A;  4X9W A; 
#chains in the Genus database with same CATH homology
 3C5L A;  3Q1I A;  4O6W A;  4X9V A;  4XB0 A;  5LHZ A;  4HAB A;  3P36 A;  2OGQ A;  1Q4K A;  4E67 A;  3P34 A;  4RS6 A;  1UMW A;  3HIK A;  3RQ7 A;  4WHL A;  4LKM A;  1Q4O A;  4H71 A;  3P35 A;  4WHH A;  5DMS A;  4RCP A;  5DNJ A;  3BZI A;  4E9C A;  4H5X A;  4YYP A;  2N19 A;  4J7B B;  4WHK A;  4DFW A;  4LKL A;  3HIH A;  4HCO A;  4HY2 A;  3P37 A;  3P2W A;  4X9R A;  5J19 A;  4O9W A;  2OJX A;  4O56 A;  3FVH A;  4X9W A;  4E9D A;  5DMV C;  3P2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...