1F32A

Crystal structure of ascaris pepsin inhibitor-3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
127
Chain Sequence
b'FLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQSPPPPPSFCTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR PEPSIN INHIBITOR PI-3
publication title Structural basis for the inhibition of porcine pepsin by Ascaris pepsin inhibitor-3.
pubmed doi rcsb
source organism Ascaris suum
molecule tags Hydrolase inhibitor
total genus 33
structure length 127
sequence length 147
ec nomenclature
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06394 Pepsin-I3 Pepsin inhibitor-3-like repeated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f32A01
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f32A02
1F34B 1F32A
chains in the Genus database with same CATH superfamily
4G7NA 3HFDA 4NK7A 1FSUA 3LXQA 4DFWA 3HIHA 2OGQA 4CXUA 1F34B 4WHLA 2IA9A 4X9WA 3C5LA 2UV8G 4J7BB 2I9ZA 3Q1IA 4CYRA 1HDHA 4N7ZA 3FVHA 4WHHA 1E2TA 4E67A 4N9JA 4NKBA 4WHKA 4FDJA 2N19A 3P35A 4YYPA 1N2KA 1E3CP 4XB0A 1Q4KA 5J19A 4N7VA 4O56A 3P34A 4CXKA 2E50A 4RS6A 4O9WA 1E33P 4LKMA 3P36A 4HCOA 2OJXA 5DMVC 3LM3A 4LKLA 4HABA 2I9XA 5DMSA 1E1ZP 1A87A 4E9DA 1N2LA 1UMWA 3P2ZA 3GYVA 4H71A 3HMJG 4X9VA 4O6WA 3KDRA 1F32A 3GYWA 4H5XA 3ED4A 5DNJA 1P49A 4HY2A 1Q4OA 5AJ9A 5DAYA 3HIKA 3BZIA 3FS3A 4FDIA 4X9RA 3P2WA 3RQ7A 4CXSA 3P37A 1AUKA 2QZUA 5LHZA 4E9CA 2VKZG 4CYSA 1E2SP 4RCPA
chains in the Genus database with same CATH topology
1F34B 1F32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F34 B;  1F32 A; 
#chains in the Genus database with same CATH topology
 4G7N A;  3HFD A;  4NK7 A;  1FSU A;  3LXQ A;  4DFW A;  3HIH A;  2OGQ A;  4CXU A;  1F34 B;  4WHL A;  2IA9 A;  4X9W A;  3C5L A;  2UV8 G;  4J7B B;  2I9Z A;  3Q1I A;  4CYR A;  1HDH A;  4N7Z A;  3FVH A;  4WHH A;  1E2T A;  4E67 A;  4N9J A;  4NKB A;  4WHK A;  4FDJ A;  2N19 A;  3P35 A;  4YYP A;  1N2K A;  1E3C P;  4XB0 A;  1Q4K A;  5J19 A;  4N7V A;  4O56 A;  3P34 A;  4CXK A;  2E50 A;  4RS6 A;  4O9W A;  1E33 P;  4LKM A;  3P36 A;  4HCO A;  2OJX A;  5DMV C;  3LM3 A;  4LKL A;  4HAB A;  2I9X A;  5DMS A;  1E1Z P;  1A87 A;  4E9D A;  1N2L A;  1UMW A;  3P2Z A;  3GYV A;  4H71 A;  3HMJ G;  4X9V A;  4O6W A;  3KDR A;  1F32 A;  3GYW A;  4H5X A;  3ED4 A;  5DNJ A;  1P49 A;  4HY2 A;  1Q4O A;  5AJ9 A;  5DAY A;  3HIK A;  3BZI A;  3FS3 A;  4FDI A;  4X9R A;  3P2W A;  3RQ7 A;  4CXS A;  3P37 A;  1AUK A;  2QZU A;  5LHZ A;  4E9C A;  2VKZ G;  4CYS A;  1E2S P;  4RCP A; 
#chains in the Genus database with same CATH homology
 1F34 B;  1F32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...