3P36A

Polo-like kinase i polo-box domain in complex with dpplhspta phosphopeptide from pbip1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
223
structure length
217
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPRRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 217
sequence length 223
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p36A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p36A01
3FVHA 3RQ7A 4DFWA 3HIHA 4RS6A 4XB0A 5J19A 1Q4OA 4HABA 4WHLA 4H71A 3P35A 4H5XA 4O9WA 5LHZA 4X9RA 4O6WA 3P36A 4YYPA 3P37A 4HCOA 4J7BB 4LKMA 5DNJA 4LKLA 3P2WA 3BZIA 4X9WA 4HY2A 4E9DA 2N19A 4WHHA 1UMWA 2OJXA 4WHKA 1Q4KA 3C5LA 4X9VA 3HIKA 5DMSA 4E9CA 3P34A 5DMVC 3Q1IA 2OGQA 3P2ZA 4O56A 4E67A 4RCPA
chains in the Genus database with same CATH superfamily
3RQ7A 4XB0A 4WHLA 3P35A 4O6WA 4HCOA 4LKMA 3P2WA 4N7VA 1P49A 4E9CA 4N7ZA 3HFDA 3P2ZA 4CYSA 5AJ9A 3ED4A 2I9XA 1N2KA 3GYWA 4N9JA 4H71A 1N2LA 5DAYA 3P36A 1F34B 5DNJA 1E3CP 1E33P 2N19A 4E9DA 2OJXA 4E67A 1AUKA 5DMSA 3HIKA 1A87A 3Q1IA 4O56A 4G7NA 3FVHA 3KDRA 1FSUA 2IA9A 3HIHA 4FDIA 4CYRA 4CXSA 2UV8G 3LM3A 1Q4OA 2VKZG 4H5XA 5LHZA 4X9RA 1E2SP 3P37A 3BZIA 4X9WA 1E1ZP 4WHHA 4X9VA 2QZUA 5DMVC 2E50A 2OGQA 3HMJG 4RCPA 4CXUA 3LXQA 4DFWA 4CXKA 4RS6A 5J19A 4HABA 4O9WA 4YYPA 1F32A 2I9ZA 4FDJA 3GYVA 4J7BB 4LKLA 1E2TA 4HY2A 1UMWA 4WHKA 1Q4KA 3C5LA 3P34A 3FS3A 1HDHA 4NKBA 4NK7A
chains in the Genus database with same CATH topology
3FVHA 3RQ7A 4DFWA 3HIHA 4RS6A 4XB0A 5J19A 1Q4OA 4HABA 4WHLA 4H71A 3P35A 4H5XA 4O9WA 5LHZA 4X9RA 4O6WA 3P36A 4YYPA 3P37A 4HCOA 4J7BB 4LKMA 5DNJA 4LKLA 3P2WA 3BZIA 4X9WA 4HY2A 4E9DA 2N19A 4WHHA 1UMWA 2OJXA 4WHKA 1Q4KA 3C5LA 4X9VA 3HIKA 5DMSA 4E9CA 3P34A 5DMVC 3Q1IA 2OGQA 3P2ZA 4O56A 4E67A 4RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FVH A;  3RQ7 A;  4DFW A;  3HIH A;  4RS6 A;  4XB0 A;  5J19 A;  1Q4O A;  4HAB A;  4WHL A;  4H71 A;  3P35 A;  4H5X A;  4O9W A;  5LHZ A;  4X9R A;  4O6W A;  3P36 A;  4YYP A;  3P37 A;  4HCO A;  4J7B B;  4LKM A;  5DNJ A;  4LKL A;  3P2W A;  3BZI A;  4X9W A;  4HY2 A;  4E9D A;  2N19 A;  4WHH A;  1UMW A;  2OJX A;  4WHK A;  1Q4K A;  3C5L A;  4X9V A;  3HIK A;  5DMS A;  4E9C A;  3P34 A;  5DMV C;  3Q1I A;  2OGQ A;  3P2Z A;  4O56 A;  4E67 A;  4RCP A; 
#chains in the Genus database with same CATH topology
 3RQ7 A;  4XB0 A;  4WHL A;  3P35 A;  4O6W A;  4HCO A;  4LKM A;  3P2W A;  4N7V A;  1P49 A;  4E9C A;  4N7Z A;  3HFD A;  3P2Z A;  4CYS A;  5AJ9 A;  3ED4 A;  2I9X A;  1N2K A;  3GYW A;  4N9J A;  4H71 A;  1N2L A;  5DAY A;  3P36 A;  1F34 B;  5DNJ A;  1E3C P;  1E33 P;  2N19 A;  4E9D A;  2OJX A;  4E67 A;  1AUK A;  5DMS A;  3HIK A;  1A87 A;  3Q1I A;  4O56 A;  4G7N A;  3FVH A;  3KDR A;  1FSU A;  2IA9 A;  3HIH A;  4FDI A;  4CYR A;  4CXS A;  2UV8 G;  3LM3 A;  1Q4O A;  2VKZ G;  4H5X A;  5LHZ A;  4X9R A;  1E2S P;  3P37 A;  3BZI A;  4X9W A;  1E1Z P;  4WHH A;  4X9V A;  2QZU A;  5DMV C;  2E50 A;  2OGQ A;  3HMJ G;  4RCP A;  4CXU A;  3LXQ A;  4DFW A;  4CXK A;  4RS6 A;  5J19 A;  4HAB A;  4O9W A;  4YYP A;  1F32 A;  2I9Z A;  4FDJ A;  3GYV A;  4J7B B;  4LKL A;  1E2T A;  4HY2 A;  1UMW A;  4WHK A;  1Q4K A;  3C5L A;  3P34 A;  3FS3 A;  1HDH A;  4NKB A;  4NK7 A; 
#chains in the Genus database with same CATH homology
 3FVH A;  3RQ7 A;  4DFW A;  3HIH A;  4RS6 A;  4XB0 A;  5J19 A;  1Q4O A;  4HAB A;  4WHL A;  4H71 A;  3P35 A;  4H5X A;  4O9W A;  5LHZ A;  4X9R A;  4O6W A;  3P36 A;  4YYP A;  3P37 A;  4HCO A;  4J7B B;  4LKM A;  5DNJ A;  4LKL A;  3P2W A;  3BZI A;  4X9W A;  4HY2 A;  4E9D A;  2N19 A;  4WHH A;  1UMW A;  2OJX A;  4WHK A;  1Q4K A;  3C5L A;  4X9V A;  3HIK A;  5DMS A;  4E9C A;  3P34 A;  5DMV C;  3Q1I A;  2OGQ A;  3P2Z A;  4O56 A;  4E67 A;  4RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...