1FSUA

Crystal structure of 4-sulfatase (human)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
Knots found
sequence length
492
structure length
474
Chain Sequence
SRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords N-ACETYLGALACTOSAMINE-4-SULFATASE
publication title Structure of a human lysosomal sulfatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 164
structure length 474
sequence length 492
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.6.12: N-acetylgalactosamine-4-sulfatase.
pdb deposition date 1996-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1fsuA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1fsuA01
5K4PA 1KH4A 4CXKA 1ALKA 1KHKA 5HRTA 3BDGB 1HDHA 2W5WA 4LR9A 4MHXA 1EW2A 3NKRA 2IUCB 3UNYA 3IDDA 1ALIA 4LQYA 3BDGA 3BDHA 3LXQA 3NVLA 1KHNA 3WAYA 4MIVA 3BDFA 2IUCA 3IGYB 1EI6A 4UOPA 1Y7AA 5LQQA 5GRRA 3A52A 5DLVA 3MK1A 4FDIA 3E2DA 3NKMA 3B5QA 5TJ3A 1AJAA 3IGZB 4QAXA 4ZG7A 2W8DA 3UN5A 1HJKA 1AJDA 1ELYA 1AJCA 3M8WA 5GOVA 1AJBA 2GLQA 1E33P 4NWJA 4UOOA 2GSNA 1E1ZP 4TN0A 1ED8A 1EW9A 3WAXA 3T01A 1ANJA 1P49A 4FDJA 1KH5A 3Q3QA 3DPCA 1ELZA 1ALJA 1B8JA 3MK0A 4GTYA 4GTXA 3WAVA 3MK2A 1FSUA 2RH6A 5DLTA 1SHNA 4YR1A 4B56A 2G9YA 2XRGA 4LRCA 3UO0A 5L0KA 3CMRA 5LRMA 4UPKA 2W8SA 2W5RA 3UN3A 4CXSA 4ZG9A 3TWZA 5IJQA 4LR7A 1HQAA 3T00A 2GA3A 4MY4A 2X98A 3NKQA 1ELXA 2GSOA 4UORA 2VQRA 4UPLA 1ALHA 3NKPA 4KAVA 4KJGA 2W5QA 4KAYA 3NKOA 4CXUA 4LRDA 3UN2A 5EGEA 4ZGAA 4KM4A 1KH9A 1EQJA 4LRFA 4NWXA 1ZEBA 1N2KA 1ZEFA 2W5XA 1N2LA 3WBHA 4ZG6A 4CYSA 5INHA 1O98A 1SHQA 1EJJA 4KJDA 4LREA 4LR8A 2QZUA 1ED9A 1E3CP 2W5TA 3M7VA 3NKNA 2ZKTA 3TG0A 2GSUA 1KHJA 2XR9A 3KD8A 1KHLA 1ZEDA 4UPIA 1ANIA 2W5SA 5L0EA 5LIAA 4CYRA 3M8ZA 3ED4A 5IJSA 1URBA 1EW8A 1AUKA 4LRAA 4GTZA 3DYCA 3SZZA 5AJ9A 2D1GA 5L0BA 5LRNA 4GTWA 3WAWA 3TX0A 1KH7A 1URAA 4LR2A 5EGHA 3OT9A 4LRBA 4UPHA 1K7HA 3SZYA 5C66A 2IFYA 1O99A 1E2SP 5DLWA 5KXAA 2W5VA 3T02A 4N7TA 2ANHA 3M8YA 1Y6VA
chains in the Genus database with same CATH superfamily
4E9DA 5K4PA 1KH4A 4H5XA 4CXKA 1ALKA 1KHKA 5HRTA 3BDGB 1HDHA 4J7BB 2W5WA 4LKLA 4LR9A 4MHXA 2IA9A 1EW2A 3P37A 2IUCB 3NKRA 3UNYA 3IDDA 3P2WA 1ALIA 4LQYA 4X9VA 3BDGA 3LXQA 3BDHA 3NVLA 1KHNA 3WAYA 4MIVA 4WHLA 2IUCA 3BDFA 3IGYB 1EI6A 4UOPA 1Y7AA 4LKMA 5LQQA 5GRRA 3A52A 5DLVA 3MK1A 4FDIA 3E2DA 3NKMA 3B5QA 5TJ3A 4NK7A 1AJAA 3IGZB 4QAXA 4ZG7A 2W8DA 3UN5A 1HJKA 1AJDA 4N9JA 1ELYA 3HFDA 1AJCA 3M8WA 1UMWA 4X9WA 5GOVA 1AJBA 2GLQA 1F34B 4HABA 3BZIA 1E33P 4NWJA 4UOOA 5DMSA 2GSNA 1E1ZP 4TN0A 1ED8A 1EW9A 3P36A 3WAXA 2VKZG 3T01A 1ANJA 1P49A 4FDJA 1KH5A 4E9CA 3Q3QA 4H71A 4WHKA 5DNJA 3DPCA 1ELZA 1ALJA 4DFWA 1B8JA 4E67A 3MK0A 4GTYA 4GTXA 4O56A 3MK2A 1FSUA 2RH6A 5DLTA 1A87A 3WAVA 1SHNA 4YR1A 1Q4OA 2E50A 4B56A 2G9YA 2XRGA 4LRCA 3UO0A 5L0KA 3CMRA 5LRMA 4UPKA 2W8SA 5DAYA 2W5RA 3UN3A 4CXSA 4ZG9A 4N7ZA 4YYPA 3TWZA 5IJQA 4LR7A 5J19A 1HQAA 4X9RA 3T00A 2GA3A 4MY4A 2X98A 3NKQA 1ELXA 2GSOA 4UORA 3KDRA 2VQRA 4XB0A 4O9WA 4UPLA 3LM3A 1ALHA 3NKPA 4KAVA 4KJGA 2W5QA 4KAYA 3NKOA 4CXUA 4LRDA 3HIHA 4O6WA 3UN2A 5EGEA 4ZGAA 4KM4A 1KH9A 1EQJA 3RQ7A 3GYWA 3P34A 4LRFA 3HMJG 4NWXA 1ZEBA 3Q1IA 1Q4KA 1N2KA 1ZEFA 3FS3A 3GYVA 2W5XA 1N2LA 3WBHA 4ZG6A 4CYSA 3HIKA 5INHA 1O98A 1SHQA 2ANHA 1EJJA 4KJDA 4LREA 4LR8A 2QZUA 3P35A 2I9XA 1ED9A 1E2TA 2I9ZA 1E3CP 2W5TA 3M7VA 3NKNA 4HCOA 2ZKTA 2N19A 3C5LA 2GSUA 1KHJA 3TG0A 2XR9A 3KD8A 1KHLA 3P2ZA 1ZEDA 4UPIA 1ANIA 2W5SA 5DMVC 4RCPA 5L0EA 5LIAA 1F32A 4CYRA 3ED4A 3M8ZA 5IJSA 2UV8G 1URBA 1EW8A 1AUKA 4LRAA 4GTZA 3DYCA 3SZZA 5AJ9A 3FVHA 2D1GA 5L0BA 5LRNA 4G7NA 4GTWA 3TX0A 4NKBA 3WAWA 1KH7A 1URAA 4LR2A 5EGHA 3OT9A 4LRBA 4UPHA 1K7HA 3SZYA 5C66A 2IFYA 5LHZA 1E2SP 1O99A 5DLWA 4N7VA 2OGQA 2W5VA 2OJXA 4WHHA 3T02A 4RS6A 4N7TA 5KXAA 4HY2A 3M8YA 1Y6VA
chains in the Genus database with same CATH topology
5K4PA 1KH4A 4CXKA 1ALKA 1KHKA 5HRTA 3BDGB 1HDHA 2W5WA 4LR9A 4MHXA 1EW2A 3NKRA 2IUCB 3UNYA 3IDDA 1ALIA 4LQYA 3BDGA 3BDHA 3LXQA 3NVLA 1KHNA 3WAYA 4MIVA 3BDFA 2IUCA 3IGYB 1EI6A 4UOPA 1Y7AA 5LQQA 5GRRA 3A52A 5DLVA 3MK1A 4FDIA 3E2DA 3NKMA 3B5QA 5TJ3A 4NK7A 1AJAA 3IGZB 4QAXA 4ZG7A 2W8DA 3UN5A 1HJKA 1AJDA 4N9JA 1ELYA 3HFDA 1AJCA 3M8WA 5GOVA 1AJBA 2GLQA 1E33P 4NWJA 4UOOA 2GSNA 1E1ZP 4TN0A 1ED8A 1EW9A 3WAXA 2VKZG 3T01A 1ANJA 1P49A 4FDJA 1KH5A 3Q3QA 3DPCA 1ELZA 1ALJA 1B8JA 3MK0A 4GTYA 4GTXA 3WAVA 3MK2A 1FSUA 2RH6A 5DLTA 1SHNA 4YR1A 2E50A 4B56A 2G9YA 2XRGA 4LRCA 3UO0A 5L0KA 3CMRA 5LRMA 4UPKA 2W8SA 5DAYA 2W5RA 3UN3A 4CXSA 4ZG9A 4N7ZA 3TWZA 5IJQA 4LR7A 1HQAA 3T00A 2GA3A 4MY4A 2X98A 3NKQA 1ELXA 2GSOA 4UORA 3KDRA 2VQRA 4UPLA 3LM3A 1ALHA 3NKPA 4KAVA 4KJGA 2W5QA 4KAYA 3NKOA 4CXUA 4LRDA 3UN2A 5EGEA 4ZGAA 4KM4A 1KH9A 1EQJA 3GYWA 4LRFA 4NWXA 3HMJG 1ZEBA 1N2KA 1ZEFA 3FS3A 3GYVA 2W5XA 1N2LA 3WBHA 4ZG6A 4CYSA 5INHA 1O98A 1SHQA 1EJJA 4KJDA 4LREA 4LR8A 2QZUA 1ED9A 1E2TA 1E3CP 2W5TA 3M7VA 3NKNA 2ZKTA 3TG0A 2GSUA 1KHJA 2XR9A 3KD8A 1KHLA 1ZEDA 4UPIA 1ANIA 2W5SA 5L0EA 5LIAA 4CYRA 3M8ZA 3ED4A 5IJSA 2UV8G 1URBA 1EW8A 1AUKA 4LRAA 4GTZA 3DYCA 3SZZA 5AJ9A 2D1GA 5L0BA 5LRNA 4G7NA 4GTWA 3TX0A 4NKBA 3WAWA 1KH7A 1URAA 4LR2A 5EGHA 3OT9A 4LRBA 4UPHA 1K7HA 3SZYA 5C66A 2IFYA 1O99A 1E2SP 5DLWA 4N7VA 5KXAA 2W5VA 3T02A 4N7TA 2ANHA 3M8YA 1Y6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K4P A;  1KH4 A;  4CXK A;  1ALK A;  1KHK A;  5HRT A;  3BDG B;  1HDH A;  2W5W A;  4LR9 A;  4MHX A;  1EW2 A;  3NKR A;  2IUC B;  3UNY A;  3IDD A;  1ALI A;  4LQY A;  3BDG A;  3BDH A;  3LXQ A;  3NVL A;  1KHN A;  3WAY A;  4MIV A;  3BDF A;  2IUC A;  3IGY B;  1EI6 A;  4UOP A;  1Y7A A;  5LQQ A;  5GRR A;  3A52 A;  5DLV A;  3MK1 A;  4FDI A;  3E2D A;  3NKM A;  3B5Q A;  5TJ3 A;  1AJA A;  3IGZ B;  4QAX A;  4ZG7 A;  2W8D A;  3UN5 A;  1HJK A;  1AJD A;  1ELY A;  1AJC A;  3M8W A;  5GOV A;  1AJB A;  2GLQ A;  1E33 P;  4NWJ A;  4UOO A;  2GSN A;  1E1Z P;  4TN0 A;  1ED8 A;  1EW9 A;  3WAX A;  3T01 A;  1ANJ A;  1P49 A;  4FDJ A;  1KH5 A;  3Q3Q A;  3DPC A;  1ELZ A;  1ALJ A;  1B8J A;  3MK0 A;  4GTY A;  4GTX A;  3WAV A;  3MK2 A;  1FSU A;  2RH6 A;  5DLT A;  1SHN A;  4YR1 A;  4B56 A;  2G9Y A;  2XRG A;  4LRC A;  3UO0 A;  5L0K A;  3CMR A;  5LRM A;  4UPK A;  2W8S A;  2W5R A;  3UN3 A;  4CXS A;  4ZG9 A;  3TWZ A;  5IJQ A;  4LR7 A;  1HQA A;  3T00 A;  2GA3 A;  4MY4 A;  2X98 A;  3NKQ A;  1ELX A;  2GSO A;  4UOR A;  2VQR A;  4UPL A;  1ALH A;  3NKP A;  4KAV A;  4KJG A;  2W5Q A;  4KAY A;  3NKO A;  4CXU A;  4LRD A;  3UN2 A;  5EGE A;  4ZGA A;  4KM4 A;  1KH9 A;  1EQJ A;  4LRF A;  4NWX A;  1ZEB A;  1N2K A;  1ZEF A;  2W5X A;  1N2L A;  3WBH A;  4ZG6 A;  4CYS A;  5INH A;  1O98 A;  1SHQ A;  1EJJ A;  4KJD A;  4LRE A;  4LR8 A;  2QZU A;  1ED9 A;  1E3C P;  2W5T A;  3M7V A;  3NKN A;  2ZKT A;  3TG0 A;  2GSU A;  1KHJ A;  2XR9 A;  3KD8 A;  1KHL A;  1ZED A;  4UPI A;  1ANI A;  2W5S A;  5L0E A;  5LIA A;  4CYR A;  3M8Z A;  3ED4 A;  5IJS A;  1URB A;  1EW8 A;  1AUK A;  4LRA A;  4GTZ A;  3DYC A;  3SZZ A;  5AJ9 A;  2D1G A;  5L0B A;  5LRN A;  4GTW A;  3WAW A;  3TX0 A;  1KH7 A;  1URA A;  4LR2 A;  5EGH A;  3OT9 A;  4LRB A;  4UPH A;  1K7H A;  3SZY A;  5C66 A;  2IFY A;  1O99 A;  1E2S P;  5DLW A;  5KXA A;  2W5V A;  3T02 A;  4N7T A;  2ANH A;  3M8Y A;  1Y6V A; 
#chains in the Genus database with same CATH topology
 4E9D A;  5K4P A;  1KH4 A;  4H5X A;  4CXK A;  1ALK A;  1KHK A;  5HRT A;  3BDG B;  1HDH A;  4J7B B;  2W5W A;  4LKL A;  4LR9 A;  4MHX A;  2IA9 A;  1EW2 A;  3P37 A;  2IUC B;  3NKR A;  3UNY A;  3IDD A;  3P2W A;  1ALI A;  4LQY A;  4X9V A;  3BDG A;  3LXQ A;  3BDH A;  3NVL A;  1KHN A;  3WAY A;  4MIV A;  4WHL A;  2IUC A;  3BDF A;  3IGY B;  1EI6 A;  4UOP A;  1Y7A A;  4LKM A;  5LQQ A;  5GRR A;  3A52 A;  5DLV A;  3MK1 A;  4FDI A;  3E2D A;  3NKM A;  3B5Q A;  5TJ3 A;  4NK7 A;  1AJA A;  3IGZ B;  4QAX A;  4ZG7 A;  2W8D A;  3UN5 A;  1HJK A;  1AJD A;  4N9J A;  1ELY A;  3HFD A;  1AJC A;  3M8W A;  1UMW A;  4X9W A;  5GOV A;  1AJB A;  2GLQ A;  1F34 B;  4HAB A;  3BZI A;  1E33 P;  4NWJ A;  4UOO A;  5DMS A;  2GSN A;  1E1Z P;  4TN0 A;  1ED8 A;  1EW9 A;  3P36 A;  3WAX A;  2VKZ G;  3T01 A;  1ANJ A;  1P49 A;  4FDJ A;  1KH5 A;  4E9C A;  3Q3Q A;  4H71 A;  4WHK A;  5DNJ A;  3DPC A;  1ELZ A;  1ALJ A;  4DFW A;  1B8J A;  4E67 A;  3MK0 A;  4GTY A;  4GTX A;  4O56 A;  3MK2 A;  1FSU A;  2RH6 A;  5DLT A;  1A87 A;  3WAV A;  1SHN A;  4YR1 A;  1Q4O A;  2E50 A;  4B56 A;  2G9Y A;  2XRG A;  4LRC A;  3UO0 A;  5L0K A;  3CMR A;  5LRM A;  4UPK A;  2W8S A;  5DAY A;  2W5R A;  3UN3 A;  4CXS A;  4ZG9 A;  4N7Z A;  4YYP A;  3TWZ A;  5IJQ A;  4LR7 A;  5J19 A;  1HQA A;  4X9R A;  3T00 A;  2GA3 A;  4MY4 A;  2X98 A;  3NKQ A;  1ELX A;  2GSO A;  4UOR A;  3KDR A;  2VQR A;  4XB0 A;  4O9W A;  4UPL A;  3LM3 A;  1ALH A;  3NKP A;  4KAV A;  4KJG A;  2W5Q A;  4KAY A;  3NKO A;  4CXU A;  4LRD A;  3HIH A;  4O6W A;  3UN2 A;  5EGE A;  4ZGA A;  4KM4 A;  1KH9 A;  1EQJ A;  3RQ7 A;  3GYW A;  3P34 A;  4LRF A;  3HMJ G;  4NWX A;  1ZEB A;  3Q1I A;  1Q4K A;  1N2K A;  1ZEF A;  3FS3 A;  3GYV A;  2W5X A;  1N2L A;  3WBH A;  4ZG6 A;  4CYS A;  3HIK A;  5INH A;  1O98 A;  1SHQ A;  2ANH A;  1EJJ A;  4KJD A;  4LRE A;  4LR8 A;  2QZU A;  3P35 A;  2I9X A;  1ED9 A;  1E2T A;  2I9Z A;  1E3C P;  2W5T A;  3M7V A;  3NKN A;  4HCO A;  2ZKT A;  2N19 A;  3C5L A;  2GSU A;  1KHJ A;  3TG0 A;  2XR9 A;  3KD8 A;  1KHL A;  3P2Z A;  1ZED A;  4UPI A;  1ANI A;  2W5S A;  5DMV C;  4RCP A;  5L0E A;  5LIA A;  1F32 A;  4CYR A;  3ED4 A;  3M8Z A;  5IJS A;  2UV8 G;  1URB A;  1EW8 A;  1AUK A;  4LRA A;  4GTZ A;  3DYC A;  3SZZ A;  5AJ9 A;  3FVH A;  2D1G A;  5L0B A;  5LRN A;  4G7N A;  4GTW A;  3TX0 A;  4NKB A;  3WAW A;  1KH7 A;  1URA A;  4LR2 A;  5EGH A;  3OT9 A;  4LRB A;  4UPH A;  1K7H A;  3SZY A;  5C66 A;  2IFY A;  5LHZ A;  1E2S P;  1O99 A;  5DLW A;  4N7V A;  2OGQ A;  2W5V A;  2OJX A;  4WHH A;  3T02 A;  4RS6 A;  4N7T A;  5KXA A;  4HY2 A;  3M8Y A;  1Y6V A; 
#chains in the Genus database with same CATH homology
 5K4P A;  1KH4 A;  4CXK A;  1ALK A;  1KHK A;  5HRT A;  3BDG B;  1HDH A;  2W5W A;  4LR9 A;  4MHX A;  1EW2 A;  3NKR A;  2IUC B;  3UNY A;  3IDD A;  1ALI A;  4LQY A;  3BDG A;  3BDH A;  3LXQ A;  3NVL A;  1KHN A;  3WAY A;  4MIV A;  3BDF A;  2IUC A;  3IGY B;  1EI6 A;  4UOP A;  1Y7A A;  5LQQ A;  5GRR A;  3A52 A;  5DLV A;  3MK1 A;  4FDI A;  3E2D A;  3NKM A;  3B5Q A;  5TJ3 A;  4NK7 A;  1AJA A;  3IGZ B;  4QAX A;  4ZG7 A;  2W8D A;  3UN5 A;  1HJK A;  1AJD A;  4N9J A;  1ELY A;  3HFD A;  1AJC A;  3M8W A;  5GOV A;  1AJB A;  2GLQ A;  1E33 P;  4NWJ A;  4UOO A;  2GSN A;  1E1Z P;  4TN0 A;  1ED8 A;  1EW9 A;  3WAX A;  2VKZ G;  3T01 A;  1ANJ A;  1P49 A;  4FDJ A;  1KH5 A;  3Q3Q A;  3DPC A;  1ELZ A;  1ALJ A;  1B8J A;  3MK0 A;  4GTY A;  4GTX A;  3WAV A;  3MK2 A;  1FSU A;  2RH6 A;  5DLT A;  1SHN A;  4YR1 A;  2E50 A;  4B56 A;  2G9Y A;  2XRG A;  4LRC A;  3UO0 A;  5L0K A;  3CMR A;  5LRM A;  4UPK A;  2W8S A;  5DAY A;  2W5R A;  3UN3 A;  4CXS A;  4ZG9 A;  4N7Z A;  3TWZ A;  5IJQ A;  4LR7 A;  1HQA A;  3T00 A;  2GA3 A;  4MY4 A;  2X98 A;  3NKQ A;  1ELX A;  2GSO A;  4UOR A;  3KDR A;  2VQR A;  4UPL A;  3LM3 A;  1ALH A;  3NKP A;  4KAV A;  4KJG A;  2W5Q A;  4KAY A;  3NKO A;  4CXU A;  4LRD A;  3UN2 A;  5EGE A;  4ZGA A;  4KM4 A;  1KH9 A;  1EQJ A;  3GYW A;  4LRF A;  4NWX A;  3HMJ G;  1ZEB A;  1N2K A;  1ZEF A;  3FS3 A;  3GYV A;  2W5X A;  1N2L A;  3WBH A;  4ZG6 A;  4CYS A;  5INH A;  1O98 A;  1SHQ A;  1EJJ A;  4KJD A;  4LRE A;  4LR8 A;  2QZU A;  1ED9 A;  1E2T A;  1E3C P;  2W5T A;  3M7V A;  3NKN A;  2ZKT A;  3TG0 A;  2GSU A;  1KHJ A;  2XR9 A;  3KD8 A;  1KHL A;  1ZED A;  4UPI A;  1ANI A;  2W5S A;  5L0E A;  5LIA A;  4CYR A;  3M8Z A;  3ED4 A;  5IJS A;  2UV8 G;  1URB A;  1EW8 A;  1AUK A;  4LRA A;  4GTZ A;  3DYC A;  3SZZ A;  5AJ9 A;  2D1G A;  5L0B A;  5LRN A;  4G7N A;  4GTW A;  3TX0 A;  4NKB A;  3WAW A;  1KH7 A;  1URA A;  4LR2 A;  5EGH A;  3OT9 A;  4LRB A;  4UPH A;  1K7H A;  3SZY A;  5C66 A;  2IFY A;  1O99 A;  1E2S P;  5DLW A;  4N7V A;  5KXA A;  2W5V A;  3T02 A;  4N7T A;  2ANH A;  3M8Y A;  1Y6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...