1FSUA

Crystal structure of 4-sulfatase (human)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
Knots found
sequence length
492
structure length
474
Chain Sequence
b'SRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ACETYLGALACTOSAMINE-4-SULFATASE
publication title Structure of a human lysosomal sulfatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 164
structure length 474
sequence length 492
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.6.12: N-acetylgalactosamine-4-sulfatase.
pdb deposition date 1996-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1fsuA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1fsuA01
3M8WA 4B56A 1EW9A 4ZG7A 3OT9A 5EGEA 5GOVA 2GSUA 2XRGA 4CYSA 2D1GA 4CYRA 1K7HA 5DLVA 4LRFA 3UO0A 4CXSA 2GLQA 4UPIA 1E1ZP 2W8SA 4UPLA 4GTWA 4LR7A 4TN0A 1AUKA 1B8JA 1KHKA 4LR9A 1ZEDA 1HJKA 3MK1A 4LR8A 3DPCA 1ANIA 4KJGA 5C66A 1N2LA 4YR1A 1KHLA 1KH7A 1O99A 2W5RA 2G9YA 4NWJA 3UN3A 4KAYA 2W5TA 3WAVA 3BDGB 1ZEBA 4LRBA 5DLWA 3T01A 2IUCA 3TWZA 4GTZA 1O98A 1EW2A 2W5XA 4LRAA 2X98A 5K4PA 3T00A 3TX0A 3SZZA 2W8DA 5TJ3A 1ALKA 2QZUA 2ZKTA 1EQJA 5L0EA 5L0BA 4GTYA 3M7VA 5AJ9A 1E33P 3NKOA 1AJDA 3BDGA 2IFYA 2GSOA 3WBHA 2GA3A 5LIAA 1EI6A 4UORA 4UOPA 1ALHA 3WAWA 1URAA 4FDIA 2VQRA 4LQYA 3M8YA 4MY4A 1FSUA 1E3CP 1N2KA 1HQAA 1SHNA 2W5SA 1AJBA 5KXAA 3LXQA 3NKPA 3MK2A 2W5WA 3KD8A 3NKMA 5LRMA 1ED9A 3ED4A 4N7TA 1KH5A 5INHA 1ZEFA 1ELZA 1EW8A 5IJSA 3IDDA 5IJQA 2W5VA 3CMRA 3DYCA 3BDFA 4KAVA 3UN2A 4ZG9A 3E2DA 5DLTA 5LQQA 4ZGAA 4LR2A 5L0KA 1ED8A 4CXKA 1KH4A 4LRDA 3MK0A 3M8ZA 3NVLA 3B5QA 1Y6VA 1HDHA 1AJCA 5LRNA 1EJJA 1P49A 1ALIA 4KM4A 4ZG6A 3IGYB 4NWXA 4LRCA 3WAYA 2RH6A 3NKQA 1AJAA 5HRTA 4FDJA 1Y7AA 4UOOA 1ELYA 1ALJA 2ANHA 1E2SP 4UPHA 1ELXA 3IGZB 3WAXA 3Q3QA 4UPKA 2IUCB 2W5QA 3BDHA 4CXUA 4MHXA 3NKRA 4MIVA 3UNYA 5EGHA 4LREA 2XR9A 1KH9A 3UN5A 3NKNA 3A52A 3SZYA 1URBA 1SHQA 4GTXA 1KHJA 3T02A 4QAXA 1ANJA 4KJDA 2GSNA 3TG0A 1KHNA 5GRRA
chains in the Genus database with same CATH superfamily
3M8WA 4B56A 1EW9A 4ZG7A 3OT9A 5EGEA 2VKZG 5GOVA 2GSUA 2XRGA 3P2WA 4CYSA 2D1GA 4J7BB 4G7NA 4XB0A 4CYRA 1K7HA 1UMWA 3LM3A 5DLVA 4H5XA 4LRFA 3UO0A 3HIKA 4CXSA 2GLQA 4O6WA 4UPIA 1E1ZP 2W8SA 3GYWA 4UPLA 3FVHA 4GTWA 4LR7A 4O56A 3KDRA 3C5LA 2UV8G 4TN0A 1AUKA 1B8JA 1KHKA 4LR9A 1ZEDA 1HJKA 3MK1A 4LR8A 3DPCA 2OGQA 1ANIA 4KJGA 3HMJG 5C66A 1N2LA 4YR1A 1KHLA 1KH7A 1O99A 2W5RA 4X9RA 2G9YA 4NWJA 3UN3A 4KAYA 2W5TA 3WAVA 3BDGB 1ZEBA 4LRBA 4WHLA 5DLWA 2IUCA 3T01A 3TWZA 4GTZA 1O98A 1EW2A 2W5XA 4LRAA 2X98A 5K4PA 3T00A 4WHKA 3TX0A 3SZZA 2W8DA 5TJ3A 1ALKA 2QZUA 3P36A 2ZKTA 5DAYA 1EQJA 1Q4OA 5L0EA 5L0BA 4N9JA 4GTYA 3M7VA 5AJ9A 1E33P 4HY2A 1A87A 1AJDA 3BDGA 3NKOA 2IFYA 2GSOA 3WBHA 2GA3A 3HFDA 4WHHA 5LIAA 1EI6A 1E2TA 3P37A 1F32A 4NKBA 4UORA 4UOPA 4NK7A 4RS6A 3P35A 4DFWA 1ALHA 4E9CA 3WAWA 1URAA 4FDIA 4N7VA 2VQRA 1F34B 4LQYA 3M8YA 4MY4A 1FSUA 4H71A 1E3CP 1N2KA 2OJXA 1HQAA 1SHNA 2W5SA 4O9WA 3P34A 4E9DA 4N7ZA 1AJBA 5KXAA 3LXQA 4X9VA 3NKPA 2I9XA 2W5WA 3KD8A 3MK2A 3NKMA 1ED9A 3ED4A 4HABA 3HIHA 5DNJA 1KH5A 4N7TA 5INHA 5LRMA 3GYVA 1ZEFA 3BZIA 1ELZA 1EW8A 5IJSA 3IDDA 5IJQA 2W5VA 3CMRA 3DYCA 3BDFA 4KAVA 3UN2A 4ZG9A 3E2DA 5DLTA 5LQQA 4ZGAA 4LR2A 3FS3A 5L0KA 1ED8A 4CXKA 1KH4A 4LRDA 3MK0A 3M8ZA 3NVLA 3B5QA 1Y6VA 1HDHA 1AJCA 5LRNA 2I9ZA 1EJJA 1P49A 1ALIA 4KM4A 4ZG6A 5DMSA 3IGYB 4NWXA 4LRCA 3WAYA 5J19A 2RH6A 2N19A 1AJAA 3NKQA 5HRTA 4FDJA 5DMVC 5LHZA 1Y7AA 4RCPA 4UOOA 4X9WA 1ELYA 1ALJA 2ANHA 1E2SP 4UPHA 3P2ZA 4E67A 4YYPA 1ELXA 3IGZB 3WAXA 3Q3QA 4UPKA 4LKLA 2IUCB 2W5QA 3Q1IA 3BDHA 1Q4KA 4CXUA 4MHXA 3NKRA 4MIVA 3UNYA 5EGHA 4HCOA 4LREA 2XR9A 3RQ7A 1KH9A 3UN5A 2E50A 3NKNA 3A52A 3SZYA 1URBA 1SHQA 4LKMA 1KHJA 4GTXA 3T02A 4QAXA 1ANJA 4KJDA 2GSNA 3TG0A 1KHNA 2IA9A 5GRRA
chains in the Genus database with same CATH topology
3M8WA 4B56A 1EW9A 4ZG7A 3OT9A 5EGEA 2VKZG 5GOVA 2GSUA 2XRGA 4CYSA 2D1GA 4G7NA 4CYRA 1K7HA 3LM3A 5DLVA 4LRFA 3UO0A 4CXSA 2GLQA 4UPIA 1E1ZP 2W8SA 3GYWA 4UPLA 4GTWA 4LR7A 3KDRA 2UV8G 4TN0A 1AUKA 1B8JA 1KHKA 4LR9A 1ZEDA 1HJKA 3MK1A 4LR8A 3DPCA 1ANIA 4KJGA 3HMJG 5C66A 1N2LA 4YR1A 1KHLA 1KH7A 1O99A 2W5RA 2G9YA 4NWJA 3UN3A 4KAYA 2W5TA 3WAVA 3BDGB 1ZEBA 4LRBA 5DLWA 3T01A 2IUCA 3TWZA 4GTZA 1O98A 1EW2A 2W5XA 4LRAA 2X98A 5K4PA 3T00A 3TX0A 3SZZA 2W8DA 5TJ3A 1ALKA 2QZUA 2ZKTA 5DAYA 1EQJA 5L0EA 5L0BA 4N9JA 4GTYA 3M7VA 5AJ9A 1E33P 3NKOA 1AJDA 3BDGA 2IFYA 2GSOA 3WBHA 2GA3A 3HFDA 5LIAA 1EI6A 1E2TA 4NKBA 4UORA 4UOPA 4NK7A 1ALHA 3WAWA 1URAA 4FDIA 4N7VA 2VQRA 4LQYA 3M8YA 4MY4A 1FSUA 1E3CP 1N2KA 1HQAA 1SHNA 2W5SA 4N7ZA 1AJBA 5KXAA 3LXQA 3NKPA 3MK2A 2W5WA 3KD8A 3NKMA 5LRMA 1ED9A 3ED4A 4N7TA 1KH5A 5INHA 3GYVA 1ZEFA 1ELZA 1EW8A 5IJSA 3IDDA 5IJQA 2W5VA 3CMRA 3DYCA 3BDFA 4KAVA 3UN2A 4ZG9A 3E2DA 5DLTA 5LQQA 4ZGAA 4LR2A 3FS3A 5L0KA 1ED8A 4CXKA 1KH4A 4LRDA 3MK0A 3M8ZA 3NVLA 3B5QA 1Y6VA 1HDHA 1AJCA 5LRNA 1EJJA 1P49A 1ALIA 4KM4A 4ZG6A 3IGYB 4NWXA 4LRCA 3WAYA 2RH6A 3NKQA 1AJAA 5HRTA 4FDJA 1Y7AA 4UOOA 1ELYA 1ALJA 2ANHA 1E2SP 4UPHA 1ELXA 3IGZB 3WAXA 3Q3QA 4UPKA 2IUCB 2W5QA 3BDHA 4CXUA 4MHXA 3NKRA 4MIVA 3UNYA 5EGHA 4LREA 2XR9A 1KH9A 3UN5A 2E50A 3NKNA 3A52A 3SZYA 1URBA 1SHQA 4GTXA 1KHJA 3T02A 4QAXA 1ANJA 4KJDA 2GSNA 3TG0A 1KHNA 5GRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M8W A;  4B56 A;  1EW9 A;  4ZG7 A;  3OT9 A;  5EGE A;  5GOV A;  2GSU A;  2XRG A;  4CYS A;  2D1G A;  4CYR A;  1K7H A;  5DLV A;  4LRF A;  3UO0 A;  4CXS A;  2GLQ A;  4UPI A;  1E1Z P;  2W8S A;  4UPL A;  4GTW A;  4LR7 A;  4TN0 A;  1AUK A;  1B8J A;  1KHK A;  4LR9 A;  1ZED A;  1HJK A;  3MK1 A;  4LR8 A;  3DPC A;  1ANI A;  4KJG A;  5C66 A;  1N2L A;  4YR1 A;  1KHL A;  1KH7 A;  1O99 A;  2W5R A;  2G9Y A;  4NWJ A;  3UN3 A;  4KAY A;  2W5T A;  3WAV A;  3BDG B;  1ZEB A;  4LRB A;  5DLW A;  3T01 A;  2IUC A;  3TWZ A;  4GTZ A;  1O98 A;  1EW2 A;  2W5X A;  4LRA A;  2X98 A;  5K4P A;  3T00 A;  3TX0 A;  3SZZ A;  2W8D A;  5TJ3 A;  1ALK A;  2QZU A;  2ZKT A;  1EQJ A;  5L0E A;  5L0B A;  4GTY A;  3M7V A;  5AJ9 A;  1E33 P;  3NKO A;  1AJD A;  3BDG A;  2IFY A;  2GSO A;  3WBH A;  2GA3 A;  5LIA A;  1EI6 A;  4UOR A;  4UOP A;  1ALH A;  3WAW A;  1URA A;  4FDI A;  2VQR A;  4LQY A;  3M8Y A;  4MY4 A;  1FSU A;  1E3C P;  1N2K A;  1HQA A;  1SHN A;  2W5S A;  1AJB A;  5KXA A;  3LXQ A;  3NKP A;  3MK2 A;  2W5W A;  3KD8 A;  3NKM A;  5LRM A;  1ED9 A;  3ED4 A;  4N7T A;  1KH5 A;  5INH A;  1ZEF A;  1ELZ A;  1EW8 A;  5IJS A;  3IDD A;  5IJQ A;  2W5V A;  3CMR A;  3DYC A;  3BDF A;  4KAV A;  3UN2 A;  4ZG9 A;  3E2D A;  5DLT A;  5LQQ A;  4ZGA A;  4LR2 A;  5L0K A;  1ED8 A;  4CXK A;  1KH4 A;  4LRD A;  3MK0 A;  3M8Z A;  3NVL A;  3B5Q A;  1Y6V A;  1HDH A;  1AJC A;  5LRN A;  1EJJ A;  1P49 A;  1ALI A;  4KM4 A;  4ZG6 A;  3IGY B;  4NWX A;  4LRC A;  3WAY A;  2RH6 A;  3NKQ A;  1AJA A;  5HRT A;  4FDJ A;  1Y7A A;  4UOO A;  1ELY A;  1ALJ A;  2ANH A;  1E2S P;  4UPH A;  1ELX A;  3IGZ B;  3WAX A;  3Q3Q A;  4UPK A;  2IUC B;  2W5Q A;  3BDH A;  4CXU A;  4MHX A;  3NKR A;  4MIV A;  3UNY A;  5EGH A;  4LRE A;  2XR9 A;  1KH9 A;  3UN5 A;  3NKN A;  3A52 A;  3SZY A;  1URB A;  1SHQ A;  4GTX A;  1KHJ A;  3T02 A;  4QAX A;  1ANJ A;  4KJD A;  2GSN A;  3TG0 A;  1KHN A;  5GRR A; 
#chains in the Genus database with same CATH topology
 3M8W A;  4B56 A;  1EW9 A;  4ZG7 A;  3OT9 A;  5EGE A;  2VKZ G;  5GOV A;  2GSU A;  2XRG A;  3P2W A;  4CYS A;  2D1G A;  4J7B B;  4G7N A;  4XB0 A;  4CYR A;  1K7H A;  1UMW A;  3LM3 A;  5DLV A;  4H5X A;  4LRF A;  3UO0 A;  3HIK A;  4CXS A;  2GLQ A;  4O6W A;  4UPI A;  1E1Z P;  2W8S A;  3GYW A;  4UPL A;  3FVH A;  4GTW A;  4LR7 A;  4O56 A;  3KDR A;  3C5L A;  2UV8 G;  4TN0 A;  1AUK A;  1B8J A;  1KHK A;  4LR9 A;  1ZED A;  1HJK A;  3MK1 A;  4LR8 A;  3DPC A;  2OGQ A;  1ANI A;  4KJG A;  3HMJ G;  5C66 A;  1N2L A;  4YR1 A;  1KHL A;  1KH7 A;  1O99 A;  2W5R A;  4X9R A;  2G9Y A;  4NWJ A;  3UN3 A;  4KAY A;  2W5T A;  3WAV A;  3BDG B;  1ZEB A;  4LRB A;  4WHL A;  5DLW A;  2IUC A;  3T01 A;  3TWZ A;  4GTZ A;  1O98 A;  1EW2 A;  2W5X A;  4LRA A;  2X98 A;  5K4P A;  3T00 A;  4WHK A;  3TX0 A;  3SZZ A;  2W8D A;  5TJ3 A;  1ALK A;  2QZU A;  3P36 A;  2ZKT A;  5DAY A;  1EQJ A;  1Q4O A;  5L0E A;  5L0B A;  4N9J A;  4GTY A;  3M7V A;  5AJ9 A;  1E33 P;  4HY2 A;  1A87 A;  1AJD A;  3BDG A;  3NKO A;  2IFY A;  2GSO A;  3WBH A;  2GA3 A;  3HFD A;  4WHH A;  5LIA A;  1EI6 A;  1E2T A;  3P37 A;  1F32 A;  4NKB A;  4UOR A;  4UOP A;  4NK7 A;  4RS6 A;  3P35 A;  4DFW A;  1ALH A;  4E9C A;  3WAW A;  1URA A;  4FDI A;  4N7V A;  2VQR A;  1F34 B;  4LQY A;  3M8Y A;  4MY4 A;  1FSU A;  4H71 A;  1E3C P;  1N2K A;  2OJX A;  1HQA A;  1SHN A;  2W5S A;  4O9W A;  3P34 A;  4E9D A;  4N7Z A;  1AJB A;  5KXA A;  3LXQ A;  4X9V A;  3NKP A;  2I9X A;  2W5W A;  3KD8 A;  3MK2 A;  3NKM A;  1ED9 A;  3ED4 A;  4HAB A;  3HIH A;  5DNJ A;  1KH5 A;  4N7T A;  5INH A;  5LRM A;  3GYV A;  1ZEF A;  3BZI A;  1ELZ A;  1EW8 A;  5IJS A;  3IDD A;  5IJQ A;  2W5V A;  3CMR A;  3DYC A;  3BDF A;  4KAV A;  3UN2 A;  4ZG9 A;  3E2D A;  5DLT A;  5LQQ A;  4ZGA A;  4LR2 A;  3FS3 A;  5L0K A;  1ED8 A;  4CXK A;  1KH4 A;  4LRD A;  3MK0 A;  3M8Z A;  3NVL A;  3B5Q A;  1Y6V A;  1HDH A;  1AJC A;  5LRN A;  2I9Z A;  1EJJ A;  1P49 A;  1ALI A;  4KM4 A;  4ZG6 A;  5DMS A;  3IGY B;  4NWX A;  4LRC A;  3WAY A;  5J19 A;  2RH6 A;  2N19 A;  1AJA A;  3NKQ A;  5HRT A;  4FDJ A;  5DMV C;  5LHZ A;  1Y7A A;  4RCP A;  4UOO A;  4X9W A;  1ELY A;  1ALJ A;  2ANH A;  1E2S P;  4UPH A;  3P2Z A;  4E67 A;  4YYP A;  1ELX A;  3IGZ B;  3WAX A;  3Q3Q A;  4UPK A;  4LKL A;  2IUC B;  2W5Q A;  3Q1I A;  3BDH A;  1Q4K A;  4CXU A;  4MHX A;  3NKR A;  4MIV A;  3UNY A;  5EGH A;  4HCO A;  4LRE A;  2XR9 A;  3RQ7 A;  1KH9 A;  3UN5 A;  2E50 A;  3NKN A;  3A52 A;  3SZY A;  1URB A;  1SHQ A;  4LKM A;  1KHJ A;  4GTX A;  3T02 A;  4QAX A;  1ANJ A;  4KJD A;  2GSN A;  3TG0 A;  1KHN A;  2IA9 A;  5GRR A; 
#chains in the Genus database with same CATH homology
 3M8W A;  4B56 A;  1EW9 A;  4ZG7 A;  3OT9 A;  5EGE A;  2VKZ G;  5GOV A;  2GSU A;  2XRG A;  4CYS A;  2D1G A;  4G7N A;  4CYR A;  1K7H A;  3LM3 A;  5DLV A;  4LRF A;  3UO0 A;  4CXS A;  2GLQ A;  4UPI A;  1E1Z P;  2W8S A;  3GYW A;  4UPL A;  4GTW A;  4LR7 A;  3KDR A;  2UV8 G;  4TN0 A;  1AUK A;  1B8J A;  1KHK A;  4LR9 A;  1ZED A;  1HJK A;  3MK1 A;  4LR8 A;  3DPC A;  1ANI A;  4KJG A;  3HMJ G;  5C66 A;  1N2L A;  4YR1 A;  1KHL A;  1KH7 A;  1O99 A;  2W5R A;  2G9Y A;  4NWJ A;  3UN3 A;  4KAY A;  2W5T A;  3WAV A;  3BDG B;  1ZEB A;  4LRB A;  5DLW A;  3T01 A;  2IUC A;  3TWZ A;  4GTZ A;  1O98 A;  1EW2 A;  2W5X A;  4LRA A;  2X98 A;  5K4P A;  3T00 A;  3TX0 A;  3SZZ A;  2W8D A;  5TJ3 A;  1ALK A;  2QZU A;  2ZKT A;  5DAY A;  1EQJ A;  5L0E A;  5L0B A;  4N9J A;  4GTY A;  3M7V A;  5AJ9 A;  1E33 P;  3NKO A;  1AJD A;  3BDG A;  2IFY A;  2GSO A;  3WBH A;  2GA3 A;  3HFD A;  5LIA A;  1EI6 A;  1E2T A;  4NKB A;  4UOR A;  4UOP A;  4NK7 A;  1ALH A;  3WAW A;  1URA A;  4FDI A;  4N7V A;  2VQR A;  4LQY A;  3M8Y A;  4MY4 A;  1FSU A;  1E3C P;  1N2K A;  1HQA A;  1SHN A;  2W5S A;  4N7Z A;  1AJB A;  5KXA A;  3LXQ A;  3NKP A;  3MK2 A;  2W5W A;  3KD8 A;  3NKM A;  5LRM A;  1ED9 A;  3ED4 A;  4N7T A;  1KH5 A;  5INH A;  3GYV A;  1ZEF A;  1ELZ A;  1EW8 A;  5IJS A;  3IDD A;  5IJQ A;  2W5V A;  3CMR A;  3DYC A;  3BDF A;  4KAV A;  3UN2 A;  4ZG9 A;  3E2D A;  5DLT A;  5LQQ A;  4ZGA A;  4LR2 A;  3FS3 A;  5L0K A;  1ED8 A;  4CXK A;  1KH4 A;  4LRD A;  3MK0 A;  3M8Z A;  3NVL A;  3B5Q A;  1Y6V A;  1HDH A;  1AJC A;  5LRN A;  1EJJ A;  1P49 A;  1ALI A;  4KM4 A;  4ZG6 A;  3IGY B;  4NWX A;  4LRC A;  3WAY A;  2RH6 A;  3NKQ A;  1AJA A;  5HRT A;  4FDJ A;  1Y7A A;  4UOO A;  1ELY A;  1ALJ A;  2ANH A;  1E2S P;  4UPH A;  1ELX A;  3IGZ B;  3WAX A;  3Q3Q A;  4UPK A;  2IUC B;  2W5Q A;  3BDH A;  4CXU A;  4MHX A;  3NKR A;  4MIV A;  3UNY A;  5EGH A;  4LRE A;  2XR9 A;  1KH9 A;  3UN5 A;  2E50 A;  3NKN A;  3A52 A;  3SZY A;  1URB A;  1SHQ A;  4GTX A;  1KHJ A;  3T02 A;  4QAX A;  1ANJ A;  4KJD A;  2GSN A;  3TG0 A;  1KHN A;  5GRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...