1FSUA

Crystal structure of 4-sulfatase (human)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
Knots found
sequence length
492
structure length
474
Chain Sequence
SRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a human lysosomal sulfatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords N-ACETYLGALACTOSAMINE-4-SULFATASE
total genus 164
structure length 474
sequence length 492
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.6.12: N-acetylgalactosamine-4-sulfatase.
pdb deposition date 1996-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1fsuA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1fsuA01
3B5QA 2D1GA 1ALIA 3M8YA 1P49A 2W5WA 4UPHA 5GOVA 1KHJA 3TG0A 3UO0A 5L0BA 5EGHA 2GSOA 1HDHA 3SZZA 3TX0A 1SHQA 1ELXA 3IGZB 1ZEFA 3NKNA 4KAYA 1E1ZP 3M8WA 4MIVA 4ZG7A 3CMRA 4GTWA 2IUCB 2W8DA 4LRFA 4QAXA 1HQAA 1EW2A 1EJJA 1KH5A 5IJQA 3T01A 4LQYA 5K4PA 1FSUA 3UN3A 4GTYA 4ZG6A 5C66A 4GTXA 3IDDA 3NKRA 2IFYA 2RH6A 5KXAA 4LR7A 3WAVA 4KM4A 2W8SA 1KHNA 3BDHA 1EW9A 2X98A 3MK2A 4KJGA 5L0EA 5GRRA 2XRGA 4KJDA 3Q3QA 3TWZA 4FDIA 4CYRA 1ANJA 5EGEA 3BDFA 1N2LA 4UOOA 3NVLA 5AJ9A 1URBA 3T00A 2GLQA 3M7VA 1ALHA 3IGYB 3NKOA 5HRTA 4KAVA 3UN2A 5LQQA 4LRDA 3UNYA 4LRAA 3E2DA 1ALJA 1E2SP 4LR8A 4UPKA 3OT9A 1ED9A 3DPCA 3NKMA 4UOPA 1SHNA 4CYSA 5TJ3A 5L0KA 1EW8A 4CXUA 4LREA 1AJCA 4NWJA 1ALKA 2VQRA 2ZKTA 5LRMA 4B56A 3WAYA 1O98A 2G9YA 3NKPA 1AJAA 1E33P 4N7TA 4TN0A 1URAA 1ZEDA 5DLVA 4CXKA 1E3CP 1KHLA 4LRCA 1ANIA 2XR9A 5DLWA 4UPIA 1ELYA 2W5XA 3A52A 4FDJA 4CXSA 3WBHA 4ZG9A 3WAXA 3WAWA 1ELZA 5IJSA 3MK0A 3UN5A 3MK1A 4UORA 2W5VA 1K7HA 5DLTA 1KH4A 3SZYA 4MY4A 1N2KA 3ED4A 1ZEBA 4LRBA 2W5QA 1Y7AA 1Y6VA 3BDGB 3BDGA 3M8ZA 5LRNA 3T02A 2W5RA 1EQJA 4ZGAA 1B8JA 2IUCA 4LR2A 2W5TA 3NKQA 1HJKA 1KHKA 1AJBA 2W5SA 1KH7A 1AUKA 1ED8A 1KH9A 1O99A 5INHA 3KD8A 4GTZA 2ANHA 2QZUA 3DYCA 4MHXA 4UPLA 2GSUA 3LXQA 4NWXA 1EI6A 1AJDA 4LR9A 4YR1A 2GSNA 5LIAA 2GA3A
chains in the Genus database with same CATH superfamily
3B5QA 2D1GA 1ALIA 3M8YA 4X9WA 3GYVA 1P49A 4DFWA 2W5WA 4UPHA 5GOVA 1KHJA 3TG0A 3UO0A 5L0BA 5EGHA 2GSOA 1HDHA 3SZZA 3TX0A 1SHQA 1ELXA 3IGZB 4N7ZA 1ZEFA 3NKNA 4KAYA 3KDRA 4J7BB 1E1ZP 3M8WA 3HIKA 4MIVA 3CMRA 4ZG7A 1F32A 4G7NA 2IUCB 4GTWA 3RQ7A 2W8DA 4YYPA 4LRFA 3FVHA 5J19A 1EW2A 4WHKA 1A87A 3C5LA 1EJJA 1HQAA 1KH5A 4LQYA 5IJQA 2OGQA 3T01A 3P36A 5K4PA 1FSUA 3UN3A 1Q4OA 4GTYA 4ZG6A 2IA9A 5C66A 4GTXA 3P37A 3IDDA 3NKRA 2IFYA 4H71A 5LHZA 4O9WA 2RH6A 3HMJG 4LR7A 3WAVA 4KM4A 5KXAA 2W8SA 1KHNA 3BDHA 1EW9A 3P2ZA 2X98A 3MK2A 4KJGA 4E67A 5L0EA 5GRRA 2XRGA 4X9RA 3Q3QA 4KJDA 4HY2A 4FDIA 4CYRA 4E9CA 1ANJA 5EGEA 3TWZA 3BDFA 1N2LA 4NK7A 4O6WA 3NVLA 4UOOA 5AJ9A 1URBA 3T00A 2GLQA 3M7VA 1ALHA 3IGYB 3NKOA 5HRTA 4KAVA 3UN2A 1F34B 5LQQA 4LRDA 4RS6A 4LRAA 3E2DA 3UNYA 1ALJA 1E2SP 4LR8A 4UPKA 3OT9A 1ED9A 3P34A 1Q4KA 3DPCA 5DAYA 3NKMA 4UOPA 1SHNA 3HFDA 4X9VA 4CYSA 5TJ3A 5L0KA 1EW8A 2VKZG 4CXUA 4LREA 1AJCA 4NWJA 3LM3A 1ALKA 2VQRA 2ZKTA 5LRMA 4B56A 3WAYA 4O56A 1O98A 2G9YA 2E50A 3NKPA 2I9ZA 1E33P 1AJAA 4N7TA 4TN0A 4LKLA 1URAA 1ZEDA 4E9DA 5DLVA 3BZIA 4CXKA 1E3CP 4WHLA 4RCPA 1KHLA 4LRCA 3GYWA 1ANIA 2XR9A 5DLWA 4UPIA 1E2TA 2OJXA 1ELYA 5DMVC 2W5XA 4LKMA 3A52A 4FDJA 4CXSA 3FS3A 3WBHA 4ZG9A 3WAXA 3WAWA 1ELZA 5IJSA 3MK0A 3UN5A 3MK1A 3P35A 2W5VA 4UORA 2I9XA 4NKBA 1UMWA 1K7HA 5DLTA 4N7VA 4XB0A 4HABA 1KH4A 3SZYA 4MY4A 1N2KA 3ED4A 4H5XA 4QAXA 1ZEBA 4LRBA 2UV8G 2W5QA 1Y7AA 1Y6VA 3BDGB 3BDGA 3M8ZA 5DNJA 3T02A 5LRNA 4HCOA 2W5RA 1EQJA 4ZGAA 1B8JA 4N9JA 2IUCA 3HIHA 4LR2A 3P2WA 2W5TA 3NKQA 1HJKA 1KHKA 1AJBA 2W5SA 1KH7A 5DMSA 1AUKA 1ED8A 1KH9A 4WHHA 1O99A 5INHA 3KD8A 4GTZA 2ANHA 2QZUA 3DYCA 4MHXA 4UPLA 2GSUA 3LXQA 4NWXA 1EI6A 2N19A 3Q1IA 1AJDA 4LR9A 4YR1A 2GSNA 5LIAA 2GA3A
chains in the Genus database with same CATH topology
3B5QA 2D1GA 1ALIA 3M8YA 3GYVA 1P49A 2W5WA 4UPHA 5GOVA 1KHJA 3TG0A 3UO0A 5L0BA 5EGHA 2GSOA 1HDHA 3SZZA 3TX0A 1SHQA 1ELXA 3IGZB 4N7ZA 1ZEFA 3NKNA 4KAYA 3KDRA 1E1ZP 3M8WA 4MIVA 4ZG7A 3CMRA 4G7NA 4GTWA 2IUCB 2W8DA 4LRFA 4QAXA 1HQAA 1EW2A 1EJJA 1KH5A 5IJQA 3T01A 4LQYA 5K4PA 1FSUA 3UN3A 4GTYA 4ZG6A 5C66A 4GTXA 3IDDA 3NKRA 2IFYA 2RH6A 5KXAA 3HMJG 4LR7A 3WAVA 4KM4A 2W8SA 1KHNA 3BDHA 1EW9A 2X98A 3MK2A 4KJGA 5L0EA 5GRRA 2XRGA 4KJDA 3Q3QA 3TWZA 4FDIA 4CYRA 1ANJA 5EGEA 3BDFA 1N2LA 4NK7A 4UOOA 3NVLA 5AJ9A 1URBA 3T00A 2GLQA 3M7VA 1ALHA 3IGYB 3NKOA 5HRTA 4KAVA 3UN2A 5LQQA 4LRDA 3UNYA 4LRAA 3E2DA 1ALJA 1E2SP 4LR8A 4UPKA 3OT9A 1ED9A 3DPCA 5DAYA 3NKMA 4UOPA 1SHNA 3HFDA 4CYSA 5TJ3A 5L0KA 1EW8A 2VKZG 4CXUA 4LREA 1AJCA 4NWJA 3LM3A 1ALKA 2VQRA 2ZKTA 5LRMA 4B56A 3WAYA 1O98A 2G9YA 2E50A 3NKPA 1AJAA 1E33P 4N7TA 4TN0A 1URAA 1ZEDA 5DLVA 4CXKA 1E3CP 1KHLA 4LRCA 3GYWA 1ANIA 2XR9A 5DLWA 4UPIA 1E2TA 1ELYA 2W5XA 3A52A 4FDJA 4CXSA 3FS3A 3WBHA 4ZG9A 3WAXA 3WAWA 1ELZA 5IJSA 3MK0A 3UN5A 3MK1A 4UORA 2W5VA 4NKBA 1K7HA 5DLTA 4N7VA 1KH4A 3SZYA 4MY4A 1N2KA 3ED4A 1ZEBA 4LRBA 2UV8G 2W5QA 1Y7AA 1Y6VA 3BDGB 3BDGA 3M8ZA 5LRNA 3T02A 2W5RA 1EQJA 4ZGAA 1B8JA 4N9JA 2IUCA 4LR2A 2W5TA 3NKQA 1HJKA 1KHKA 1AJBA 2W5SA 1KH7A 1AUKA 1ED8A 1KH9A 1O99A 5INHA 3KD8A 4GTZA 2ANHA 2QZUA 3DYCA 4MHXA 4UPLA 2GSUA 3LXQA 4NWXA 1EI6A 1AJDA 4LR9A 4YR1A 2GSNA 5LIAA 2GA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5Q A;  2D1G A;  1ALI A;  3M8Y A;  1P49 A;  2W5W A;  4UPH A;  5GOV A;  1KHJ A;  3TG0 A;  3UO0 A;  5L0B A;  5EGH A;  2GSO A;  1HDH A;  3SZZ A;  3TX0 A;  1SHQ A;  1ELX A;  3IGZ B;  1ZEF A;  3NKN A;  4KAY A;  1E1Z P;  3M8W A;  4MIV A;  4ZG7 A;  3CMR A;  4GTW A;  2IUC B;  2W8D A;  4LRF A;  4QAX A;  1HQA A;  1EW2 A;  1EJJ A;  1KH5 A;  5IJQ A;  3T01 A;  4LQY A;  5K4P A;  1FSU A;  3UN3 A;  4GTY A;  4ZG6 A;  5C66 A;  4GTX A;  3IDD A;  3NKR A;  2IFY A;  2RH6 A;  5KXA A;  4LR7 A;  3WAV A;  4KM4 A;  2W8S A;  1KHN A;  3BDH A;  1EW9 A;  2X98 A;  3MK2 A;  4KJG A;  5L0E A;  5GRR A;  2XRG A;  4KJD A;  3Q3Q A;  3TWZ A;  4FDI A;  4CYR A;  1ANJ A;  5EGE A;  3BDF A;  1N2L A;  4UOO A;  3NVL A;  5AJ9 A;  1URB A;  3T00 A;  2GLQ A;  3M7V A;  1ALH A;  3IGY B;  3NKO A;  5HRT A;  4KAV A;  3UN2 A;  5LQQ A;  4LRD A;  3UNY A;  4LRA A;  3E2D A;  1ALJ A;  1E2S P;  4LR8 A;  4UPK A;  3OT9 A;  1ED9 A;  3DPC A;  3NKM A;  4UOP A;  1SHN A;  4CYS A;  5TJ3 A;  5L0K A;  1EW8 A;  4CXU A;  4LRE A;  1AJC A;  4NWJ A;  1ALK A;  2VQR A;  2ZKT A;  5LRM A;  4B56 A;  3WAY A;  1O98 A;  2G9Y A;  3NKP A;  1AJA A;  1E33 P;  4N7T A;  4TN0 A;  1URA A;  1ZED A;  5DLV A;  4CXK A;  1E3C P;  1KHL A;  4LRC A;  1ANI A;  2XR9 A;  5DLW A;  4UPI A;  1ELY A;  2W5X A;  3A52 A;  4FDJ A;  4CXS A;  3WBH A;  4ZG9 A;  3WAX A;  3WAW A;  1ELZ A;  5IJS A;  3MK0 A;  3UN5 A;  3MK1 A;  4UOR A;  2W5V A;  1K7H A;  5DLT A;  1KH4 A;  3SZY A;  4MY4 A;  1N2K A;  3ED4 A;  1ZEB A;  4LRB A;  2W5Q A;  1Y7A A;  1Y6V A;  3BDG B;  3BDG A;  3M8Z A;  5LRN A;  3T02 A;  2W5R A;  1EQJ A;  4ZGA A;  1B8J A;  2IUC A;  4LR2 A;  2W5T A;  3NKQ A;  1HJK A;  1KHK A;  1AJB A;  2W5S A;  1KH7 A;  1AUK A;  1ED8 A;  1KH9 A;  1O99 A;  5INH A;  3KD8 A;  4GTZ A;  2ANH A;  2QZU A;  3DYC A;  4MHX A;  4UPL A;  2GSU A;  3LXQ A;  4NWX A;  1EI6 A;  1AJD A;  4LR9 A;  4YR1 A;  2GSN A;  5LIA A;  2GA3 A; 
#chains in the Genus database with same CATH topology
 3B5Q A;  2D1G A;  1ALI A;  3M8Y A;  4X9W A;  3GYV A;  1P49 A;  4DFW A;  2W5W A;  4UPH A;  5GOV A;  1KHJ A;  3TG0 A;  3UO0 A;  5L0B A;  5EGH A;  2GSO A;  1HDH A;  3SZZ A;  3TX0 A;  1SHQ A;  1ELX A;  3IGZ B;  4N7Z A;  1ZEF A;  3NKN A;  4KAY A;  3KDR A;  4J7B B;  1E1Z P;  3M8W A;  3HIK A;  4MIV A;  3CMR A;  4ZG7 A;  1F32 A;  4G7N A;  2IUC B;  4GTW A;  3RQ7 A;  2W8D A;  4YYP A;  4LRF A;  3FVH A;  5J19 A;  1EW2 A;  4WHK A;  1A87 A;  3C5L A;  1EJJ A;  1HQA A;  1KH5 A;  4LQY A;  5IJQ A;  2OGQ A;  3T01 A;  3P36 A;  5K4P A;  1FSU A;  3UN3 A;  1Q4O A;  4GTY A;  4ZG6 A;  2IA9 A;  5C66 A;  4GTX A;  3P37 A;  3IDD A;  3NKR A;  2IFY A;  4H71 A;  5LHZ A;  4O9W A;  2RH6 A;  3HMJ G;  4LR7 A;  3WAV A;  4KM4 A;  5KXA A;  2W8S A;  1KHN A;  3BDH A;  1EW9 A;  3P2Z A;  2X98 A;  3MK2 A;  4KJG A;  4E67 A;  5L0E A;  5GRR A;  2XRG A;  4X9R A;  3Q3Q A;  4KJD A;  4HY2 A;  4FDI A;  4CYR A;  4E9C A;  1ANJ A;  5EGE A;  3TWZ A;  3BDF A;  1N2L A;  4NK7 A;  4O6W A;  3NVL A;  4UOO A;  5AJ9 A;  1URB A;  3T00 A;  2GLQ A;  3M7V A;  1ALH A;  3IGY B;  3NKO A;  5HRT A;  4KAV A;  3UN2 A;  1F34 B;  5LQQ A;  4LRD A;  4RS6 A;  4LRA A;  3E2D A;  3UNY A;  1ALJ A;  1E2S P;  4LR8 A;  4UPK A;  3OT9 A;  1ED9 A;  3P34 A;  1Q4K A;  3DPC A;  5DAY A;  3NKM A;  4UOP A;  1SHN A;  3HFD A;  4X9V A;  4CYS A;  5TJ3 A;  5L0K A;  1EW8 A;  2VKZ G;  4CXU A;  4LRE A;  1AJC A;  4NWJ A;  3LM3 A;  1ALK A;  2VQR A;  2ZKT A;  5LRM A;  4B56 A;  3WAY A;  4O56 A;  1O98 A;  2G9Y A;  2E50 A;  3NKP A;  2I9Z A;  1E33 P;  1AJA A;  4N7T A;  4TN0 A;  4LKL A;  1URA A;  1ZED A;  4E9D A;  5DLV A;  3BZI A;  4CXK A;  1E3C P;  4WHL A;  4RCP A;  1KHL A;  4LRC A;  3GYW A;  1ANI A;  2XR9 A;  5DLW A;  4UPI A;  1E2T A;  2OJX A;  1ELY A;  5DMV C;  2W5X A;  4LKM A;  3A52 A;  4FDJ A;  4CXS A;  3FS3 A;  3WBH A;  4ZG9 A;  3WAX A;  3WAW A;  1ELZ A;  5IJS A;  3MK0 A;  3UN5 A;  3MK1 A;  3P35 A;  2W5V A;  4UOR A;  2I9X A;  4NKB A;  1UMW A;  1K7H A;  5DLT A;  4N7V A;  4XB0 A;  4HAB A;  1KH4 A;  3SZY A;  4MY4 A;  1N2K A;  3ED4 A;  4H5X A;  4QAX A;  1ZEB A;  4LRB A;  2UV8 G;  2W5Q A;  1Y7A A;  1Y6V A;  3BDG B;  3BDG A;  3M8Z A;  5DNJ A;  3T02 A;  5LRN A;  4HCO A;  2W5R A;  1EQJ A;  4ZGA A;  1B8J A;  4N9J A;  2IUC A;  3HIH A;  4LR2 A;  3P2W A;  2W5T A;  3NKQ A;  1HJK A;  1KHK A;  1AJB A;  2W5S A;  1KH7 A;  5DMS A;  1AUK A;  1ED8 A;  1KH9 A;  4WHH A;  1O99 A;  5INH A;  3KD8 A;  4GTZ A;  2ANH A;  2QZU A;  3DYC A;  4MHX A;  4UPL A;  2GSU A;  3LXQ A;  4NWX A;  1EI6 A;  2N19 A;  3Q1I A;  1AJD A;  4LR9 A;  4YR1 A;  2GSN A;  5LIA A;  2GA3 A; 
#chains in the Genus database with same CATH homology
 3B5Q A;  2D1G A;  1ALI A;  3M8Y A;  3GYV A;  1P49 A;  2W5W A;  4UPH A;  5GOV A;  1KHJ A;  3TG0 A;  3UO0 A;  5L0B A;  5EGH A;  2GSO A;  1HDH A;  3SZZ A;  3TX0 A;  1SHQ A;  1ELX A;  3IGZ B;  4N7Z A;  1ZEF A;  3NKN A;  4KAY A;  3KDR A;  1E1Z P;  3M8W A;  4MIV A;  4ZG7 A;  3CMR A;  4G7N A;  4GTW A;  2IUC B;  2W8D A;  4LRF A;  4QAX A;  1HQA A;  1EW2 A;  1EJJ A;  1KH5 A;  5IJQ A;  3T01 A;  4LQY A;  5K4P A;  1FSU A;  3UN3 A;  4GTY A;  4ZG6 A;  5C66 A;  4GTX A;  3IDD A;  3NKR A;  2IFY A;  2RH6 A;  5KXA A;  3HMJ G;  4LR7 A;  3WAV A;  4KM4 A;  2W8S A;  1KHN A;  3BDH A;  1EW9 A;  2X98 A;  3MK2 A;  4KJG A;  5L0E A;  5GRR A;  2XRG A;  4KJD A;  3Q3Q A;  3TWZ A;  4FDI A;  4CYR A;  1ANJ A;  5EGE A;  3BDF A;  1N2L A;  4NK7 A;  4UOO A;  3NVL A;  5AJ9 A;  1URB A;  3T00 A;  2GLQ A;  3M7V A;  1ALH A;  3IGY B;  3NKO A;  5HRT A;  4KAV A;  3UN2 A;  5LQQ A;  4LRD A;  3UNY A;  4LRA A;  3E2D A;  1ALJ A;  1E2S P;  4LR8 A;  4UPK A;  3OT9 A;  1ED9 A;  3DPC A;  5DAY A;  3NKM A;  4UOP A;  1SHN A;  3HFD A;  4CYS A;  5TJ3 A;  5L0K A;  1EW8 A;  2VKZ G;  4CXU A;  4LRE A;  1AJC A;  4NWJ A;  3LM3 A;  1ALK A;  2VQR A;  2ZKT A;  5LRM A;  4B56 A;  3WAY A;  1O98 A;  2G9Y A;  2E50 A;  3NKP A;  1AJA A;  1E33 P;  4N7T A;  4TN0 A;  1URA A;  1ZED A;  5DLV A;  4CXK A;  1E3C P;  1KHL A;  4LRC A;  3GYW A;  1ANI A;  2XR9 A;  5DLW A;  4UPI A;  1E2T A;  1ELY A;  2W5X A;  3A52 A;  4FDJ A;  4CXS A;  3FS3 A;  3WBH A;  4ZG9 A;  3WAX A;  3WAW A;  1ELZ A;  5IJS A;  3MK0 A;  3UN5 A;  3MK1 A;  4UOR A;  2W5V A;  4NKB A;  1K7H A;  5DLT A;  4N7V A;  1KH4 A;  3SZY A;  4MY4 A;  1N2K A;  3ED4 A;  1ZEB A;  4LRB A;  2UV8 G;  2W5Q A;  1Y7A A;  1Y6V A;  3BDG B;  3BDG A;  3M8Z A;  5LRN A;  3T02 A;  2W5R A;  1EQJ A;  4ZGA A;  1B8J A;  4N9J A;  2IUC A;  4LR2 A;  2W5T A;  3NKQ A;  1HJK A;  1KHK A;  1AJB A;  2W5S A;  1KH7 A;  1AUK A;  1ED8 A;  1KH9 A;  1O99 A;  5INH A;  3KD8 A;  4GTZ A;  2ANH A;  2QZU A;  3DYC A;  4MHX A;  4UPL A;  2GSU A;  3LXQ A;  4NWX A;  1EI6 A;  1AJD A;  4LR9 A;  4YR1 A;  2GSN A;  5LIA A;  2GA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...