1F32A

Crystal structure of ascaris pepsin inhibitor-3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
147
structure length
127
Chain Sequence
FLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQSPPPPPSFCTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords MAJOR PEPSIN INHIBITOR PI-3
publication title Structural basis for the inhibition of porcine pepsin by Ascaris pepsin inhibitor-3.
pubmed doi rcsb
source organism Ascaris suum
total genus 33
structure length 127
sequence length 147
ec nomenclature
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06394 Pepsin-I3 Pepsin inhibitor-3-like repeated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f32A01
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f32A02
1F34B 1F32A
chains in the Genus database with same CATH superfamily
3GYVA 1A87A 1Q4KA 4HY2A 2OJXA 5AJ9A 2IA9A 1N2KA 4X9VA 5J19A 4X9RA 2QZUA 4N7VA 2N19A 4H5XA 3RQ7A 4HCOA 3C5LA 4CYRA 4DFWA 4J7BB 1P49A 4CXKA 4WHLA 4RS6A 2I9XA 1HDHA 3ED4A 1E2SP 4WHKA 4CYSA 5DMSA 1UMWA 3LM3A 4CXSA 4HABA 3FVHA 4E9CA 3Q1IA 1E3CP 3HIHA 4LKMA 2UV8G 3LXQA 1AUKA 4FDJA 3GYWA 4WHHA 4O6WA 5DMVC 5DAYA 4FDIA 2I9ZA 2VKZG 3P35A 4XB0A 3P36A 1N2LA 3HIKA 4YYPA 4N9JA 4O9WA 1E33P 1Q4OA 3BZIA 2E50A 4H71A 4N7ZA 4E67A 1F34B 3KDRA 3HFDA 1FSUA 1E1ZP 4E9DA 3P2ZA 1E2TA 5DNJA 4X9WA 1F32A 4CXUA 4NKBA 4RCPA 3P37A 3P34A 4LKLA 2OGQA 4NK7A 4O56A 4G7NA 3HMJG 5LHZA 3P2WA 3FS3A
chains in the Genus database with same CATH topology
1F34B 1F32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F34 B;  1F32 A; 
#chains in the Genus database with same CATH topology
 3GYV A;  1A87 A;  1Q4K A;  4HY2 A;  2OJX A;  5AJ9 A;  2IA9 A;  1N2K A;  4X9V A;  5J19 A;  4X9R A;  2QZU A;  4N7V A;  2N19 A;  4H5X A;  3RQ7 A;  4HCO A;  3C5L A;  4CYR A;  4DFW A;  4J7B B;  1P49 A;  4CXK A;  4WHL A;  4RS6 A;  2I9X A;  1HDH A;  3ED4 A;  1E2S P;  4WHK A;  4CYS A;  5DMS A;  1UMW A;  3LM3 A;  4CXS A;  4HAB A;  3FVH A;  4E9C A;  3Q1I A;  1E3C P;  3HIH A;  4LKM A;  2UV8 G;  3LXQ A;  1AUK A;  4FDJ A;  3GYW A;  4WHH A;  4O6W A;  5DMV C;  5DAY A;  4FDI A;  2I9Z A;  2VKZ G;  3P35 A;  4XB0 A;  3P36 A;  1N2L A;  3HIK A;  4YYP A;  4N9J A;  4O9W A;  1E33 P;  1Q4O A;  3BZI A;  2E50 A;  4H71 A;  4N7Z A;  4E67 A;  1F34 B;  3KDR A;  3HFD A;  1FSU A;  1E1Z P;  4E9D A;  3P2Z A;  1E2T A;  5DNJ A;  4X9W A;  1F32 A;  4CXU A;  4NKB A;  4RCP A;  3P37 A;  3P34 A;  4LKL A;  2OGQ A;  4NK7 A;  4O56 A;  4G7N A;  3HMJ G;  5LHZ A;  3P2W A;  3FS3 A; 
#chains in the Genus database with same CATH homology
 1F34 B;  1F32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...