4NKBA

Crystal structure of the cryptic polo box (cpb)of zyg-1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
203
Chain Sequence
QLWPIRMDRLEGQRVCTAGGRYIVELDTRCRFEVAAQGNFVKRILIVEVDEMVQTVYVHRIPDRTVRGRNGEEELITLTNNPFVYTSYSQMPKEVQNDYMRLQKMVAVTISGRVAKVTFRRPSQFPDAQAQLMENGDLRIKLPRSVIVRKMDNGEIFNCQKQAVSGITLTKVNEVYKYLIRFEQCLNGMDRCFPIVFSAGTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Probable serine/threonine-protein kinase zyg-1
publication title Structure of the C. elegans ZYG-1 Cryptic Polo Box Suggests a Conserved Mechanism for Centriolar Docking of Plk4 Kinases.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 46
structure length 203
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18531 Polo_box_2 Polo box domain
A PF18544 Polo_box_3 Polo box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nkbA01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nkbA02
4G7NA 4N7ZA 4N9JA 4NK7A 4N7VA 4NKBA
chains in the Genus database with same CATH superfamily
3GYWA 4N7ZA 4H5XA 4DFWA 1FSUA 5DNJA 4X9RA 3Q1IA 3HIHA 4CYRA 4RCPA 4HABA 4CYSA 4E9DA 3P2WA 1N2LA 3KDRA 4WHKA 4E67A 4X9WA 4LKMA 4E9CA 1P49A 2E50A 1Q4KA 4O6WA 1E2TA 4O56A 3ED4A 3FVHA 3HFDA 4NKBA 1F32A 4N9JA 2QZUA 5LHZA 4FDIA 4RS6A 2N19A 4N7VA 1AUKA 4HCOA 2UV8G 1E33P 5DMSA 5DAYA 3LXQA 4G7NA 5DMVC 2OGQA 4LKLA 3RQ7A 4CXSA 1UMWA 3GYVA 2OJXA 4CXKA 1N2KA 3P37A 2I9XA 3HMJG 4HY2A 4O9WA 5AJ9A 4J7BB 1E2SP 2IA9A 3BZIA 3LM3A 5J19A 2VKZG 4WHHA 3C5LA 4YYPA 1Q4OA 1F34B 4CXUA 1E1ZP 1A87A 3FS3A 4XB0A 3P35A 2I9ZA 1HDHA 4FDJA 4NK7A 4H71A 3P36A 3P34A 3HIKA 4WHLA 4X9VA 1E3CP 3P2ZA
chains in the Genus database with same CATH topology
3GYWA 4G7NA 4N7ZA 4CXSA 1E2TA 3ED4A 4CXUA 1FSUA 3GYVA 3HFDA 4NKBA 4CXKA 1E1ZP 4N9JA 3FS3A 1N2KA 4CYRA 4CYSA 2QZUA 3HMJG 1HDHA 1N2LA 3KDRA 4FDJA 4FDIA 5AJ9A 4NK7A 1E2SP 4N7VA 1AUKA 5DAYA 3LM3A 2VKZG 2UV8G 1P49A 1E33P 2E50A 1E3CP 3LXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7N A;  4N7Z A;  4N9J A;  4NK7 A;  4N7V A;  4NKB A; 
#chains in the Genus database with same CATH topology
 3GYW A;  4N7Z A;  4H5X A;  4DFW A;  1FSU A;  5DNJ A;  4X9R A;  3Q1I A;  3HIH A;  4CYR A;  4RCP A;  4HAB A;  4CYS A;  4E9D A;  3P2W A;  1N2L A;  3KDR A;  4WHK A;  4E67 A;  4X9W A;  4LKM A;  4E9C A;  1P49 A;  2E50 A;  1Q4K A;  4O6W A;  1E2T A;  4O56 A;  3ED4 A;  3FVH A;  3HFD A;  4NKB A;  1F32 A;  4N9J A;  2QZU A;  5LHZ A;  4FDI A;  4RS6 A;  2N19 A;  4N7V A;  1AUK A;  4HCO A;  2UV8 G;  1E33 P;  5DMS A;  5DAY A;  3LXQ A;  4G7N A;  5DMV C;  2OGQ A;  4LKL A;  3RQ7 A;  4CXS A;  1UMW A;  3GYV A;  2OJX A;  4CXK A;  1N2K A;  3P37 A;  2I9X A;  3HMJ G;  4HY2 A;  4O9W A;  5AJ9 A;  4J7B B;  1E2S P;  2IA9 A;  3BZI A;  3LM3 A;  5J19 A;  2VKZ G;  4WHH A;  3C5L A;  4YYP A;  1Q4O A;  1F34 B;  4CXU A;  1E1Z P;  1A87 A;  3FS3 A;  4XB0 A;  3P35 A;  2I9Z A;  1HDH A;  4FDJ A;  4NK7 A;  4H71 A;  3P36 A;  3P34 A;  3HIK A;  4WHL A;  4X9V A;  1E3C P;  3P2Z A; 
#chains in the Genus database with same CATH homology
 3GYW A;  4G7N A;  4N7Z A;  4CXS A;  1E2T A;  3ED4 A;  4CXU A;  1FSU A;  3GYV A;  3HFD A;  4NKB A;  4CXK A;  1E1Z P;  4N9J A;  3FS3 A;  1N2K A;  4CYR A;  4CYS A;  2QZU A;  3HMJ G;  1HDH A;  1N2L A;  3KDR A;  4FDJ A;  4FDI A;  5AJ9 A;  4NK7 A;  1E2S P;  4N7V A;  1AUK A;  5DAY A;  3LM3 A;  2VKZ G;  2UV8 G;  1P49 A;  1E33 P;  2E50 A;  1E3C P;  3LXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...