3P36A

Polo-like kinase i polo-box domain in complex with dpplhspta phosphopeptide from pbip1
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
223
structure length
217
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPRRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 217
sequence length 223
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p36A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p36A01
4E9CA 4J7BB 4O9WA 4H71A 2OGQA 3Q1IA 4X9RA 1UMWA 3P2ZA 3P35A 4RCPA 1Q4OA 4O6WA 5DMSA 4WHKA 3P37A 4E9DA 4WHLA 5J19A 3HIKA 1Q4KA 4O56A 4X9WA 5DMVC 4LKLA 3HIHA 2N19A 3P36A 4LKMA 4WHHA 4H5XA 2OJXA 4HABA 4DFWA 5LHZA 5DNJA 4E67A 4RS6A 3BZIA 4HCOA 4X9VA 3C5LA 4HY2A 3RQ7A 3P2WA 3P34A 4XB0A 4YYPA 3FVHA
chains in the Genus database with same CATH superfamily
4E9CA 1N2LA 2UV8G 4X9RA 3P35A 4NKBA 4E9DA 5J19A 4O56A 4LKLA 4LKMA 1F32A 4WHHA 4H5XA 2OJXA 1AUKA 4YYPA 3P2WA 3GYVA 3FVHA 4N7ZA 5DAYA 1E2TA 4J7BB 4CXSA 4CXKA 3Q1IA 1UMWA 4NK7A 4RCPA 1Q4OA 5DMSA 1E2SP 3KDRA 3LXQA 1E33P 1P49A 4DFWA 3HFDA 1HDHA 4X9VA 3C5LA 4XB0A 1E3CP 4O9WA 4H71A 1F34B 3HMJG 1FSUA 4G7NA 4WHKA 1E1ZP 3P37A 4WHLA 1N2KA 3GYWA 1Q4KA 3LM3A 4FDIA 5DMVC 2N19A 2QZUA 2VKZG 4RS6A 4N7VA 3BZIA 4HCOA 3RQ7A 3P34A 3ED4A 5AJ9A 2I9ZA 2IA9A 2OGQA 4CYSA 3P2ZA 4O6WA 4CYRA 3HIKA 2E50A 4X9WA 3HIHA 3P36A 4FDJA 1A87A 4HABA 3FS3A 4CXUA 5LHZA 5DNJA 4E67A 2I9XA 4N9JA 4HY2A
chains in the Genus database with same CATH topology
4E9CA 4J7BB 4O9WA 4H71A 2OGQA 3Q1IA 4X9RA 1UMWA 3P2ZA 3P35A 4RCPA 1Q4OA 4O6WA 5DMSA 4WHKA 3P37A 4E9DA 4WHLA 5J19A 3HIKA 1Q4KA 4O56A 4X9WA 5DMVC 4LKLA 3HIHA 2N19A 3P36A 4LKMA 4WHHA 4H5XA 2OJXA 4HABA 4DFWA 5LHZA 5DNJA 4E67A 4RS6A 3BZIA 4HCOA 4X9VA 3C5LA 4HY2A 3RQ7A 3P2WA 3P34A 4XB0A 4YYPA 3FVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E9C A;  4J7B B;  4O9W A;  4H71 A;  2OGQ A;  3Q1I A;  4X9R A;  1UMW A;  3P2Z A;  3P35 A;  4RCP A;  1Q4O A;  4O6W A;  5DMS A;  4WHK A;  3P37 A;  4E9D A;  4WHL A;  5J19 A;  3HIK A;  1Q4K A;  4O56 A;  4X9W A;  5DMV C;  4LKL A;  3HIH A;  2N19 A;  3P36 A;  4LKM A;  4WHH A;  4H5X A;  2OJX A;  4HAB A;  4DFW A;  5LHZ A;  5DNJ A;  4E67 A;  4RS6 A;  3BZI A;  4HCO A;  4X9V A;  3C5L A;  4HY2 A;  3RQ7 A;  3P2W A;  3P34 A;  4XB0 A;  4YYP A;  3FVH A; 
#chains in the Genus database with same CATH topology
 4E9C A;  1N2L A;  2UV8 G;  4X9R A;  3P35 A;  4NKB A;  4E9D A;  5J19 A;  4O56 A;  4LKL A;  4LKM A;  1F32 A;  4WHH A;  4H5X A;  2OJX A;  1AUK A;  4YYP A;  3P2W A;  3GYV A;  3FVH A;  4N7Z A;  5DAY A;  1E2T A;  4J7B B;  4CXS A;  4CXK A;  3Q1I A;  1UMW A;  4NK7 A;  4RCP A;  1Q4O A;  5DMS A;  1E2S P;  3KDR A;  3LXQ A;  1E33 P;  1P49 A;  4DFW A;  3HFD A;  1HDH A;  4X9V A;  3C5L A;  4XB0 A;  1E3C P;  4O9W A;  4H71 A;  1F34 B;  3HMJ G;  1FSU A;  4G7N A;  4WHK A;  1E1Z P;  3P37 A;  4WHL A;  1N2K A;  3GYW A;  1Q4K A;  3LM3 A;  4FDI A;  5DMV C;  2N19 A;  2QZU A;  2VKZ G;  4RS6 A;  4N7V A;  3BZI A;  4HCO A;  3RQ7 A;  3P34 A;  3ED4 A;  5AJ9 A;  2I9Z A;  2IA9 A;  2OGQ A;  4CYS A;  3P2Z A;  4O6W A;  4CYR A;  3HIK A;  2E50 A;  4X9W A;  3HIH A;  3P36 A;  4FDJ A;  1A87 A;  4HAB A;  3FS3 A;  4CXU A;  5LHZ A;  5DNJ A;  4E67 A;  2I9X A;  4N9J A;  4HY2 A; 
#chains in the Genus database with same CATH homology
 4E9C A;  4J7B B;  4O9W A;  4H71 A;  2OGQ A;  3Q1I A;  4X9R A;  1UMW A;  3P2Z A;  3P35 A;  4RCP A;  1Q4O A;  4O6W A;  5DMS A;  4WHK A;  3P37 A;  4E9D A;  4WHL A;  5J19 A;  3HIK A;  1Q4K A;  4O56 A;  4X9W A;  5DMV C;  4LKL A;  3HIH A;  2N19 A;  3P36 A;  4LKM A;  4WHH A;  4H5X A;  2OJX A;  4HAB A;  4DFW A;  5LHZ A;  5DNJ A;  4E67 A;  4RS6 A;  3BZI A;  4HCO A;  4X9V A;  3C5L A;  4HY2 A;  3RQ7 A;  3P2W A;  3P34 A;  4XB0 A;  4YYP A;  3FVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...