3P36A

Polo-like kinase i polo-box domain in complex with dpplhspta phosphopeptide from pbip1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
223
structure length
217
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPRRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 217
sequence length 223
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p36A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p36A01
4J7BB 4H71A 2OGQA 5DNJA 4E67A 4H5XA 4YYPA 4HCOA 4HABA 4WHKA 3FVHA 4E9DA 1UMWA 4LKMA 4WHHA 5J19A 3P34A 3P37A 3BZIA 4WHLA 5DMSA 3HIHA 4O6WA 3HIKA 4O9WA 3P2ZA 4X9RA 3C5LA 4O56A 4XB0A 4X9WA 2OJXA 3P35A 3Q1IA 4X9VA 3P2WA 5DMVC 4RCPA 1Q4KA 4LKLA 3P36A 4DFWA 4HY2A 4E9CA 3RQ7A 2N19A 4RS6A 1Q4OA 5LHZA
chains in the Genus database with same CATH superfamily
2I9XA 5DNJA 4E67A 1E3CP 4H5XA 4YYPA 3LM3A 4WHKA 3FVHA 4E9DA 4LKMA 1F34B 3BZIA 5DMSA 3HIHA 4O6WA 4O9WA 4X9RA 3C5LA 1N2KA 1F32A 1Q4KA 4CYSA 4CXKA 4NK7A 5AJ9A 4RS6A 4N9JA 5J19A 3KDRA 4J7BB 2UV8G 4FDIA 4N7ZA 4NKBA 2QZUA 3LXQA 2I9ZA 2E50A 1HDHA 1FSUA 4O56A 4XB0A 4CYRA 3ED4A 3GYWA 3P2WA 4X9VA 5DMVC 1AUKA 1N2LA 3P36A 4HY2A 4E9CA 5LHZA 4H71A 5DAYA 4CXSA 4CXUA 4HABA 1E1ZP 4WHHA 2VKZG 4N7VA 3P2ZA 3GYVA 4X9WA 2OJXA 1A87A 4RCPA 1P49A 4DFWA 4FDJA 3RQ7A 2IA9A 1Q4OA 3HFDA 2OGQA 3HMJG 3FS3A 4HCOA 1E2TA 1UMWA 1E33P 3P34A 3P37A 4WHLA 3HIKA 4G7NA 1E2SP 3P35A 3Q1IA 4LKLA 2N19A
chains in the Genus database with same CATH topology
4J7BB 4H71A 2OGQA 5DNJA 4E67A 4H5XA 4YYPA 4HCOA 4HABA 4WHKA 3FVHA 4E9DA 1UMWA 4LKMA 4WHHA 5J19A 3P34A 3P37A 3BZIA 4WHLA 5DMSA 3HIHA 4O6WA 3HIKA 4O9WA 3P2ZA 4X9RA 3C5LA 4O56A 4XB0A 4X9WA 2OJXA 3P35A 3Q1IA 4X9VA 3P2WA 5DMVC 4RCPA 1Q4KA 4LKLA 3P36A 4DFWA 4HY2A 4E9CA 3RQ7A 2N19A 4RS6A 1Q4OA 5LHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7B B;  4H71 A;  2OGQ A;  5DNJ A;  4E67 A;  4H5X A;  4YYP A;  4HCO A;  4HAB A;  4WHK A;  3FVH A;  4E9D A;  1UMW A;  4LKM A;  4WHH A;  5J19 A;  3P34 A;  3P37 A;  3BZI A;  4WHL A;  5DMS A;  3HIH A;  4O6W A;  3HIK A;  4O9W A;  3P2Z A;  4X9R A;  3C5L A;  4O56 A;  4XB0 A;  4X9W A;  2OJX A;  3P35 A;  3Q1I A;  4X9V A;  3P2W A;  5DMV C;  4RCP A;  1Q4K A;  4LKL A;  3P36 A;  4DFW A;  4HY2 A;  4E9C A;  3RQ7 A;  2N19 A;  4RS6 A;  1Q4O A;  5LHZ A; 
#chains in the Genus database with same CATH topology
 2I9X A;  5DNJ A;  4E67 A;  1E3C P;  4H5X A;  4YYP A;  3LM3 A;  4WHK A;  3FVH A;  4E9D A;  4LKM A;  1F34 B;  3BZI A;  5DMS A;  3HIH A;  4O6W A;  4O9W A;  4X9R A;  3C5L A;  1N2K A;  1F32 A;  1Q4K A;  4CYS A;  4CXK A;  4NK7 A;  5AJ9 A;  4RS6 A;  4N9J A;  5J19 A;  3KDR A;  4J7B B;  2UV8 G;  4FDI A;  4N7Z A;  4NKB A;  2QZU A;  3LXQ A;  2I9Z A;  2E50 A;  1HDH A;  1FSU A;  4O56 A;  4XB0 A;  4CYR A;  3ED4 A;  3GYW A;  3P2W A;  4X9V A;  5DMV C;  1AUK A;  1N2L A;  3P36 A;  4HY2 A;  4E9C A;  5LHZ A;  4H71 A;  5DAY A;  4CXS A;  4CXU A;  4HAB A;  1E1Z P;  4WHH A;  2VKZ G;  4N7V A;  3P2Z A;  3GYV A;  4X9W A;  2OJX A;  1A87 A;  4RCP A;  1P49 A;  4DFW A;  4FDJ A;  3RQ7 A;  2IA9 A;  1Q4O A;  3HFD A;  2OGQ A;  3HMJ G;  3FS3 A;  4HCO A;  1E2T A;  1UMW A;  1E33 P;  3P34 A;  3P37 A;  4WHL A;  3HIK A;  4G7N A;  1E2S P;  3P35 A;  3Q1I A;  4LKL A;  2N19 A; 
#chains in the Genus database with same CATH homology
 4J7B B;  4H71 A;  2OGQ A;  5DNJ A;  4E67 A;  4H5X A;  4YYP A;  4HCO A;  4HAB A;  4WHK A;  3FVH A;  4E9D A;  1UMW A;  4LKM A;  4WHH A;  5J19 A;  3P34 A;  3P37 A;  3BZI A;  4WHL A;  5DMS A;  3HIH A;  4O6W A;  3HIK A;  4O9W A;  3P2Z A;  4X9R A;  3C5L A;  4O56 A;  4XB0 A;  4X9W A;  2OJX A;  3P35 A;  3Q1I A;  4X9V A;  3P2W A;  5DMV C;  4RCP A;  1Q4K A;  4LKL A;  3P36 A;  4DFW A;  4HY2 A;  4E9C A;  3RQ7 A;  2N19 A;  4RS6 A;  1Q4O A;  5LHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...