1F32A

Crystal structure of ascaris pepsin inhibitor-3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
127
Chain Sequence
FLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQSPPPPPSFCTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR PEPSIN INHIBITOR PI-3
publication title Structural basis for the inhibition of porcine pepsin by Ascaris pepsin inhibitor-3.
pubmed doi rcsb
source organism Ascaris suum
molecule tags Hydrolase inhibitor
total genus 33
structure length 127
sequence length 147
ec nomenclature
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06394 Pepsin-I3 Pepsin inhibitor-3-like repeated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f32A01
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f32A02
1F34B 1F32A
chains in the Genus database with same CATH superfamily
5DNJA 3GYVA 5DMVC 1E3CP 4WHLA 3C5LA 1F32A 3RQ7A 1F34B 4N7ZA 2VKZG 4CXKA 4FDJA 4RS6A 3FVHA 4LKLA 5J19A 4NK7A 4NKBA 3P37A 2E50A 2OGQA 2OJXA 4O56A 3Q1IA 1AUKA 4N9JA 4G7NA 4HY2A 2I9ZA 4WHKA 4E67A 4E9CA 4H71A 3GYWA 4N7VA 2I9XA 4CXSA 4DFWA 4HABA 1P49A 1HDHA 5AJ9A 1UMWA 1E1ZP 4H5XA 4O6WA 4CYSA 1N2LA 4WHHA 4X9WA 1E2SP 5LHZA 3HMJG 2QZUA 3ED4A 4YYPA 3HIHA 4LKMA 1Q4KA 4RCPA 3P36A 2UV8G 1A87A 4E9DA 3FS3A 4XB0A 4FDIA 4O9WA 3KDRA 4J7BB 3HFDA 5DMSA 4CXUA 4CYRA 4X9RA 3P35A 3BZIA 1Q4OA 3LM3A 1N2KA 1E33P 3P2ZA 2IA9A 3P2WA 3LXQA 4HCOA 4X9VA 2N19A 1E2TA 1FSUA 3P34A 5DAYA 3HIKA
chains in the Genus database with same CATH topology
1F34B 1F32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F34 B;  1F32 A; 
#chains in the Genus database with same CATH topology
 5DNJ A;  3GYV A;  5DMV C;  1E3C P;  4WHL A;  3C5L A;  1F32 A;  3RQ7 A;  1F34 B;  4N7Z A;  2VKZ G;  4CXK A;  4FDJ A;  4RS6 A;  3FVH A;  4LKL A;  5J19 A;  4NK7 A;  4NKB A;  3P37 A;  2E50 A;  2OGQ A;  2OJX A;  4O56 A;  3Q1I A;  1AUK A;  4N9J A;  4G7N A;  4HY2 A;  2I9Z A;  4WHK A;  4E67 A;  4E9C A;  4H71 A;  3GYW A;  4N7V A;  2I9X A;  4CXS A;  4DFW A;  4HAB A;  1P49 A;  1HDH A;  5AJ9 A;  1UMW A;  1E1Z P;  4H5X A;  4O6W A;  4CYS A;  1N2L A;  4WHH A;  4X9W A;  1E2S P;  5LHZ A;  3HMJ G;  2QZU A;  3ED4 A;  4YYP A;  3HIH A;  4LKM A;  1Q4K A;  4RCP A;  3P36 A;  2UV8 G;  1A87 A;  4E9D A;  3FS3 A;  4XB0 A;  4FDI A;  4O9W A;  3KDR A;  4J7B B;  3HFD A;  5DMS A;  4CXU A;  4CYR A;  4X9R A;  3P35 A;  3BZI A;  1Q4O A;  3LM3 A;  1N2K A;  1E33 P;  3P2Z A;  2IA9 A;  3P2W A;  3LXQ A;  4HCO A;  4X9V A;  2N19 A;  1E2T A;  1FSU A;  3P34 A;  5DAY A;  3HIK A; 
#chains in the Genus database with same CATH homology
 1F34 B;  1F32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...