1FSUA

Crystal structure of 4-sulfatase (human)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
Knots found
sequence length
492
structure length
474
Chain Sequence
SRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords N-ACETYLGALACTOSAMINE-4-SULFATASE
publication title Structure of a human lysosomal sulfatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 164
structure length 474
sequence length 492
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.1.6.12: N-acetylgalactosamine-4-sulfatase.
pdb deposition date 1996-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.10 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1fsuA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1fsuA01
1KH4A 3WAWA 1KHJA 2XRGA 2GSOA 3NKOA 4LRDA 3ED4A 2X98A 1AUKA 4MHXA 4ZGAA 5TJ3A 1Y6VA 3Q3QA 1N2KA 1EQJA 1FSUA 5AJ9A 4NWXA 1O99A 2GA3A 1HDHA 3DPCA 5LRMA 4ZG6A 3MK0A 1KHKA 5DLTA 2IFYA 4YR1A 4CYSA 4CXUA 1ZEBA 1URAA 2W5VA 4LRFA 5IJSA 1N2LA 1ZEDA 3M8WA 2GSUA 3UN3A 4B56A 4KAYA 5HRTA 3WBHA 4GTZA 4NWJA 3M8YA 3T00A 1AJAA 4QAXA 1HJKA 5GRRA 1ALJA 5LRNA 5L0EA 1AJBA 2ZKTA 3UN2A 1E1ZP 4GTYA 1ELXA 4LR8A 3E2DA 4N7TA 4UORA 4LRAA 4ZG9A 3NKMA 1KH5A 2W5TA 5DLWA 4UPLA 5DLVA 3NKQA 3BDGB 4KM4A 3NKRA 3UNYA 4FDJA 4TN0A 5IJQA 2RH6A 3TG0A 3BDFA 4GTWA 5C66A 3WAVA 4UPIA 4LR7A 2D1GA 3TX0A 4LRCA 2XR9A 3CMRA 4LRBA 1AJCA 4CXKA 1EW2A 1ALKA 4UPHA 4LREA 1EW8A 5EGEA 3MK2A 1ZEFA 1ALHA 1O98A 5GOVA 3OT9A 5LIAA 1Y7AA 4FDIA 3A52A 5L0KA 3LXQA 3M7VA 2GLQA 3M8ZA 3WAXA 3UN5A 1ELZA 5INHA 1HQAA 1AJDA 1ELYA 2W5SA 2W5WA 2W5QA 1E3CP 3T02A 4ZG7A 4UPKA 2ANHA 4MY4A 3T01A 3B5QA 1KHLA 3BDGA 4LR9A 2IUCB 1E2SP 1ANIA 3WAYA 4LR2A 1ALIA 3MK1A 5LQQA 2QZUA 3SZYA 1ANJA 1ED9A 2GSNA 1B8JA 3KD8A 1P49A 2W8DA 4CXSA 3NKPA 3SZZA 4LQYA 1SHNA 1KH7A 1ED8A 1KH9A 4UOPA 4KJDA 5EGHA 3NVLA 3UO0A 3IGYB 4GTXA 3DYCA 4UOOA 4KAVA 3BDHA 1URBA 2VQRA 1EI6A 1E33P 5K4PA 1EW9A 5L0BA 3TWZA 1EJJA 4CYRA 1K7HA 2W5XA 2W8SA 4MIVA 1SHQA 1KHNA 2W5RA 3IGZB 3NKNA 4KJGA 2IUCA 2G9YA 5KXAA 3IDDA
chains in the Genus database with same CATH superfamily
1KH4A 3WAWA 1KHJA 2XRGA 2GSOA 3NKOA 4LRDA 3ED4A 1A87A 2E50A 2X98A 1AUKA 2N19A 4MHXA 4ZGAA 5TJ3A 1Y6VA 4RCPA 3P36A 3Q3QA 1N2KA 1EQJA 1FSUA 5AJ9A 4NWXA 1O99A 3Q1IA 2GA3A 1HDHA 3BZIA 4DFWA 3DPCA 5LRMA 3KDRA 2I9ZA 4NK7A 4ZG6A 3MK0A 1KHKA 2VKZG 3GYVA 5DLTA 2IFYA 4YR1A 4CYSA 4CXUA 1E2TA 1ZEBA 1Q4OA 1URAA 2W5VA 4LRFA 5IJSA 1N2LA 1ZEDA 3M8WA 4G7NA 3FS3A 4H71A 2GSUA 4E67A 3UN3A 4KAYA 4B56A 5HRTA 4E9CA 3WBHA 4GTZA 4NWJA 3M8YA 3T00A 1AJAA 4QAXA 1HJKA 2I9XA 5GRRA 1ALJA 1F32A 3LM3A 3HIHA 4E9DA 5LRNA 5L0EA 4O9WA 1AJBA 2ZKTA 3UN2A 1E1ZP 4GTYA 1ELXA 4LR8A 3E2DA 4N7TA 4UORA 4LRAA 4ZG9A 3NKMA 1KH5A 2W5TA 5DLWA 4UPLA 5DLVA 5DAYA 3NKQA 3BDGB 4KM4A 3NKRA 3UNYA 3HIKA 4FDJA 4X9RA 4TN0A 5IJQA 2RH6A 3TG0A 3BDFA 4GTWA 3HFDA 5C66A 3WAVA 4N7VA 4UPIA 4NKBA 4LR7A 2D1GA 3TX0A 4LRCA 2XR9A 3CMRA 4LRBA 4X9VA 4HCOA 4N7ZA 3P35A 4CXKA 1AJCA 1EW2A 1ALKA 4UPHA 4LREA 1EW8A 5EGEA 3MK2A 1ZEFA 1ALHA 1O98A 4LKMA 5GOVA 5DMVC 3OT9A 5LIAA 1Y7AA 4FDIA 3A52A 5L0KA 4WHHA 3LXQA 3M7VA 3FVHA 2GLQA 3M8ZA 3WAXA 5DNJA 3UN5A 1ELZA 5INHA 3P2ZA 1HQAA 1AJDA 1UMWA 1ELYA 2W5SA 2W5WA 5L0BA 2W5QA 1E3CP 4RS6A 3T02A 4ZG7A 4UPKA 2ANHA 4MY4A 3T01A 3B5QA 1KHLA 3BDGA 4O56A 4O6WA 2IUCB 4LR9A 1E2SP 1ANIA 3WAYA 4LR2A 1ALIA 3MK1A 5LQQA 2QZUA 3SZYA 1ANJA 1ED9A 2GSNA 1B8JA 3KD8A 1P49A 2W8DA 4CXSA 3NKPA 3SZZA 5LHZA 4LQYA 1SHNA 4HABA 1KH7A 4LKLA 4WHLA 1ED8A 2UV8G 3GYWA 1KH9A 4UOPA 3HMJG 4KJDA 5EGHA 1Q4KA 2OJXA 5DMSA 4XB0A 3IGYB 2IA9A 3DYCA 3NVLA 4GTXA 3UO0A 4UOOA 4N9JA 4KAVA 3BDHA 1URBA 2VQRA 3P37A 1EI6A 1E33P 5K4PA 1EW9A 2OGQA 4HY2A 4J7BB 3RQ7A 4YYPA 4CYRA 5J19A 1EJJA 1K7HA 2W5XA 3TWZA 2W8SA 4MIVA 4H5XA 3P2WA 3P34A 1SHQA 1KHNA 2W5RA 4X9WA 3IGZB 1F34B 4WHKA 3NKNA 4KJGA 2G9YA 2IUCA 3C5LA 5KXAA 3IDDA
chains in the Genus database with same CATH topology
1KH4A 3WAWA 1KHJA 2XRGA 2GSOA 3NKOA 4LRDA 3ED4A 2E50A 2X98A 1AUKA 4MHXA 4ZGAA 5TJ3A 1Y6VA 3Q3QA 1N2KA 1EQJA 1FSUA 5AJ9A 4NWXA 1O99A 2GA3A 1HDHA 3DPCA 5LRMA 3KDRA 4NK7A 4ZG6A 3MK0A 1KHKA 2VKZG 3GYVA 5DLTA 2IFYA 4YR1A 4CYSA 4CXUA 1E2TA 1ZEBA 1URAA 2W5VA 4LRFA 5IJSA 1N2LA 1ZEDA 3M8WA 4G7NA 3FS3A 2GSUA 3UN3A 4B56A 4KAYA 5HRTA 3WBHA 4GTZA 4NWJA 3M8YA 3T00A 1AJAA 4QAXA 1HJKA 5GRRA 1ALJA 5LRNA 3LM3A 5L0EA 1AJBA 2ZKTA 3UN2A 1E1ZP 4GTYA 1ELXA 4LR8A 3E2DA 4N7TA 4UORA 4LRAA 4ZG9A 3NKMA 1KH5A 2W5TA 5DLWA 4UPLA 5DLVA 5DAYA 3NKQA 3BDGB 4KM4A 3NKRA 3UNYA 4FDJA 4TN0A 5IJQA 2RH6A 3TG0A 3BDFA 4GTWA 3HFDA 5C66A 3WAVA 4N7VA 4UPIA 4NKBA 4LR7A 2D1GA 3TX0A 4LRCA 2XR9A 3CMRA 4LRBA 1AJCA 4CXKA 4N7ZA 1EW2A 1ALKA 4UPHA 4LREA 1EW8A 5EGEA 3MK2A 1ZEFA 1ALHA 1O98A 5GOVA 3OT9A 5LIAA 1Y7AA 4FDIA 3A52A 5L0KA 3LXQA 3M7VA 2GLQA 3M8ZA 3WAXA 3UN5A 1ELZA 5INHA 1HQAA 1AJDA 1ELYA 2W5SA 2W5WA 2W5QA 1E3CP 3T02A 4ZG7A 4UPKA 2ANHA 4MY4A 3T01A 3B5QA 1KHLA 3BDGA 4LR9A 2IUCB 1E2SP 1ANIA 3WAYA 4LR2A 1ALIA 3MK1A 5LQQA 2QZUA 3SZYA 1ANJA 1ED9A 2GSNA 1B8JA 3KD8A 1P49A 2W8DA 4CXSA 3NKPA 3SZZA 4LQYA 1SHNA 1KH7A 1ED8A 2UV8G 3GYWA 1KH9A 4UOPA 3HMJG 4KJDA 5EGHA 3NVLA 3UO0A 3IGYB 4GTXA 3DYCA 4UOOA 4N9JA 4KAVA 3BDHA 1URBA 2VQRA 1EI6A 1E33P 5K4PA 1EW9A 5L0BA 3TWZA 1EJJA 4CYRA 1K7HA 2W5XA 2W8SA 4MIVA 1SHQA 1KHNA 2W5RA 3IGZB 3NKNA 4KJGA 2G9YA 2IUCA 5KXAA 3IDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KH4 A;  3WAW A;  1KHJ A;  2XRG A;  2GSO A;  3NKO A;  4LRD A;  3ED4 A;  2X98 A;  1AUK A;  4MHX A;  4ZGA A;  5TJ3 A;  1Y6V A;  3Q3Q A;  1N2K A;  1EQJ A;  1FSU A;  5AJ9 A;  4NWX A;  1O99 A;  2GA3 A;  1HDH A;  3DPC A;  5LRM A;  4ZG6 A;  3MK0 A;  1KHK A;  5DLT A;  2IFY A;  4YR1 A;  4CYS A;  4CXU A;  1ZEB A;  1URA A;  2W5V A;  4LRF A;  5IJS A;  1N2L A;  1ZED A;  3M8W A;  2GSU A;  3UN3 A;  4B56 A;  4KAY A;  5HRT A;  3WBH A;  4GTZ A;  4NWJ A;  3M8Y A;  3T00 A;  1AJA A;  4QAX A;  1HJK A;  5GRR A;  1ALJ A;  5LRN A;  5L0E A;  1AJB A;  2ZKT A;  3UN2 A;  1E1Z P;  4GTY A;  1ELX A;  4LR8 A;  3E2D A;  4N7T A;  4UOR A;  4LRA A;  4ZG9 A;  3NKM A;  1KH5 A;  2W5T A;  5DLW A;  4UPL A;  5DLV A;  3NKQ A;  3BDG B;  4KM4 A;  3NKR A;  3UNY A;  4FDJ A;  4TN0 A;  5IJQ A;  2RH6 A;  3TG0 A;  3BDF A;  4GTW A;  5C66 A;  3WAV A;  4UPI A;  4LR7 A;  2D1G A;  3TX0 A;  4LRC A;  2XR9 A;  3CMR A;  4LRB A;  1AJC A;  4CXK A;  1EW2 A;  1ALK A;  4UPH A;  4LRE A;  1EW8 A;  5EGE A;  3MK2 A;  1ZEF A;  1ALH A;  1O98 A;  5GOV A;  3OT9 A;  5LIA A;  1Y7A A;  4FDI A;  3A52 A;  5L0K A;  3LXQ A;  3M7V A;  2GLQ A;  3M8Z A;  3WAX A;  3UN5 A;  1ELZ A;  5INH A;  1HQA A;  1AJD A;  1ELY A;  2W5S A;  2W5W A;  2W5Q A;  1E3C P;  3T02 A;  4ZG7 A;  4UPK A;  2ANH A;  4MY4 A;  3T01 A;  3B5Q A;  1KHL A;  3BDG A;  4LR9 A;  2IUC B;  1E2S P;  1ANI A;  3WAY A;  4LR2 A;  1ALI A;  3MK1 A;  5LQQ A;  2QZU A;  3SZY A;  1ANJ A;  1ED9 A;  2GSN A;  1B8J A;  3KD8 A;  1P49 A;  2W8D A;  4CXS A;  3NKP A;  3SZZ A;  4LQY A;  1SHN A;  1KH7 A;  1ED8 A;  1KH9 A;  4UOP A;  4KJD A;  5EGH A;  3NVL A;  3UO0 A;  3IGY B;  4GTX A;  3DYC A;  4UOO A;  4KAV A;  3BDH A;  1URB A;  2VQR A;  1EI6 A;  1E33 P;  5K4P A;  1EW9 A;  5L0B A;  3TWZ A;  1EJJ A;  4CYR A;  1K7H A;  2W5X A;  2W8S A;  4MIV A;  1SHQ A;  1KHN A;  2W5R A;  3IGZ B;  3NKN A;  4KJG A;  2IUC A;  2G9Y A;  5KXA A;  3IDD A; 
#chains in the Genus database with same CATH topology
 1KH4 A;  3WAW A;  1KHJ A;  2XRG A;  2GSO A;  3NKO A;  4LRD A;  3ED4 A;  1A87 A;  2E50 A;  2X98 A;  1AUK A;  2N19 A;  4MHX A;  4ZGA A;  5TJ3 A;  1Y6V A;  4RCP A;  3P36 A;  3Q3Q A;  1N2K A;  1EQJ A;  1FSU A;  5AJ9 A;  4NWX A;  1O99 A;  3Q1I A;  2GA3 A;  1HDH A;  3BZI A;  4DFW A;  3DPC A;  5LRM A;  3KDR A;  2I9Z A;  4NK7 A;  4ZG6 A;  3MK0 A;  1KHK A;  2VKZ G;  3GYV A;  5DLT A;  2IFY A;  4YR1 A;  4CYS A;  4CXU A;  1E2T A;  1ZEB A;  1Q4O A;  1URA A;  2W5V A;  4LRF A;  5IJS A;  1N2L A;  1ZED A;  3M8W A;  4G7N A;  3FS3 A;  4H71 A;  2GSU A;  4E67 A;  3UN3 A;  4KAY A;  4B56 A;  5HRT A;  4E9C A;  3WBH A;  4GTZ A;  4NWJ A;  3M8Y A;  3T00 A;  1AJA A;  4QAX A;  1HJK A;  2I9X A;  5GRR A;  1ALJ A;  1F32 A;  3LM3 A;  3HIH A;  4E9D A;  5LRN A;  5L0E A;  4O9W A;  1AJB A;  2ZKT A;  3UN2 A;  1E1Z P;  4GTY A;  1ELX A;  4LR8 A;  3E2D A;  4N7T A;  4UOR A;  4LRA A;  4ZG9 A;  3NKM A;  1KH5 A;  2W5T A;  5DLW A;  4UPL A;  5DLV A;  5DAY A;  3NKQ A;  3BDG B;  4KM4 A;  3NKR A;  3UNY A;  3HIK A;  4FDJ A;  4X9R A;  4TN0 A;  5IJQ A;  2RH6 A;  3TG0 A;  3BDF A;  4GTW A;  3HFD A;  5C66 A;  3WAV A;  4N7V A;  4UPI A;  4NKB A;  4LR7 A;  2D1G A;  3TX0 A;  4LRC A;  2XR9 A;  3CMR A;  4LRB A;  4X9V A;  4HCO A;  4N7Z A;  3P35 A;  4CXK A;  1AJC A;  1EW2 A;  1ALK A;  4UPH A;  4LRE A;  1EW8 A;  5EGE A;  3MK2 A;  1ZEF A;  1ALH A;  1O98 A;  4LKM A;  5GOV A;  5DMV C;  3OT9 A;  5LIA A;  1Y7A A;  4FDI A;  3A52 A;  5L0K A;  4WHH A;  3LXQ A;  3M7V A;  3FVH A;  2GLQ A;  3M8Z A;  3WAX A;  5DNJ A;  3UN5 A;  1ELZ A;  5INH A;  3P2Z A;  1HQA A;  1AJD A;  1UMW A;  1ELY A;  2W5S A;  2W5W A;  5L0B A;  2W5Q A;  1E3C P;  4RS6 A;  3T02 A;  4ZG7 A;  4UPK A;  2ANH A;  4MY4 A;  3T01 A;  3B5Q A;  1KHL A;  3BDG A;  4O56 A;  4O6W A;  2IUC B;  4LR9 A;  1E2S P;  1ANI A;  3WAY A;  4LR2 A;  1ALI A;  3MK1 A;  5LQQ A;  2QZU A;  3SZY A;  1ANJ A;  1ED9 A;  2GSN A;  1B8J A;  3KD8 A;  1P49 A;  2W8D A;  4CXS A;  3NKP A;  3SZZ A;  5LHZ A;  4LQY A;  1SHN A;  4HAB A;  1KH7 A;  4LKL A;  4WHL A;  1ED8 A;  2UV8 G;  3GYW A;  1KH9 A;  4UOP A;  3HMJ G;  4KJD A;  5EGH A;  1Q4K A;  2OJX A;  5DMS A;  4XB0 A;  3IGY B;  2IA9 A;  3DYC A;  3NVL A;  4GTX A;  3UO0 A;  4UOO A;  4N9J A;  4KAV A;  3BDH A;  1URB A;  2VQR A;  3P37 A;  1EI6 A;  1E33 P;  5K4P A;  1EW9 A;  2OGQ A;  4HY2 A;  4J7B B;  3RQ7 A;  4YYP A;  4CYR A;  5J19 A;  1EJJ A;  1K7H A;  2W5X A;  3TWZ A;  2W8S A;  4MIV A;  4H5X A;  3P2W A;  3P34 A;  1SHQ A;  1KHN A;  2W5R A;  4X9W A;  3IGZ B;  1F34 B;  4WHK A;  3NKN A;  4KJG A;  2G9Y A;  2IUC A;  3C5L A;  5KXA A;  3IDD A; 
#chains in the Genus database with same CATH homology
 1KH4 A;  3WAW A;  1KHJ A;  2XRG A;  2GSO A;  3NKO A;  4LRD A;  3ED4 A;  2E50 A;  2X98 A;  1AUK A;  4MHX A;  4ZGA A;  5TJ3 A;  1Y6V A;  3Q3Q A;  1N2K A;  1EQJ A;  1FSU A;  5AJ9 A;  4NWX A;  1O99 A;  2GA3 A;  1HDH A;  3DPC A;  5LRM A;  3KDR A;  4NK7 A;  4ZG6 A;  3MK0 A;  1KHK A;  2VKZ G;  3GYV A;  5DLT A;  2IFY A;  4YR1 A;  4CYS A;  4CXU A;  1E2T A;  1ZEB A;  1URA A;  2W5V A;  4LRF A;  5IJS A;  1N2L A;  1ZED A;  3M8W A;  4G7N A;  3FS3 A;  2GSU A;  3UN3 A;  4B56 A;  4KAY A;  5HRT A;  3WBH A;  4GTZ A;  4NWJ A;  3M8Y A;  3T00 A;  1AJA A;  4QAX A;  1HJK A;  5GRR A;  1ALJ A;  5LRN A;  3LM3 A;  5L0E A;  1AJB A;  2ZKT A;  3UN2 A;  1E1Z P;  4GTY A;  1ELX A;  4LR8 A;  3E2D A;  4N7T A;  4UOR A;  4LRA A;  4ZG9 A;  3NKM A;  1KH5 A;  2W5T A;  5DLW A;  4UPL A;  5DLV A;  5DAY A;  3NKQ A;  3BDG B;  4KM4 A;  3NKR A;  3UNY A;  4FDJ A;  4TN0 A;  5IJQ A;  2RH6 A;  3TG0 A;  3BDF A;  4GTW A;  3HFD A;  5C66 A;  3WAV A;  4N7V A;  4UPI A;  4NKB A;  4LR7 A;  2D1G A;  3TX0 A;  4LRC A;  2XR9 A;  3CMR A;  4LRB A;  1AJC A;  4CXK A;  4N7Z A;  1EW2 A;  1ALK A;  4UPH A;  4LRE A;  1EW8 A;  5EGE A;  3MK2 A;  1ZEF A;  1ALH A;  1O98 A;  5GOV A;  3OT9 A;  5LIA A;  1Y7A A;  4FDI A;  3A52 A;  5L0K A;  3LXQ A;  3M7V A;  2GLQ A;  3M8Z A;  3WAX A;  3UN5 A;  1ELZ A;  5INH A;  1HQA A;  1AJD A;  1ELY A;  2W5S A;  2W5W A;  2W5Q A;  1E3C P;  3T02 A;  4ZG7 A;  4UPK A;  2ANH A;  4MY4 A;  3T01 A;  3B5Q A;  1KHL A;  3BDG A;  4LR9 A;  2IUC B;  1E2S P;  1ANI A;  3WAY A;  4LR2 A;  1ALI A;  3MK1 A;  5LQQ A;  2QZU A;  3SZY A;  1ANJ A;  1ED9 A;  2GSN A;  1B8J A;  3KD8 A;  1P49 A;  2W8D A;  4CXS A;  3NKP A;  3SZZ A;  4LQY A;  1SHN A;  1KH7 A;  1ED8 A;  2UV8 G;  3GYW A;  1KH9 A;  4UOP A;  3HMJ G;  4KJD A;  5EGH A;  3NVL A;  3UO0 A;  3IGY B;  4GTX A;  3DYC A;  4UOO A;  4N9J A;  4KAV A;  3BDH A;  1URB A;  2VQR A;  1EI6 A;  1E33 P;  5K4P A;  1EW9 A;  5L0B A;  3TWZ A;  1EJJ A;  4CYR A;  1K7H A;  2W5X A;  2W8S A;  4MIV A;  1SHQ A;  1KHN A;  2W5R A;  3IGZ B;  3NKN A;  4KJG A;  2G9Y A;  2IUC A;  5KXA A;  3IDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...