4NKBA

Crystal structure of the cryptic polo box (cpb)of zyg-1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
203
Chain Sequence
QLWPIRMDRLEGQRVCTAGGRYIVELDTRCRFEVAAQGNFVKRILIVEVDEMVQTVYVHRIPDRTVRGRNGEEELITLTNNPFVYTSYSQMPKEVQNDYMRLQKMVAVTISGRVAKVTFRRPSQFPDAQAQLMENGDLRIKLPRSVIVRKMDNGEIFNCQKQAVSGITLTKVNEVYKYLIRFEQCLNGMDRCFPIVFSAGTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C. elegans ZYG-1 Cryptic Polo Box Suggests a Conserved Mechanism for Centriolar Docking of Plk4 Kinases.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
molecule keywords Probable serine/threonine-protein kinase zyg-1
total genus 46
structure length 203
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18531 Polo_box_2 Polo box domain
A PF18544 Polo_box_3 Polo box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nkbA01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nkbA02
4NK7A 4N7ZA 4NKBA 4G7NA 4N9JA 4N7VA
chains in the Genus database with same CATH superfamily
5DMSA 1Q4KA 1A87A 1N2KA 4N7ZA 4O56A 5AJ9A 4H5XA 1E33P 1N2LA 1E1ZP 4HABA 1Q4OA 4RS6A 4WHLA 3GYVA 3P2WA 4NKBA 3HMJG 4FDJA 4O6WA 4XB0A 4LKMA 2VKZG 3C5LA 3KDRA 4CYSA 4FDIA 3HIHA 1FSUA 3P35A 4HY2A 1F32A 4X9WA 4DFWA 4E9CA 3GYWA 2OJXA 4YYPA 4HCOA 2UV8G 1F34B 3FVHA 4RCPA 3LXQA 4N9JA 4J7BB 4N7VA 5DAYA 1HDHA 5DMVC 3RQ7A 4CYRA 3P36A 4CXKA 2I9ZA 2OGQA 3HFDA 4E9DA 4X9RA 4O9WA 2E50A 3ED4A 3P34A 4LKLA 1AUKA 3BZIA 4G7NA 4CXSA 2IA9A 2I9XA 4NK7A 4WHHA 1E3CP 4E67A 2N19A 3LM3A 1P49A 2QZUA 1UMWA 4H71A 3Q1IA 3P37A 4CXUA 3HIKA 4X9VA 1E2TA 5DNJA 4WHKA 5LHZA 3P2ZA 5J19A 1E2SP 3FS3A
chains in the Genus database with same CATH topology
1AUKA 4NKBA 3GYWA 4G7NA 3HMJG 4FDJA 4CXSA 2UV8G 1N2KA 4NK7A 4N7ZA 1E3CP 5AJ9A 3LM3A 2VKZG 3LXQA 4N9JA 3KDRA 1E33P 1P49A 2QZUA 4N7VA 5DAYA 1HDHA 4CYSA 1N2LA 1E1ZP 4FDIA 1FSUA 4CXUA 4CYRA 4CXKA 1E2TA 3GYVA 1E2SP 3HFDA 2E50A 3ED4A 3FS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NK7 A;  4N7Z A;  4NKB A;  4G7N A;  4N9J A;  4N7V A; 
#chains in the Genus database with same CATH topology
 5DMS A;  1Q4K A;  1A87 A;  1N2K A;  4N7Z A;  4O56 A;  5AJ9 A;  4H5X A;  1E33 P;  1N2L A;  1E1Z P;  4HAB A;  1Q4O A;  4RS6 A;  4WHL A;  3GYV A;  3P2W A;  4NKB A;  3HMJ G;  4FDJ A;  4O6W A;  4XB0 A;  4LKM A;  2VKZ G;  3C5L A;  3KDR A;  4CYS A;  4FDI A;  3HIH A;  1FSU A;  3P35 A;  4HY2 A;  1F32 A;  4X9W A;  4DFW A;  4E9C A;  3GYW A;  2OJX A;  4YYP A;  4HCO A;  2UV8 G;  1F34 B;  3FVH A;  4RCP A;  3LXQ A;  4N9J A;  4J7B B;  4N7V A;  5DAY A;  1HDH A;  5DMV C;  3RQ7 A;  4CYR A;  3P36 A;  4CXK A;  2I9Z A;  2OGQ A;  3HFD A;  4E9D A;  4X9R A;  4O9W A;  2E50 A;  3ED4 A;  3P34 A;  4LKL A;  1AUK A;  3BZI A;  4G7N A;  4CXS A;  2IA9 A;  2I9X A;  4NK7 A;  4WHH A;  1E3C P;  4E67 A;  2N19 A;  3LM3 A;  1P49 A;  2QZU A;  1UMW A;  4H71 A;  3Q1I A;  3P37 A;  4CXU A;  3HIK A;  4X9V A;  1E2T A;  5DNJ A;  4WHK A;  5LHZ A;  3P2Z A;  5J19 A;  1E2S P;  3FS3 A; 
#chains in the Genus database with same CATH homology
 1AUK A;  4NKB A;  3GYW A;  4G7N A;  3HMJ G;  4FDJ A;  4CXS A;  2UV8 G;  1N2K A;  4NK7 A;  4N7Z A;  1E3C P;  5AJ9 A;  3LM3 A;  2VKZ G;  3LXQ A;  4N9J A;  3KDR A;  1E33 P;  1P49 A;  2QZU A;  4N7V A;  5DAY A;  1HDH A;  4CYS A;  1N2L A;  1E1Z P;  4FDI A;  1FSU A;  4CXU A;  4CYR A;  4CXK A;  1E2T A;  3GYV A;  1E2S P;  3HFD A;  2E50 A;  3ED4 A;  3FS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...