1F34B

Crystal structure of ascaris pepsin inhibitor-3 bound to porcine pepsin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
148
structure length
138
Chain Sequence
QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPAGGLSPPPPPSFCTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPSIN A
publication title Structural basis for the inhibition of porcine pepsin by Ascaris pepsin inhibitor-3.
pubmed doi rcsb
source organism Ascaris suum
molecule tags Hydrolase/hydrolase inhibitor
total genus 34
structure length 138
sequence length 148
ec nomenclature
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06394 Pepsin-I3 Pepsin inhibitor-3-like repeated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f34B01
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f34B02
1F34B 1F32A
chains in the Genus database with same CATH superfamily
1P49A 4O56A 3HFDA 5AJ9A 1AUKA 1E2SP 3Q1IA 3HMJG 4CXSA 4N7ZA 1Q4OA 3BZIA 1E2TA 4H5XA 4FDIA 3P36A 4LKLA 1UMWA 5J19A 3P2WA 5DMVC 4N7VA 2VKZG 3GYWA 3P37A 4RCPA 3LM3A 4H71A 3GYVA 4E9CA 4G7NA 4CXKA 4NK7A 4J7BB 4RS6A 4X9RA 1N2KA 3P35A 4YYPA 4NKBA 5DMSA 1F32A 1HDHA 4CYRA 4LKMA 4HABA 4WHHA 4DFWA 2E50A 3HIHA 4FDJA 2I9ZA 2OJXA 3KDRA 4XB0A 3FS3A 4WHKA 2OGQA 3ED4A 1N2LA 2IA9A 3HIKA 1E3CP 3LXQA 4HY2A 4O6WA 3P34A 4HCOA 3RQ7A 4X9VA 2I9XA 1F34B 2QZUA 5DAYA 4CXUA 2UV8G 1Q4KA 4E9DA 1FSUA 2N19A 4WHLA 4E67A 4X9WA 5DNJA 3C5LA 1E33P 3P2ZA 4O9WA 5LHZA 1E1ZP 3FVHA 4N9JA 1A87A 4CYSA
chains in the Genus database with same CATH topology
1F34B 1F32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F34 B;  1F32 A; 
#chains in the Genus database with same CATH topology
 1P49 A;  4O56 A;  3HFD A;  5AJ9 A;  1AUK A;  1E2S P;  3Q1I A;  3HMJ G;  4CXS A;  4N7Z A;  1Q4O A;  3BZI A;  1E2T A;  4H5X A;  4FDI A;  3P36 A;  4LKL A;  1UMW A;  5J19 A;  3P2W A;  5DMV C;  4N7V A;  2VKZ G;  3GYW A;  3P37 A;  4RCP A;  3LM3 A;  4H71 A;  3GYV A;  4E9C A;  4G7N A;  4CXK A;  4NK7 A;  4J7B B;  4RS6 A;  4X9R A;  1N2K A;  3P35 A;  4YYP A;  4NKB A;  5DMS A;  1F32 A;  1HDH A;  4CYR A;  4LKM A;  4HAB A;  4WHH A;  4DFW A;  2E50 A;  3HIH A;  4FDJ A;  2I9Z A;  2OJX A;  3KDR A;  4XB0 A;  3FS3 A;  4WHK A;  2OGQ A;  3ED4 A;  1N2L A;  2IA9 A;  3HIK A;  1E3C P;  3LXQ A;  4HY2 A;  4O6W A;  3P34 A;  4HCO A;  3RQ7 A;  4X9V A;  2I9X A;  1F34 B;  2QZU A;  5DAY A;  4CXU A;  2UV8 G;  1Q4K A;  4E9D A;  1FSU A;  2N19 A;  4WHL A;  4E67 A;  4X9W A;  5DNJ A;  3C5L A;  1E33 P;  3P2Z A;  4O9W A;  5LHZ A;  1E1Z P;  3FVH A;  4N9J A;  1A87 A;  4CYS A; 
#chains in the Genus database with same CATH homology
 1F34 B;  1F32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...