4NKBA

Crystal structure of the cryptic polo box (cpb)of zyg-1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
203
Chain Sequence
QLWPIRMDRLEGQRVCTAGGRYIVELDTRCRFEVAAQGNFVKRILIVEVDEMVQTVYVHRIPDRTVRGRNGEEELITLTNNPFVYTSYSQMPKEVQNDYMRLQKMVAVTISGRVAKVTFRRPSQFPDAQAQLMENGDLRIKLPRSVIVRKMDNGEIFNCQKQAVSGITLTKVNEVYKYLIRFEQCLNGMDRCFPIVFSAGTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable serine/threonine-protein kinase zyg-1
publication title Structure of the C. elegans ZYG-1 Cryptic Polo Box Suggests a Conserved Mechanism for Centriolar Docking of Plk4 Kinases.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 46
structure length 203
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18531 Polo_box_2 Polo box domain
A PF18544 Polo_box_3 Polo box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nkbA01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nkbA02
4N7ZA 4N7VA 4NKBA 4NK7A 4N9JA 4G7NA
chains in the Genus database with same CATH superfamily
4CXSA 3HIKA 4YYPA 4RS6A 1HDHA 4CYSA 2I9XA 1N2LA 4WHHA 4CYRA 3ED4A 4FDJA 3C5LA 4N7ZA 3FS3A 4E9CA 1E3CP 1F34B 1N2KA 4FDIA 4X9WA 4XB0A 4HCOA 3KDRA 5LHZA 4CXKA 1AUKA 2OGQA 4N9JA 4O9WA 1F32A 1Q4OA 1P49A 4NK7A 5DMVC 2OJXA 3Q1IA 4LKLA 2QZUA 3HIHA 4X9RA 4DFWA 1UMWA 4X9VA 3P35A 4WHLA 2UV8G 4G7NA 4J7BB 5J19A 4N7VA 4NKBA 2VKZG 3GYVA 2E50A 2I9ZA 3GYWA 4HY2A 4RCPA 3LXQA 4HABA 2IA9A 3P2ZA 4WHKA 3FVHA 1FSUA 3P36A 4H71A 3RQ7A 3P2WA 1E2TA 1Q4KA 4H5XA 3LM3A 3BZIA 2N19A 4E9DA 1E33P 3HFDA 5DMSA 4E67A 4CXUA 4LKMA 4O6WA 3P34A 5DNJA 3HMJG 5AJ9A 1E1ZP 3P37A 1A87A 1E2SP 4O56A 5DAYA
chains in the Genus database with same CATH topology
4CXSA 1AUKA 4N7VA 4NKBA 2VKZG 1HDHA 4CYSA 1FSUA 4N9JA 1N2LA 3GYVA 1E2TA 2E50A 4CYRA 1P49A 3ED4A 3LM3A 4NK7A 4FDJA 3GYWA 4N7ZA 5DAYA 1E33P 3FS3A 3HFDA 3LXQA 1E3CP 2QZUA 4CXUA 3HMJG 1N2KA 4FDIA 5AJ9A 1E1ZP 3KDRA 2UV8G 4CXKA 1E2SP 4G7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N7Z A;  4N7V A;  4NKB A;  4NK7 A;  4N9J A;  4G7N A; 
#chains in the Genus database with same CATH topology
 4CXS A;  3HIK A;  4YYP A;  4RS6 A;  1HDH A;  4CYS A;  2I9X A;  1N2L A;  4WHH A;  4CYR A;  3ED4 A;  4FDJ A;  3C5L A;  4N7Z A;  3FS3 A;  4E9C A;  1E3C P;  1F34 B;  1N2K A;  4FDI A;  4X9W A;  4XB0 A;  4HCO A;  3KDR A;  5LHZ A;  4CXK A;  1AUK A;  2OGQ A;  4N9J A;  4O9W A;  1F32 A;  1Q4O A;  1P49 A;  4NK7 A;  5DMV C;  2OJX A;  3Q1I A;  4LKL A;  2QZU A;  3HIH A;  4X9R A;  4DFW A;  1UMW A;  4X9V A;  3P35 A;  4WHL A;  2UV8 G;  4G7N A;  4J7B B;  5J19 A;  4N7V A;  4NKB A;  2VKZ G;  3GYV A;  2E50 A;  2I9Z A;  3GYW A;  4HY2 A;  4RCP A;  3LXQ A;  4HAB A;  2IA9 A;  3P2Z A;  4WHK A;  3FVH A;  1FSU A;  3P36 A;  4H71 A;  3RQ7 A;  3P2W A;  1E2T A;  1Q4K A;  4H5X A;  3LM3 A;  3BZI A;  2N19 A;  4E9D A;  1E33 P;  3HFD A;  5DMS A;  4E67 A;  4CXU A;  4LKM A;  4O6W A;  3P34 A;  5DNJ A;  3HMJ G;  5AJ9 A;  1E1Z P;  3P37 A;  1A87 A;  1E2S P;  4O56 A;  5DAY A; 
#chains in the Genus database with same CATH homology
 4CXS A;  1AUK A;  4N7V A;  4NKB A;  2VKZ G;  1HDH A;  4CYS A;  1FSU A;  4N9J A;  1N2L A;  3GYV A;  1E2T A;  2E50 A;  4CYR A;  1P49 A;  3ED4 A;  3LM3 A;  4NK7 A;  4FDJ A;  3GYW A;  4N7Z A;  5DAY A;  1E33 P;  3FS3 A;  3HFD A;  3LXQ A;  1E3C P;  2QZU A;  4CXU A;  3HMJ G;  1N2K A;  4FDI A;  5AJ9 A;  1E1Z P;  3KDR A;  2UV8 G;  4CXK A;  1E2S P;  4G7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...