4WHHA

A new class of peptidomimetics targeting the polo-box domain of polo-like kinase 1
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
210
Chain Sequence
HLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANILPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
publication title A new class of peptidomimetics targeting the polo-box domain of polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 210
sequence length 220
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2014-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4whhA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4whhA01
3P36A 4H5XA 3P34A 4LKMA 4H71A 4HABA 4WHKA 3P2ZA 5DNJA 4RCPA 3P35A 2OJXA 4E67A 3P37A 5DMVC 3HIHA 3C5LA 4X9RA 4LKLA 4HCOA 3RQ7A 4YYPA 4E9DA 1Q4KA 3BZIA 4O56A 4X9VA 2N19A 2OGQA 3HIKA 4WHLA 4O9WA 4X9WA 4DFWA 5J19A 4HY2A 4WHHA 3Q1IA 4E9CA 3FVHA 4O6WA 4J7BB 1UMWA 4XB0A 1Q4OA 4RS6A 5LHZA 5DMSA 3P2WA
chains in the Genus database with same CATH superfamily
4N7ZA 3HFDA 3GYWA 3LM3A 4RCPA 2OJXA 4HCOA 1FSUA 3RQ7A 4YYPA 4CXKA 3BZIA 4CYSA 4NKBA 4DFWA 4HY2A 4XB0A 5DMSA 1E2TA 1F34B 4H5XA 5DAYA 4H71A 3P2ZA 1E3CP 2VKZG 1E1ZP 3P37A 5DMVC 2I9XA 4LKLA 1AUKA 4E9DA 1Q4KA 4X9VA 2N19A 1E33P 2OGQA 4O9WA 5J19A 4N7VA 4WHHA 4E9CA 3FVHA 1P49A 4RS6A 5LHZA 4E67A 3FS3A 3P2WA 3HIHA 4CXSA 4NK7A 1F32A 1N2KA 3HMJG 4N9JA 4WHKA 3P35A 4X9RA 3C5LA 2IA9A 1E2SP 4X9WA 3ED4A 3Q1IA 4FDIA 1UMWA 3P36A 4G7NA 2I9ZA 1HDHA 3P34A 4CXUA 4LKMA 4CYRA 1A87A 4HABA 5DNJA 2QZUA 2E50A 5AJ9A 4O56A 4FDJA 3GYVA 1N2LA 2UV8G 3HIKA 4WHLA 4O6WA 3KDRA 4J7BB 3LXQA 1Q4OA
chains in the Genus database with same CATH topology
3P36A 4H5XA 3P34A 4LKMA 4H71A 4HABA 4WHKA 3P2ZA 5DNJA 4RCPA 3P35A 2OJXA 4E67A 3P37A 5DMVC 3HIHA 3C5LA 4X9RA 4LKLA 4HCOA 3RQ7A 4YYPA 4E9DA 1Q4KA 3BZIA 4O56A 4X9VA 2N19A 2OGQA 3HIKA 4WHLA 4O9WA 4X9WA 4DFWA 5J19A 4HY2A 4WHHA 3Q1IA 4E9CA 3FVHA 4O6WA 4J7BB 1UMWA 4XB0A 1Q4OA 4RS6A 5LHZA 5DMSA 3P2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P36 A;  4H5X A;  3P34 A;  4LKM A;  4H71 A;  4HAB A;  4WHK A;  3P2Z A;  5DNJ A;  4RCP A;  3P35 A;  2OJX A;  4E67 A;  3P37 A;  5DMV C;  3HIH A;  3C5L A;  4X9R A;  4LKL A;  4HCO A;  3RQ7 A;  4YYP A;  4E9D A;  1Q4K A;  3BZI A;  4O56 A;  4X9V A;  2N19 A;  2OGQ A;  3HIK A;  4WHL A;  4O9W A;  4X9W A;  4DFW A;  5J19 A;  4HY2 A;  4WHH A;  3Q1I A;  4E9C A;  3FVH A;  4O6W A;  4J7B B;  1UMW A;  4XB0 A;  1Q4O A;  4RS6 A;  5LHZ A;  5DMS A;  3P2W A; 
#chains in the Genus database with same CATH topology
 4N7Z A;  3HFD A;  3GYW A;  3LM3 A;  4RCP A;  2OJX A;  4HCO A;  1FSU A;  3RQ7 A;  4YYP A;  4CXK A;  3BZI A;  4CYS A;  4NKB A;  4DFW A;  4HY2 A;  4XB0 A;  5DMS A;  1E2T A;  1F34 B;  4H5X A;  5DAY A;  4H71 A;  3P2Z A;  1E3C P;  2VKZ G;  1E1Z P;  3P37 A;  5DMV C;  2I9X A;  4LKL A;  1AUK A;  4E9D A;  1Q4K A;  4X9V A;  2N19 A;  1E33 P;  2OGQ A;  4O9W A;  5J19 A;  4N7V A;  4WHH A;  4E9C A;  3FVH A;  1P49 A;  4RS6 A;  5LHZ A;  4E67 A;  3FS3 A;  3P2W A;  3HIH A;  4CXS A;  4NK7 A;  1F32 A;  1N2K A;  3HMJ G;  4N9J A;  4WHK A;  3P35 A;  4X9R A;  3C5L A;  2IA9 A;  1E2S P;  4X9W A;  3ED4 A;  3Q1I A;  4FDI A;  1UMW A;  3P36 A;  4G7N A;  2I9Z A;  1HDH A;  3P34 A;  4CXU A;  4LKM A;  4CYR A;  1A87 A;  4HAB A;  5DNJ A;  2QZU A;  2E50 A;  5AJ9 A;  4O56 A;  4FDJ A;  3GYV A;  1N2L A;  2UV8 G;  3HIK A;  4WHL A;  4O6W A;  3KDR A;  4J7B B;  3LXQ A;  1Q4O A; 
#chains in the Genus database with same CATH homology
 3P36 A;  4H5X A;  3P34 A;  4LKM A;  4H71 A;  4HAB A;  4WHK A;  3P2Z A;  5DNJ A;  4RCP A;  3P35 A;  2OJX A;  4E67 A;  3P37 A;  5DMV C;  3HIH A;  3C5L A;  4X9R A;  4LKL A;  4HCO A;  3RQ7 A;  4YYP A;  4E9D A;  1Q4K A;  3BZI A;  4O56 A;  4X9V A;  2N19 A;  2OGQ A;  3HIK A;  4WHL A;  4O9W A;  4X9W A;  4DFW A;  5J19 A;  4HY2 A;  4WHH A;  3Q1I A;  4E9C A;  3FVH A;  4O6W A;  4J7B B;  1UMW A;  4XB0 A;  1Q4O A;  4RS6 A;  5LHZ A;  5DMS A;  3P2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...