The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
66
|
sequence length |
220
|
structure length |
210
|
Chain Sequence |
HLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANILPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A new class of peptidomimetics targeting the polo-box domain of polo-like kinase 1.
pubmed doi rcsb |
| molecule keywords |
Serine/threonine-protein kinase PLK1
|
| molecule tags |
Transferase/transferase inhibitor
|
| source organism |
Homo sapiens
|
| total genus |
66
|
| structure length |
210
|
| sequence length |
220
|
| ec nomenclature |
ec
2.7.11.21: Polo kinase. |
| pdb deposition date | 2014-09-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00659 | POLO_box | POLO box duplicated region |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | POLO box domain | ||
| Alpha Beta | 2-Layer Sandwich | Arylsulfatase, C-terminal domain | POLO box domain |
#chains in the Genus database with same CATH superfamily 4LKL A; 4X9R A; 4XB0 A; 3RQ7 A; 3P2Z A; 1Q4O A; 4HY2 A; 4X9V A; 3C5L A; 4YYP A; 4O6W A; 4WHH A; 4E67 A; 3P36 A; 4X9W A; 3BZI A; 2N19 A; 2OJX A; 3HIK A; 4RS6 A; 4WHL A; 4H5X A; 5DMS A; 2OGQ A; 3P35 A; 4DFW A; 3FVH A; 5LHZ A; 1UMW A; 4J7B B; 4WHK A; 3HIH A; 4H71 A; 4O9W A; 1Q4K A; 5DMV C; 5DNJ A; 4O56 A; 3Q1I A; 4HAB A; 3P34 A; 3P37 A; 4RCP A; 3P2W A; 5J19 A; 4HCO A; 4E9D A; 4LKM A; 4E9C A; #chains in the Genus database with same CATH topology 4FDJ A; 3RQ7 A; 3P2Z A; 4HY2 A; 4O6W A; 4FDI A; 3BZI A; 5DAY A; 1N2L A; 2N19 A; 4H5X A; 5DMS A; 2VKZ G; 1E33 P; 4O9W A; 1Q4K A; 1E3C P; 3LXQ A; 2I9X A; 4HAB A; 4E9D A; 4CXS A; 4LKL A; 4X9R A; 4XB0 A; 1AUK A; 1HDH A; 3C5L A; 5AJ9 A; 1P49 A; 4WHL A; 2OGQ A; 3FVH A; 2UV8 G; 5LHZ A; 1UMW A; 4WHK A; 3HFD A; 4H71 A; 4CXK A; 5DMV C; 4O56 A; 3Q1I A; 3P37 A; 4RCP A; 4NK7 A; 3LM3 A; 4CYS A; 1Q4O A; 2I9Z A; 4X9V A; 4YYP A; 4WHH A; 4E67 A; 4X9W A; 3P36 A; 3HIK A; 1A87 A; 1N2K A; 3FS3 A; 4CXU A; 4N7V A; 3HIH A; 3HMJ G; 5DNJ A; 1E1Z P; 3P34 A; 5J19 A; 4CYR A; 4HCO A; 4LKM A; 4E9C A; 3GYV A; 2E50 A; 4G7N A; 2QZU A; 4N7Z A; 2OJX A; 4RS6 A; 3GYW A; 3P35 A; 4DFW A; 4J7B B; 4NKB A; 1F32 A; 3KDR A; 1F34 B; 1E2T A; 1FSU A; 1E2S P; 4N9J A; 3P2W A; 2IA9 A; 3ED4 A; #chains in the Genus database with same CATH homology 4LKL A; 4X9R A; 4XB0 A; 3RQ7 A; 3P2Z A; 1Q4O A; 4HY2 A; 4X9V A; 3C5L A; 4YYP A; 4O6W A; 4WHH A; 4E67 A; 3P36 A; 4X9W A; 3BZI A; 2N19 A; 2OJX A; 3HIK A; 4RS6 A; 4WHL A; 4H5X A; 5DMS A; 2OGQ A; 3P35 A; 4DFW A; 3FVH A; 5LHZ A; 1UMW A; 4J7B B; 4WHK A; 3HIH A; 4H71 A; 4O9W A; 1Q4K A; 5DMV C; 5DNJ A; 4O56 A; 3Q1I A; 4HAB A; 3P34 A; 3P37 A; 4RCP A; 3P2W A; 5J19 A; 4HCO A; 4E9D A; 4LKM A; 4E9C A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
