4NKBA

Crystal structure of the cryptic polo box (cpb)of zyg-1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
203
Chain Sequence
QLWPIRMDRLEGQRVCTAGGRYIVELDTRCRFEVAAQGNFVKRILIVEVDEMVQTVYVHRIPDRTVRGRNGEEELITLTNNPFVYTSYSQMPKEVQNDYMRLQKMVAVTISGRVAKVTFRRPSQFPDAQAQLMENGDLRIKLPRSVIVRKMDNGEIFNCQKQAVSGITLTKVNEVYKYLIRFEQCLNGMDRCFPIVFSAGTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable serine/threonine-protein kinase zyg-1
publication title Structure of the C. elegans ZYG-1 Cryptic Polo Box Suggests a Conserved Mechanism for Centriolar Docking of Plk4 Kinases.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 46
structure length 203
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18531 Polo_box_2 Polo box domain
A PF18544 Polo_box_3 Polo box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nkbA01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nkbA02
4NKBA 4G7NA 4N7VA 4N9JA 4NK7A 4N7ZA
chains in the Genus database with same CATH superfamily
4CXUA 4E67A 3FS3A 3GYVA 4X9RA 5AJ9A 4E9CA 1P49A 3FVHA 4WHLA 1UMWA 2E50A 4O56A 1A87A 4N7ZA 4FDJA 4CYRA 2OJXA 4CXSA 1Q4OA 3KDRA 3GYWA 5J19A 1N2KA 3P36A 4O9WA 1E2TA 4X9VA 5DNJA 1E1ZP 1F34B 4WHHA 3C5LA 4FDIA 5DAYA 3RQ7A 4N7VA 3BZIA 4WHKA 4HABA 4HCOA 1E33P 2QZUA 4CYSA 4YYPA 4O6WA 1E3CP 3P34A 4RS6A 4G7NA 4DFWA 4NK7A 1HDHA 4H71A 4LKLA 1N2LA 4RCPA 3HIHA 2I9ZA 5DMSA 2VKZG 4XB0A 3HIKA 5DMVC 1F32A 3P2WA 3HFDA 2I9XA 4X9WA 4H5XA 3LXQA 3P37A 4E9DA 3HMJG 3Q1IA 3ED4A 3LM3A 4NKBA 1Q4KA 3P2ZA 1E2SP 2UV8G 4N9JA 4LKMA 4CXKA 3P35A 1AUKA 4HY2A 2OGQA 2IA9A 4J7BB 1FSUA 5LHZA 2N19A
chains in the Genus database with same CATH topology
3HMJG 4CXUA 3FS3A 4G7NA 1E1ZP 3GYVA 3ED4A 3LM3A 4NK7A 1HDHA 4NKBA 5AJ9A 4FDIA 1P49A 1N2LA 2E50A 5DAYA 1E2SP 2UV8G 4N9JA 4N7VA 4N7ZA 4FDJA 4CYRA 4CXKA 2VKZG 1AUKA 4CXSA 1E33P 2QZUA 3KDRA 4CYSA 3GYWA 1N2KA 1FSUA 3HFDA 1E3CP 3LXQA 1E2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKB A;  4G7N A;  4N7V A;  4N9J A;  4NK7 A;  4N7Z A; 
#chains in the Genus database with same CATH topology
 4CXU A;  4E67 A;  3FS3 A;  3GYV A;  4X9R A;  5AJ9 A;  4E9C A;  1P49 A;  3FVH A;  4WHL A;  1UMW A;  2E50 A;  4O56 A;  1A87 A;  4N7Z A;  4FDJ A;  4CYR A;  2OJX A;  4CXS A;  1Q4O A;  3KDR A;  3GYW A;  5J19 A;  1N2K A;  3P36 A;  4O9W A;  1E2T A;  4X9V A;  5DNJ A;  1E1Z P;  1F34 B;  4WHH A;  3C5L A;  4FDI A;  5DAY A;  3RQ7 A;  4N7V A;  3BZI A;  4WHK A;  4HAB A;  4HCO A;  1E33 P;  2QZU A;  4CYS A;  4YYP A;  4O6W A;  1E3C P;  3P34 A;  4RS6 A;  4G7N A;  4DFW A;  4NK7 A;  1HDH A;  4H71 A;  4LKL A;  1N2L A;  4RCP A;  3HIH A;  2I9Z A;  5DMS A;  2VKZ G;  4XB0 A;  3HIK A;  5DMV C;  1F32 A;  3P2W A;  3HFD A;  2I9X A;  4X9W A;  4H5X A;  3LXQ A;  3P37 A;  4E9D A;  3HMJ G;  3Q1I A;  3ED4 A;  3LM3 A;  4NKB A;  1Q4K A;  3P2Z A;  1E2S P;  2UV8 G;  4N9J A;  4LKM A;  4CXK A;  3P35 A;  1AUK A;  4HY2 A;  2OGQ A;  2IA9 A;  4J7B B;  1FSU A;  5LHZ A;  2N19 A; 
#chains in the Genus database with same CATH homology
 3HMJ G;  4CXU A;  3FS3 A;  4G7N A;  1E1Z P;  3GYV A;  3ED4 A;  3LM3 A;  4NK7 A;  1HDH A;  4NKB A;  5AJ9 A;  4FDI A;  1P49 A;  1N2L A;  2E50 A;  5DAY A;  1E2S P;  2UV8 G;  4N9J A;  4N7V A;  4N7Z A;  4FDJ A;  4CYR A;  4CXK A;  2VKZ G;  1AUK A;  4CXS A;  1E33 P;  2QZU A;  3KDR A;  4CYS A;  3GYW A;  1N2K A;  1FSU A;  3HFD A;  1E3C P;  3LXQ A;  1E2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...