1FSUA

Crystal structure of 4-sulfatase (human)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
Knots found
sequence length
492
structure length
474
Chain Sequence
SRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a human lysosomal sulfatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords N-ACETYLGALACTOSAMINE-4-SULFATASE
total genus 164
structure length 474
sequence length 492
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.6.12: N-acetylgalactosamine-4-sulfatase.
pdb deposition date 1996-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1fsuA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1fsuA01
2IUCA 5DLWA 3NKPA 4YR1A 1ALHA 1KHLA 1Y6VA 3DYCA 2QZUA 3OT9A 5L0EA 2XRGA 4KM4A 2VQRA 4KAYA 2XR9A 1ALKA 4UOPA 3IDDA 3LXQA 4GTZA 4ZG9A 4MIVA 2W5SA 1KHNA 1N2KA 1N2LA 4NWXA 1ELZA 3IGZB 5EGHA 4LR8A 1E3CP 5C66A 1SHNA 5IJSA 3BDGB 3NKRA 3NKQA 3NKNA 4UPIA 3UO0A 4LRDA 2G9YA 3B5QA 2IFYA 1EQJA 1E2SP 4CYSA 3UN2A 3T00A 4LR9A 5INHA 4UPHA 1HDHA 3WAXA 1ZEBA 1URBA 3IGYB 3BDGA 3WAYA 2GSUA 5DLVA 1SHQA 4FDJA 5HRTA 5LIAA 3A52A 3DPCA 1ALJA 5GOVA 1EW2A 1KHJA 3SZZA 3MK1A 4QAXA 2ANHA 1EW9A 3SZYA 3NKMA 1HQAA 2GLQA 2RH6A 5LRNA 4GTYA 1E1ZP 3NKOA 3UN3A 3MK0A 1KHKA 1ELYA 3NVLA 1O98A 1ZEFA 3TWZA 1ED8A 4KJDA 1EW8A 2ZKTA 1KH4A 2GA3A 3M8WA 1E33P 4UOOA 2W5WA 1ELXA 5EGEA 3M7VA 1ZEDA 3TG0A 4LRCA 5DLTA 5IJQA 1KH7A 4MY4A 2W8SA 4CXUA 4CXSA 4LRFA 1P49A 3M8ZA 3BDFA 1AJDA 3WAVA 4LRAA 1AJCA 3UNYA 4UPLA 1FSUA 4KJGA 5LQQA 1EI6A 2W5QA 2W5VA 4KAVA 2D1GA 5AJ9A 2W5RA 1KH9A 3WBHA 3MK2A 5L0KA 2X98A 4MHXA 4ZG7A 1ALIA 3T01A 3KD8A 2IUCB 4LRBA 4TN0A 4FDIA 3E2DA 5TJ3A 4CXKA 1B8JA 1KH5A 4GTWA 4NWJA 1AJBA 4UPKA 5K4PA 1URAA 3Q3QA 4LREA 4GTXA 3M8YA 4LR2A 3WAWA 1Y7AA 4ZG6A 3UN5A 1ED9A 1ANIA 3TX0A 3T02A 4B56A 1ANJA 4N7TA 4UORA 3ED4A 1AJAA 3BDHA 3CMRA 4LR7A 4LQYA 1K7HA 2W5XA 4ZGAA 5L0BA 5GRRA 5LRMA 2GSNA 2W5TA 4CYRA 1O99A 2W8DA 5KXAA 1EJJA 1AUKA 1HJKA 2GSOA
chains in the Genus database with same CATH superfamily
2IUCA 5DLWA 3NKPA 4YR1A 1ALHA 1KHLA 1Y6VA 3DYCA 2QZUA 3OT9A 5L0EA 2XRGA 4KM4A 2VQRA 4KAYA 2XR9A 1ALKA 4UOPA 4J7BB 3IDDA 3LXQA 4GTZA 4ZG9A 4MIVA 2W5SA 1KHNA 1N2KA 3LM3A 4E9CA 1N2LA 5DNJA 4NWXA 1E2TA 1ELZA 3IGZB 4G7NA 5EGHA 4LR8A 1E3CP 5C66A 1SHNA 5IJSA 3BDGB 3NKRA 3HIHA 3NKQA 3NKNA 4UPIA 3UO0A 4LRDA 3FS3A 3Q1IA 2G9YA 3B5QA 4E67A 2IFYA 1EQJA 1E2SP 4NKBA 4CYSA 3UN2A 3T00A 4LR9A 5INHA 4UPHA 1HDHA 2IA9A 3WAXA 4WHLA 4H5XA 1ZEBA 1URBA 3IGYB 3BDGA 3WAYA 2GSUA 3P2WA 5DLVA 1SHQA 4FDJA 5HRTA 5LIAA 3A52A 3DPCA 1ALJA 5GOVA 1EW2A 1KHJA 3SZZA 3HFDA 3MK1A 4QAXA 2ANHA 1EW9A 3SZYA 2E50A 3NKMA 5DAYA 1HQAA 2GLQA 2RH6A 5LRNA 3P34A 4GTYA 1E1ZP 4WHKA 3NKOA 3C5LA 4YYPA 3UN3A 3MK0A 1KHKA 4DFWA 1ELYA 3NVLA 1O98A 1ZEFA 3TWZA 1ED8A 4RCPA 4LKMA 4KJDA 1EW8A 2ZKTA 1KH4A 2GA3A 3M8WA 1E33P 4UOOA 4LKLA 2W5WA 1ELXA 5EGEA 3M7VA 1ZEDA 3TG0A 4LRCA 5DLTA 5IJQA 1KH7A 4MY4A 5LHZA 2W8SA 4N9JA 4CXUA 4CXSA 4LRFA 4N7ZA 1P49A 3M8ZA 3BDFA 1AJDA 2N19A 2I9ZA 4X9VA 4LRAA 3WAVA 4XB0A 1AJCA 3UNYA 4UPLA 1FSUA 4H71A 4KJGA 1A87A 3HIKA 5LQQA 1EI6A 2W5QA 1Q4OA 2W5VA 4KAVA 3P2ZA 5AJ9A 3P36A 5DMVC 3HMJG 1KH9A 4O56A 2D1GA 4WHHA 4X9RA 2W5RA 3MK2A 3WBHA 3RQ7A 5L0KA 2OJXA 2X98A 4MHXA 4ZG7A 1ALIA 2VKZG 3T01A 3KD8A 2IUCB 4LRBA 4TN0A 2OGQA 4E9DA 4FDIA 3E2DA 5TJ3A 3KDRA 4CXKA 1B8JA 1KH5A 4GTWA 4NWJA 1AJBA 4UPKA 5K4PA 1URAA 3Q3QA 4LREA 4GTXA 3M8YA 4LR2A 3WAWA 1Y7AA 4ZG6A 3UN5A 5DMSA 1F32A 1Q4KA 1ED9A 1ANIA 3P35A 3TX0A 2I9XA 3T02A 4NK7A 4B56A 1ANJA 4N7TA 5J19A 4UORA 3ED4A 3FVHA 1UMWA 1AJAA 3BDHA 3CMRA 1F34B 4X9WA 4LR7A 4LQYA 4O9WA 4N7VA 1K7HA 2W5XA 4ZGAA 5GRRA 5L0BA 4O6WA 2GSNA 5LRMA 4RS6A 3GYWA 3P37A 4HABA 4CYRA 4HCOA 1O99A 2W5TA 2W8DA 5KXAA 1EJJA 3BZIA 3GYVA 2UV8G 1AUKA 4HY2A 1HJKA 2GSOA
chains in the Genus database with same CATH topology
2IUCA 5DLWA 3NKPA 4YR1A 1ALHA 1KHLA 1Y6VA 3DYCA 2QZUA 3OT9A 5L0EA 2XRGA 4KM4A 2VQRA 4KAYA 2XR9A 1ALKA 4UOPA 3IDDA 3LXQA 4GTZA 4ZG9A 4MIVA 2W5SA 1KHNA 1N2KA 3LM3A 1N2LA 4NWXA 1E2TA 1ELZA 3IGZB 4G7NA 5EGHA 4LR8A 1E3CP 5C66A 1SHNA 5IJSA 3BDGB 3NKRA 3NKQA 3NKNA 4UPIA 3UO0A 4LRDA 3FS3A 2G9YA 3B5QA 2IFYA 1EQJA 1E2SP 4NKBA 4CYSA 3UN2A 3T00A 4LR9A 5INHA 4UPHA 1HDHA 3WAXA 1ZEBA 1URBA 3IGYB 3BDGA 3WAYA 2GSUA 5DLVA 1SHQA 4FDJA 5HRTA 5LIAA 3A52A 3DPCA 1ALJA 5GOVA 1EW2A 1KHJA 3SZZA 3HFDA 3MK1A 4QAXA 2ANHA 1EW9A 3SZYA 2E50A 3NKMA 5DAYA 1HQAA 2GLQA 2RH6A 5LRNA 4GTYA 1E1ZP 3NKOA 3UN3A 3MK0A 1KHKA 1ELYA 3NVLA 1O98A 1ZEFA 3TWZA 1ED8A 4KJDA 1EW8A 2ZKTA 1KH4A 2GA3A 3M8WA 1E33P 4UOOA 2W5WA 1ELXA 5EGEA 3M7VA 1ZEDA 3TG0A 4LRCA 5DLTA 5IJQA 1KH7A 4MY4A 2W8SA 4N9JA 4CXUA 4CXSA 4LRFA 4N7ZA 1P49A 3M8ZA 3BDFA 1AJDA 3WAVA 4LRAA 1AJCA 3UNYA 4UPLA 1FSUA 4KJGA 5LQQA 1EI6A 2W5QA 2W5VA 4KAVA 2D1GA 5AJ9A 3HMJG 1KH9A 2W5RA 3WBHA 3MK2A 5L0KA 2X98A 4MHXA 4ZG7A 1ALIA 2VKZG 3T01A 3KD8A 2IUCB 4LRBA 4TN0A 4FDIA 3E2DA 5TJ3A 3KDRA 4CXKA 1B8JA 1KH5A 4GTWA 4NWJA 1AJBA 4UPKA 5K4PA 1URAA 3Q3QA 4LREA 4GTXA 3M8YA 4LR2A 3WAWA 1Y7AA 4ZG6A 3UN5A 1ED9A 1ANIA 3TX0A 3T02A 4NK7A 4B56A 1ANJA 4N7TA 4UORA 3ED4A 1AJAA 3BDHA 3CMRA 4LR7A 4LQYA 1K7HA 4N7VA 2W5XA 4ZGAA 5GRRA 5L0BA 5LRMA 2GSNA 3GYWA 2W5TA 4CYRA 1O99A 2W8DA 5KXAA 1EJJA 3GYVA 2UV8G 1AUKA 1HJKA 2GSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUC A;  5DLW A;  3NKP A;  4YR1 A;  1ALH A;  1KHL A;  1Y6V A;  3DYC A;  2QZU A;  3OT9 A;  5L0E A;  2XRG A;  4KM4 A;  2VQR A;  4KAY A;  2XR9 A;  1ALK A;  4UOP A;  3IDD A;  3LXQ A;  4GTZ A;  4ZG9 A;  4MIV A;  2W5S A;  1KHN A;  1N2K A;  1N2L A;  4NWX A;  1ELZ A;  3IGZ B;  5EGH A;  4LR8 A;  1E3C P;  5C66 A;  1SHN A;  5IJS A;  3BDG B;  3NKR A;  3NKQ A;  3NKN A;  4UPI A;  3UO0 A;  4LRD A;  2G9Y A;  3B5Q A;  2IFY A;  1EQJ A;  1E2S P;  4CYS A;  3UN2 A;  3T00 A;  4LR9 A;  5INH A;  4UPH A;  1HDH A;  3WAX A;  1ZEB A;  1URB A;  3IGY B;  3BDG A;  3WAY A;  2GSU A;  5DLV A;  1SHQ A;  4FDJ A;  5HRT A;  5LIA A;  3A52 A;  3DPC A;  1ALJ A;  5GOV A;  1EW2 A;  1KHJ A;  3SZZ A;  3MK1 A;  4QAX A;  2ANH A;  1EW9 A;  3SZY A;  3NKM A;  1HQA A;  2GLQ A;  2RH6 A;  5LRN A;  4GTY A;  1E1Z P;  3NKO A;  3UN3 A;  3MK0 A;  1KHK A;  1ELY A;  3NVL A;  1O98 A;  1ZEF A;  3TWZ A;  1ED8 A;  4KJD A;  1EW8 A;  2ZKT A;  1KH4 A;  2GA3 A;  3M8W A;  1E33 P;  4UOO A;  2W5W A;  1ELX A;  5EGE A;  3M7V A;  1ZED A;  3TG0 A;  4LRC A;  5DLT A;  5IJQ A;  1KH7 A;  4MY4 A;  2W8S A;  4CXU A;  4CXS A;  4LRF A;  1P49 A;  3M8Z A;  3BDF A;  1AJD A;  3WAV A;  4LRA A;  1AJC A;  3UNY A;  4UPL A;  1FSU A;  4KJG A;  5LQQ A;  1EI6 A;  2W5Q A;  2W5V A;  4KAV A;  2D1G A;  5AJ9 A;  2W5R A;  1KH9 A;  3WBH A;  3MK2 A;  5L0K A;  2X98 A;  4MHX A;  4ZG7 A;  1ALI A;  3T01 A;  3KD8 A;  2IUC B;  4LRB A;  4TN0 A;  4FDI A;  3E2D A;  5TJ3 A;  4CXK A;  1B8J A;  1KH5 A;  4GTW A;  4NWJ A;  1AJB A;  4UPK A;  5K4P A;  1URA A;  3Q3Q A;  4LRE A;  4GTX A;  3M8Y A;  4LR2 A;  3WAW A;  1Y7A A;  4ZG6 A;  3UN5 A;  1ED9 A;  1ANI A;  3TX0 A;  3T02 A;  4B56 A;  1ANJ A;  4N7T A;  4UOR A;  3ED4 A;  1AJA A;  3BDH A;  3CMR A;  4LR7 A;  4LQY A;  1K7H A;  2W5X A;  4ZGA A;  5L0B A;  5GRR A;  5LRM A;  2GSN A;  2W5T A;  4CYR A;  1O99 A;  2W8D A;  5KXA A;  1EJJ A;  1AUK A;  1HJK A;  2GSO A; 
#chains in the Genus database with same CATH topology
 2IUC A;  5DLW A;  3NKP A;  4YR1 A;  1ALH A;  1KHL A;  1Y6V A;  3DYC A;  2QZU A;  3OT9 A;  5L0E A;  2XRG A;  4KM4 A;  2VQR A;  4KAY A;  2XR9 A;  1ALK A;  4UOP A;  4J7B B;  3IDD A;  3LXQ A;  4GTZ A;  4ZG9 A;  4MIV A;  2W5S A;  1KHN A;  1N2K A;  3LM3 A;  4E9C A;  1N2L A;  5DNJ A;  4NWX A;  1E2T A;  1ELZ A;  3IGZ B;  4G7N A;  5EGH A;  4LR8 A;  1E3C P;  5C66 A;  1SHN A;  5IJS A;  3BDG B;  3NKR A;  3HIH A;  3NKQ A;  3NKN A;  4UPI A;  3UO0 A;  4LRD A;  3FS3 A;  3Q1I A;  2G9Y A;  3B5Q A;  4E67 A;  2IFY A;  1EQJ A;  1E2S P;  4NKB A;  4CYS A;  3UN2 A;  3T00 A;  4LR9 A;  5INH A;  4UPH A;  1HDH A;  2IA9 A;  3WAX A;  4WHL A;  4H5X A;  1ZEB A;  1URB A;  3IGY B;  3BDG A;  3WAY A;  2GSU A;  3P2W A;  5DLV A;  1SHQ A;  4FDJ A;  5HRT A;  5LIA A;  3A52 A;  3DPC A;  1ALJ A;  5GOV A;  1EW2 A;  1KHJ A;  3SZZ A;  3HFD A;  3MK1 A;  4QAX A;  2ANH A;  1EW9 A;  3SZY A;  2E50 A;  3NKM A;  5DAY A;  1HQA A;  2GLQ A;  2RH6 A;  5LRN A;  3P34 A;  4GTY A;  1E1Z P;  4WHK A;  3NKO A;  3C5L A;  4YYP A;  3UN3 A;  3MK0 A;  1KHK A;  4DFW A;  1ELY A;  3NVL A;  1O98 A;  1ZEF A;  3TWZ A;  1ED8 A;  4RCP A;  4LKM A;  4KJD A;  1EW8 A;  2ZKT A;  1KH4 A;  2GA3 A;  3M8W A;  1E33 P;  4UOO A;  4LKL A;  2W5W A;  1ELX A;  5EGE A;  3M7V A;  1ZED A;  3TG0 A;  4LRC A;  5DLT A;  5IJQ A;  1KH7 A;  4MY4 A;  5LHZ A;  2W8S A;  4N9J A;  4CXU A;  4CXS A;  4LRF A;  4N7Z A;  1P49 A;  3M8Z A;  3BDF A;  1AJD A;  2N19 A;  2I9Z A;  4X9V A;  4LRA A;  3WAV A;  4XB0 A;  1AJC A;  3UNY A;  4UPL A;  1FSU A;  4H71 A;  4KJG A;  1A87 A;  3HIK A;  5LQQ A;  1EI6 A;  2W5Q A;  1Q4O A;  2W5V A;  4KAV A;  3P2Z A;  5AJ9 A;  3P36 A;  5DMV C;  3HMJ G;  1KH9 A;  4O56 A;  2D1G A;  4WHH A;  4X9R A;  2W5R A;  3MK2 A;  3WBH A;  3RQ7 A;  5L0K A;  2OJX A;  2X98 A;  4MHX A;  4ZG7 A;  1ALI A;  2VKZ G;  3T01 A;  3KD8 A;  2IUC B;  4LRB A;  4TN0 A;  2OGQ A;  4E9D A;  4FDI A;  3E2D A;  5TJ3 A;  3KDR A;  4CXK A;  1B8J A;  1KH5 A;  4GTW A;  4NWJ A;  1AJB A;  4UPK A;  5K4P A;  1URA A;  3Q3Q A;  4LRE A;  4GTX A;  3M8Y A;  4LR2 A;  3WAW A;  1Y7A A;  4ZG6 A;  3UN5 A;  5DMS A;  1F32 A;  1Q4K A;  1ED9 A;  1ANI A;  3P35 A;  3TX0 A;  2I9X A;  3T02 A;  4NK7 A;  4B56 A;  1ANJ A;  4N7T A;  5J19 A;  4UOR A;  3ED4 A;  3FVH A;  1UMW A;  1AJA A;  3BDH A;  3CMR A;  1F34 B;  4X9W A;  4LR7 A;  4LQY A;  4O9W A;  4N7V A;  1K7H A;  2W5X A;  4ZGA A;  5GRR A;  5L0B A;  4O6W A;  2GSN A;  5LRM A;  4RS6 A;  3GYW A;  3P37 A;  4HAB A;  4CYR A;  4HCO A;  1O99 A;  2W5T A;  2W8D A;  5KXA A;  1EJJ A;  3BZI A;  3GYV A;  2UV8 G;  1AUK A;  4HY2 A;  1HJK A;  2GSO A; 
#chains in the Genus database with same CATH homology
 2IUC A;  5DLW A;  3NKP A;  4YR1 A;  1ALH A;  1KHL A;  1Y6V A;  3DYC A;  2QZU A;  3OT9 A;  5L0E A;  2XRG A;  4KM4 A;  2VQR A;  4KAY A;  2XR9 A;  1ALK A;  4UOP A;  3IDD A;  3LXQ A;  4GTZ A;  4ZG9 A;  4MIV A;  2W5S A;  1KHN A;  1N2K A;  3LM3 A;  1N2L A;  4NWX A;  1E2T A;  1ELZ A;  3IGZ B;  4G7N A;  5EGH A;  4LR8 A;  1E3C P;  5C66 A;  1SHN A;  5IJS A;  3BDG B;  3NKR A;  3NKQ A;  3NKN A;  4UPI A;  3UO0 A;  4LRD A;  3FS3 A;  2G9Y A;  3B5Q A;  2IFY A;  1EQJ A;  1E2S P;  4NKB A;  4CYS A;  3UN2 A;  3T00 A;  4LR9 A;  5INH A;  4UPH A;  1HDH A;  3WAX A;  1ZEB A;  1URB A;  3IGY B;  3BDG A;  3WAY A;  2GSU A;  5DLV A;  1SHQ A;  4FDJ A;  5HRT A;  5LIA A;  3A52 A;  3DPC A;  1ALJ A;  5GOV A;  1EW2 A;  1KHJ A;  3SZZ A;  3HFD A;  3MK1 A;  4QAX A;  2ANH A;  1EW9 A;  3SZY A;  2E50 A;  3NKM A;  5DAY A;  1HQA A;  2GLQ A;  2RH6 A;  5LRN A;  4GTY A;  1E1Z P;  3NKO A;  3UN3 A;  3MK0 A;  1KHK A;  1ELY A;  3NVL A;  1O98 A;  1ZEF A;  3TWZ A;  1ED8 A;  4KJD A;  1EW8 A;  2ZKT A;  1KH4 A;  2GA3 A;  3M8W A;  1E33 P;  4UOO A;  2W5W A;  1ELX A;  5EGE A;  3M7V A;  1ZED A;  3TG0 A;  4LRC A;  5DLT A;  5IJQ A;  1KH7 A;  4MY4 A;  2W8S A;  4N9J A;  4CXU A;  4CXS A;  4LRF A;  4N7Z A;  1P49 A;  3M8Z A;  3BDF A;  1AJD A;  3WAV A;  4LRA A;  1AJC A;  3UNY A;  4UPL A;  1FSU A;  4KJG A;  5LQQ A;  1EI6 A;  2W5Q A;  2W5V A;  4KAV A;  2D1G A;  5AJ9 A;  3HMJ G;  1KH9 A;  2W5R A;  3WBH A;  3MK2 A;  5L0K A;  2X98 A;  4MHX A;  4ZG7 A;  1ALI A;  2VKZ G;  3T01 A;  3KD8 A;  2IUC B;  4LRB A;  4TN0 A;  4FDI A;  3E2D A;  5TJ3 A;  3KDR A;  4CXK A;  1B8J A;  1KH5 A;  4GTW A;  4NWJ A;  1AJB A;  4UPK A;  5K4P A;  1URA A;  3Q3Q A;  4LRE A;  4GTX A;  3M8Y A;  4LR2 A;  3WAW A;  1Y7A A;  4ZG6 A;  3UN5 A;  1ED9 A;  1ANI A;  3TX0 A;  3T02 A;  4NK7 A;  4B56 A;  1ANJ A;  4N7T A;  4UOR A;  3ED4 A;  1AJA A;  3BDH A;  3CMR A;  4LR7 A;  4LQY A;  1K7H A;  4N7V A;  2W5X A;  4ZGA A;  5GRR A;  5L0B A;  5LRM A;  2GSN A;  3GYW A;  2W5T A;  4CYR A;  1O99 A;  2W8D A;  5KXA A;  1EJJ A;  3GYV A;  2UV8 G;  1AUK A;  1HJK A;  2GSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...