1FSUA

Crystal structure of 4-sulfatase (human)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
Knots found
sequence length
492
structure length
474
Chain Sequence
SRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ACETYLGALACTOSAMINE-4-SULFATASE
publication title Structure of a human lysosomal sulfatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 164
structure length 474
sequence length 492
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.6.12: N-acetylgalactosamine-4-sulfatase.
pdb deposition date 1996-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1fsuA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1fsuA01
1EW8A 1KH7A 5DLWA 4UPLA 5LIAA 1E1ZP 2X98A 5AJ9A 3IGZB 5L0EA 3BDGB 3BDGA 4NWXA 1ED8A 1ED9A 2W8DA 1ELZA 4CYRA 5GRRA 2VQRA 5L0KA 1HQAA 4LRFA 4FDJA 1KH9A 2ZKTA 1KH5A 2IFYA 1ALKA 2GSOA 1AJAA 1FSUA 4KAVA 3NKMA 5LQQA 4CXKA 2GA3A 1KH4A 2W8SA 3BDFA 3UO0A 3WAVA 4UPKA 5INHA 1ZEFA 4QAXA 1E3CP 5GOVA 5TJ3A 5DLVA 5LRMA 4UPIA 1URBA 3M7VA 4LRBA 4MHXA 2GSUA 3WAWA 5C66A 1ALHA 3IDDA 4LQYA 3WAXA 4GTYA 4LR9A 1ANJA 5EGEA 3M8YA 1EW2A 4CXSA 1HDHA 3NKNA 5K4PA 3T01A 4ZG9A 1HJKA 1O99A 4MIVA 4LRCA 4KJDA 1EQJA 1AUKA 1ELXA 3NKPA 1N2KA 3MK2A 5L0BA 1EJJA 1E33P 5LRNA 1URAA 1KHJA 4MY4A 3UN2A 1P49A 1K7HA 1ANIA 2W5WA 1EW9A 4LR7A 2D1GA 2IUCB 4KAYA 4LRDA 3A52A 3T02A 3WAYA 1N2LA 4ZG6A 1AJDA 4GTZA 3SZYA 1AJBA 2W5SA 2W5VA 1SHQA 2GLQA 3TX0A 1SHNA 3LXQA 3KD8A 1ELYA 4NWJA 3IGYB 1ALJA 5IJQA 1Y6VA 4B56A 3ED4A 3TG0A 1AJCA 3TWZA 2G9YA 1EI6A 3NKRA 3SZZA 2W5QA 2W5RA 2ANHA 2XRGA 4GTWA 4UORA 5EGHA 4UOOA 3T00A 3DPCA 2W5TA 3NKOA 4LR8A 3WBHA 5KXAA 2W5XA 4UOPA 1KHNA 3UN5A 4UPHA 4LR2A 4ZG7A 1O98A 4GTXA 4TN0A 4ZGAA 2IUCA 1Y7AA 3UN3A 3MK0A 3BDHA 4FDIA 3Q3QA 1KHLA 4KM4A 3B5QA 1ZEBA 2GSNA 1KHKA 3NVLA 4YR1A 5HRTA 1E2SP 3OT9A 4N7TA 4LRAA 3M8WA 3UNYA 1B8JA 4LREA 4CXUA 1ZEDA 3DYCA 2QZUA 4KJGA 1ALIA 2RH6A 3MK1A 2XR9A 4CYSA 3NKQA 3CMRA 5IJSA 3E2DA 3M8ZA 5DLTA
chains in the Genus database with same CATH superfamily
1EW8A 1KH7A 2I9ZA 5DLWA 4UPLA 5LIAA 1E1ZP 2X98A 5AJ9A 3IGZB 5L0EA 2UV8G 3BDGB 3BDGA 4NWXA 3HFDA 1ED8A 3P36A 1ED9A 4X9WA 4CYRA 1ELZA 2W8DA 5GRRA 2VQRA 5L0KA 4X9VA 1HQAA 1Q4KA 4LRFA 4FDJA 3P2ZA 1KH9A 2ZKTA 1KH5A 3KDRA 2IFYA 3Q1IA 4XB0A 1ALKA 2GSOA 1AJAA 2I9XA 1FSUA 3P34A 4KAVA 3NKMA 3LM3A 5LQQA 4CXKA 2GA3A 2IA9A 5DMVC 2N19A 1KH4A 2W8SA 4O56A 2OJXA 4WHKA 3BDFA 3UO0A 3WAVA 4UPKA 5INHA 1Q4OA 1ZEFA 3GYWA 1E3CP 4J7BB 4QAXA 4E9DA 5GOVA 4LKMA 5TJ3A 5DLVA 5LRMA 4HY2A 1URBA 3M7VA 4LRBA 4MHXA 3HIKA 4UPIA 2GSUA 3WAWA 5C66A 1ALHA 3RQ7A 4RS6A 3IDDA 2E50A 4LQYA 3WAXA 4GTYA 1F32A 4H5XA 4O9WA 4RCPA 4LR9A 1ANJA 5EGEA 3M8YA 4N7ZA 1EW2A 4CXSA 1HDHA 3NKNA 5K4PA 3T01A 2VKZG 2OGQA 4ZG9A 1HJKA 1O99A 4MIVA 4LRCA 3P2WA 4KJDA 1EQJA 1AUKA 4HCOA 1ELXA 3NKPA 3GYVA 1N2KA 3MK2A 4DFWA 1EJJA 1E33P 4E67A 4HABA 4N9JA 1URAA 4G7NA 5L0BA 5LRNA 1KHJA 5LHZA 3HIHA 4MY4A 3UN2A 1P49A 1K7HA 1ANIA 2W5WA 3P35A 3BZIA 4LKLA 1EW9A 2D1GA 2IUCB 4KAYA 4LR7A 4LRDA 5J19A 3A52A 3T02A 3WAYA 4YYPA 1N2LA 4ZG6A 1AJDA 4GTZA 1UMWA 1AJBA 3SZYA 5DNJA 2W5SA 3FVHA 2W5VA 1SHQA 2GLQA 3TX0A 1SHNA 3LXQA 3KD8A 4WHHA 5DAYA 5DMSA 1ELYA 3IGYB 4NWJA 5IJQA 1Y6VA 4B56A 3ED4A 1ALJA 3TG0A 1AJCA 4WHLA 3TWZA 4X9RA 2G9YA 1EI6A 3NKRA 3SZZA 2W5QA 2W5RA 2ANHA 2XRGA 3FS3A 4GTWA 4UORA 4N7VA 5EGHA 3T00A 4UOOA 3DPCA 2W5TA 3NKOA 4LR8A 3WBHA 5KXAA 3HMJG 2W5XA 4UOPA 1KHNA 3UN5A 3P37A 4UPHA 4H71A 4LR2A 4ZG7A 1O98A 4GTXA 4TN0A 4ZGAA 2IUCA 1Y7AA 1F34B 3UN3A 3MK0A 3BDHA 4FDIA 3Q3QA 1KHLA 4KM4A 3B5QA 1ZEBA 3C5LA 2GSNA 1KHKA 1E2TA 3NVLA 4YR1A 5HRTA 1E2SP 3OT9A 4N7TA 4LRAA 3M8WA 3UNYA 4O6WA 1B8JA 1A87A 4LREA 4E9CA 4CXUA 1ZEDA 3DYCA 2QZUA 4KJGA 1ALIA 2RH6A 4NK7A 3MK1A 2XR9A 4CYSA 4NKBA 3NKQA 3CMRA 5IJSA 3E2DA 3M8ZA 5DLTA
chains in the Genus database with same CATH topology
1EW8A 1KH7A 5DLWA 4UPLA 5LIAA 1E1ZP 2X98A 5AJ9A 3IGZB 5L0EA 2UV8G 3BDGB 3BDGA 4NWXA 3HFDA 1ED8A 1ED9A 2W8DA 1ELZA 4CYRA 5GRRA 2VQRA 5L0KA 1HQAA 4LRFA 4FDJA 1KH9A 2ZKTA 1KH5A 3KDRA 2IFYA 1ALKA 2GSOA 1AJAA 1FSUA 4KAVA 3NKMA 3LM3A 5LQQA 4CXKA 2GA3A 1KH4A 2W8SA 3BDFA 3UO0A 3WAVA 4UPKA 5INHA 1ZEFA 3GYWA 1E3CP 4QAXA 5GOVA 5TJ3A 5DLVA 5LRMA 4UPIA 1URBA 3M7VA 4LRBA 4MHXA 2GSUA 3WAWA 5C66A 1ALHA 3IDDA 2E50A 4LQYA 3WAXA 4GTYA 4LR9A 1ANJA 5EGEA 3M8YA 4N7ZA 1EW2A 4CXSA 1HDHA 3NKNA 5K4PA 3T01A 2VKZG 4ZG9A 1HJKA 1O99A 4MIVA 4LRCA 4KJDA 1EQJA 1AUKA 1ELXA 3NKPA 3GYVA 1N2KA 3MK2A 5L0BA 1EJJA 1E33P 5LRNA 1URAA 4N9JA 4G7NA 1KHJA 4MY4A 3UN2A 1P49A 1K7HA 1ANIA 2W5WA 1EW9A 4LR7A 2D1GA 2IUCB 4KAYA 4LRDA 3A52A 3T02A 3WAYA 1N2LA 4ZG6A 1AJDA 4GTZA 3SZYA 1AJBA 2W5SA 2W5VA 1SHQA 2GLQA 3TX0A 1SHNA 3LXQA 3KD8A 5DAYA 1ELYA 3IGYB 4NWJA 5IJQA 1ALJA 1Y6VA 4B56A 3ED4A 3TG0A 1AJCA 3TWZA 2G9YA 1EI6A 3NKRA 3SZZA 2W5QA 2W5RA 2ANHA 2XRGA 3FS3A 4GTWA 4UORA 4N7VA 5EGHA 3T00A 4UOOA 3DPCA 2W5TA 3NKOA 4LR8A 3WBHA 5KXAA 3HMJG 2W5XA 4UOPA 1KHNA 3UN5A 4UPHA 4LR2A 4ZG7A 1O98A 4GTXA 4TN0A 4ZGAA 2IUCA 1Y7AA 3UN3A 3MK0A 3BDHA 4FDIA 3Q3QA 1KHLA 4KM4A 3B5QA 1ZEBA 2GSNA 1KHKA 1E2TA 3NVLA 4YR1A 5HRTA 1E2SP 3OT9A 4N7TA 4LRAA 3M8WA 3UNYA 1B8JA 4LREA 4CXUA 1ZEDA 3DYCA 2QZUA 4KJGA 1ALIA 2RH6A 4NK7A 3MK1A 2XR9A 4CYSA 4NKBA 3NKQA 3CMRA 5IJSA 3E2DA 3M8ZA 5DLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EW8 A;  1KH7 A;  5DLW A;  4UPL A;  5LIA A;  1E1Z P;  2X98 A;  5AJ9 A;  3IGZ B;  5L0E A;  3BDG B;  3BDG A;  4NWX A;  1ED8 A;  1ED9 A;  2W8D A;  1ELZ A;  4CYR A;  5GRR A;  2VQR A;  5L0K A;  1HQA A;  4LRF A;  4FDJ A;  1KH9 A;  2ZKT A;  1KH5 A;  2IFY A;  1ALK A;  2GSO A;  1AJA A;  1FSU A;  4KAV A;  3NKM A;  5LQQ A;  4CXK A;  2GA3 A;  1KH4 A;  2W8S A;  3BDF A;  3UO0 A;  3WAV A;  4UPK A;  5INH A;  1ZEF A;  4QAX A;  1E3C P;  5GOV A;  5TJ3 A;  5DLV A;  5LRM A;  4UPI A;  1URB A;  3M7V A;  4LRB A;  4MHX A;  2GSU A;  3WAW A;  5C66 A;  1ALH A;  3IDD A;  4LQY A;  3WAX A;  4GTY A;  4LR9 A;  1ANJ A;  5EGE A;  3M8Y A;  1EW2 A;  4CXS A;  1HDH A;  3NKN A;  5K4P A;  3T01 A;  4ZG9 A;  1HJK A;  1O99 A;  4MIV A;  4LRC A;  4KJD A;  1EQJ A;  1AUK A;  1ELX A;  3NKP A;  1N2K A;  3MK2 A;  5L0B A;  1EJJ A;  1E33 P;  5LRN A;  1URA A;  1KHJ A;  4MY4 A;  3UN2 A;  1P49 A;  1K7H A;  1ANI A;  2W5W A;  1EW9 A;  4LR7 A;  2D1G A;  2IUC B;  4KAY A;  4LRD A;  3A52 A;  3T02 A;  3WAY A;  1N2L A;  4ZG6 A;  1AJD A;  4GTZ A;  3SZY A;  1AJB A;  2W5S A;  2W5V A;  1SHQ A;  2GLQ A;  3TX0 A;  1SHN A;  3LXQ A;  3KD8 A;  1ELY A;  4NWJ A;  3IGY B;  1ALJ A;  5IJQ A;  1Y6V A;  4B56 A;  3ED4 A;  3TG0 A;  1AJC A;  3TWZ A;  2G9Y A;  1EI6 A;  3NKR A;  3SZZ A;  2W5Q A;  2W5R A;  2ANH A;  2XRG A;  4GTW A;  4UOR A;  5EGH A;  4UOO A;  3T00 A;  3DPC A;  2W5T A;  3NKO A;  4LR8 A;  3WBH A;  5KXA A;  2W5X A;  4UOP A;  1KHN A;  3UN5 A;  4UPH A;  4LR2 A;  4ZG7 A;  1O98 A;  4GTX A;  4TN0 A;  4ZGA A;  2IUC A;  1Y7A A;  3UN3 A;  3MK0 A;  3BDH A;  4FDI A;  3Q3Q A;  1KHL A;  4KM4 A;  3B5Q A;  1ZEB A;  2GSN A;  1KHK A;  3NVL A;  4YR1 A;  5HRT A;  1E2S P;  3OT9 A;  4N7T A;  4LRA A;  3M8W A;  3UNY A;  1B8J A;  4LRE A;  4CXU A;  1ZED A;  3DYC A;  2QZU A;  4KJG A;  1ALI A;  2RH6 A;  3MK1 A;  2XR9 A;  4CYS A;  3NKQ A;  3CMR A;  5IJS A;  3E2D A;  3M8Z A;  5DLT A; 
#chains in the Genus database with same CATH topology
 1EW8 A;  1KH7 A;  2I9Z A;  5DLW A;  4UPL A;  5LIA A;  1E1Z P;  2X98 A;  5AJ9 A;  3IGZ B;  5L0E A;  2UV8 G;  3BDG B;  3BDG A;  4NWX A;  3HFD A;  1ED8 A;  3P36 A;  1ED9 A;  4X9W A;  4CYR A;  1ELZ A;  2W8D A;  5GRR A;  2VQR A;  5L0K A;  4X9V A;  1HQA A;  1Q4K A;  4LRF A;  4FDJ A;  3P2Z A;  1KH9 A;  2ZKT A;  1KH5 A;  3KDR A;  2IFY A;  3Q1I A;  4XB0 A;  1ALK A;  2GSO A;  1AJA A;  2I9X A;  1FSU A;  3P34 A;  4KAV A;  3NKM A;  3LM3 A;  5LQQ A;  4CXK A;  2GA3 A;  2IA9 A;  5DMV C;  2N19 A;  1KH4 A;  2W8S A;  4O56 A;  2OJX A;  4WHK A;  3BDF A;  3UO0 A;  3WAV A;  4UPK A;  5INH A;  1Q4O A;  1ZEF A;  3GYW A;  1E3C P;  4J7B B;  4QAX A;  4E9D A;  5GOV A;  4LKM A;  5TJ3 A;  5DLV A;  5LRM A;  4HY2 A;  1URB A;  3M7V A;  4LRB A;  4MHX A;  3HIK A;  4UPI A;  2GSU A;  3WAW A;  5C66 A;  1ALH A;  3RQ7 A;  4RS6 A;  3IDD A;  2E50 A;  4LQY A;  3WAX A;  4GTY A;  1F32 A;  4H5X A;  4O9W A;  4RCP A;  4LR9 A;  1ANJ A;  5EGE A;  3M8Y A;  4N7Z A;  1EW2 A;  4CXS A;  1HDH A;  3NKN A;  5K4P A;  3T01 A;  2VKZ G;  2OGQ A;  4ZG9 A;  1HJK A;  1O99 A;  4MIV A;  4LRC A;  3P2W A;  4KJD A;  1EQJ A;  1AUK A;  4HCO A;  1ELX A;  3NKP A;  3GYV A;  1N2K A;  3MK2 A;  4DFW A;  1EJJ A;  1E33 P;  4E67 A;  4HAB A;  4N9J A;  1URA A;  4G7N A;  5L0B A;  5LRN A;  1KHJ A;  5LHZ A;  3HIH A;  4MY4 A;  3UN2 A;  1P49 A;  1K7H A;  1ANI A;  2W5W A;  3P35 A;  3BZI A;  4LKL A;  1EW9 A;  2D1G A;  2IUC B;  4KAY A;  4LR7 A;  4LRD A;  5J19 A;  3A52 A;  3T02 A;  3WAY A;  4YYP A;  1N2L A;  4ZG6 A;  1AJD A;  4GTZ A;  1UMW A;  1AJB A;  3SZY A;  5DNJ A;  2W5S A;  3FVH A;  2W5V A;  1SHQ A;  2GLQ A;  3TX0 A;  1SHN A;  3LXQ A;  3KD8 A;  4WHH A;  5DAY A;  5DMS A;  1ELY A;  3IGY B;  4NWJ A;  5IJQ A;  1Y6V A;  4B56 A;  3ED4 A;  1ALJ A;  3TG0 A;  1AJC A;  4WHL A;  3TWZ A;  4X9R A;  2G9Y A;  1EI6 A;  3NKR A;  3SZZ A;  2W5Q A;  2W5R A;  2ANH A;  2XRG A;  3FS3 A;  4GTW A;  4UOR A;  4N7V A;  5EGH A;  3T00 A;  4UOO A;  3DPC A;  2W5T A;  3NKO A;  4LR8 A;  3WBH A;  5KXA A;  3HMJ G;  2W5X A;  4UOP A;  1KHN A;  3UN5 A;  3P37 A;  4UPH A;  4H71 A;  4LR2 A;  4ZG7 A;  1O98 A;  4GTX A;  4TN0 A;  4ZGA A;  2IUC A;  1Y7A A;  1F34 B;  3UN3 A;  3MK0 A;  3BDH A;  4FDI A;  3Q3Q A;  1KHL A;  4KM4 A;  3B5Q A;  1ZEB A;  3C5L A;  2GSN A;  1KHK A;  1E2T A;  3NVL A;  4YR1 A;  5HRT A;  1E2S P;  3OT9 A;  4N7T A;  4LRA A;  3M8W A;  3UNY A;  4O6W A;  1B8J A;  1A87 A;  4LRE A;  4E9C A;  4CXU A;  1ZED A;  3DYC A;  2QZU A;  4KJG A;  1ALI A;  2RH6 A;  4NK7 A;  3MK1 A;  2XR9 A;  4CYS A;  4NKB A;  3NKQ A;  3CMR A;  5IJS A;  3E2D A;  3M8Z A;  5DLT A; 
#chains in the Genus database with same CATH homology
 1EW8 A;  1KH7 A;  5DLW A;  4UPL A;  5LIA A;  1E1Z P;  2X98 A;  5AJ9 A;  3IGZ B;  5L0E A;  2UV8 G;  3BDG B;  3BDG A;  4NWX A;  3HFD A;  1ED8 A;  1ED9 A;  2W8D A;  1ELZ A;  4CYR A;  5GRR A;  2VQR A;  5L0K A;  1HQA A;  4LRF A;  4FDJ A;  1KH9 A;  2ZKT A;  1KH5 A;  3KDR A;  2IFY A;  1ALK A;  2GSO A;  1AJA A;  1FSU A;  4KAV A;  3NKM A;  3LM3 A;  5LQQ A;  4CXK A;  2GA3 A;  1KH4 A;  2W8S A;  3BDF A;  3UO0 A;  3WAV A;  4UPK A;  5INH A;  1ZEF A;  3GYW A;  1E3C P;  4QAX A;  5GOV A;  5TJ3 A;  5DLV A;  5LRM A;  4UPI A;  1URB A;  3M7V A;  4LRB A;  4MHX A;  2GSU A;  3WAW A;  5C66 A;  1ALH A;  3IDD A;  2E50 A;  4LQY A;  3WAX A;  4GTY A;  4LR9 A;  1ANJ A;  5EGE A;  3M8Y A;  4N7Z A;  1EW2 A;  4CXS A;  1HDH A;  3NKN A;  5K4P A;  3T01 A;  2VKZ G;  4ZG9 A;  1HJK A;  1O99 A;  4MIV A;  4LRC A;  4KJD A;  1EQJ A;  1AUK A;  1ELX A;  3NKP A;  3GYV A;  1N2K A;  3MK2 A;  5L0B A;  1EJJ A;  1E33 P;  5LRN A;  1URA A;  4N9J A;  4G7N A;  1KHJ A;  4MY4 A;  3UN2 A;  1P49 A;  1K7H A;  1ANI A;  2W5W A;  1EW9 A;  4LR7 A;  2D1G A;  2IUC B;  4KAY A;  4LRD A;  3A52 A;  3T02 A;  3WAY A;  1N2L A;  4ZG6 A;  1AJD A;  4GTZ A;  3SZY A;  1AJB A;  2W5S A;  2W5V A;  1SHQ A;  2GLQ A;  3TX0 A;  1SHN A;  3LXQ A;  3KD8 A;  5DAY A;  1ELY A;  3IGY B;  4NWJ A;  5IJQ A;  1ALJ A;  1Y6V A;  4B56 A;  3ED4 A;  3TG0 A;  1AJC A;  3TWZ A;  2G9Y A;  1EI6 A;  3NKR A;  3SZZ A;  2W5Q A;  2W5R A;  2ANH A;  2XRG A;  3FS3 A;  4GTW A;  4UOR A;  4N7V A;  5EGH A;  3T00 A;  4UOO A;  3DPC A;  2W5T A;  3NKO A;  4LR8 A;  3WBH A;  5KXA A;  3HMJ G;  2W5X A;  4UOP A;  1KHN A;  3UN5 A;  4UPH A;  4LR2 A;  4ZG7 A;  1O98 A;  4GTX A;  4TN0 A;  4ZGA A;  2IUC A;  1Y7A A;  3UN3 A;  3MK0 A;  3BDH A;  4FDI A;  3Q3Q A;  1KHL A;  4KM4 A;  3B5Q A;  1ZEB A;  2GSN A;  1KHK A;  1E2T A;  3NVL A;  4YR1 A;  5HRT A;  1E2S P;  3OT9 A;  4N7T A;  4LRA A;  3M8W A;  3UNY A;  1B8J A;  4LRE A;  4CXU A;  1ZED A;  3DYC A;  2QZU A;  4KJG A;  1ALI A;  2RH6 A;  4NK7 A;  3MK1 A;  2XR9 A;  4CYS A;  4NKB A;  3NKQ A;  3CMR A;  5IJS A;  3E2D A;  3M8Z A;  5DLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...