1F34B

Crystal structure of ascaris pepsin inhibitor-3 bound to porcine pepsin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
148
structure length
138
Chain Sequence
b'QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPAGGLSPPPPPSFCTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPSIN A
publication title Structural basis for the inhibition of porcine pepsin by Ascaris pepsin inhibitor-3.
pubmed doi rcsb
source organism Ascaris suum
molecule tags Hydrolase/hydrolase inhibitor
total genus 34
structure length 138
sequence length 148
ec nomenclature
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06394 Pepsin-I3 Pepsin inhibitor-3-like repeated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f34B01
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f34B02
1F32A 1F34B
chains in the Genus database with same CATH superfamily
4N7VA 4G7NA 3HFDA 1Q4OA 2I9XA 1P49A 3GYWA 3P36A 2E50A 4LKMA 1UMWA 4DFWA 4E9CA 4CYSA 4RS6A 1Q4KA 4CXKA 1F34B 3HIKA 4CYRA 1HDHA 3BZIA 1FSUA 5DAYA 3RQ7A 4N9JA 2OGQA 1F32A 1E1ZP 2I9ZA 4RCPA 2VKZG 4X9VA 4X9RA 1A87A 4WHKA 4NKBA 3FS3A 3P34A 5LHZA 3LXQA 3Q1IA 5DMSA 3KDRA 2N19A 3C5LA 4E9DA 3LM3A 3P2ZA 4O56A 1E2SP 4WHHA 4X9WA 3GYVA 2QZUA 4YYPA 4H5XA 1E3CP 4CXUA 1E33P 3FVHA 4HABA 4FDIA 3P35A 3HMJG 4FDJA 5J19A 5AJ9A 5DNJA 3P2WA 2UV8G 4LKLA 5DMVC 4H71A 3ED4A 4O6WA 1E2TA 1AUKA 4HCOA 4NK7A 4O9WA 2IA9A 4XB0A 4J7BB 3HIHA 4HY2A 3P37A 4E67A 4N7ZA 2OJXA 1N2LA 1N2KA 4WHLA 4CXSA
chains in the Genus database with same CATH topology
1F32A 1F34B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F32 A;  1F34 B; 
#chains in the Genus database with same CATH topology
 4N7V A;  4G7N A;  3HFD A;  1Q4O A;  2I9X A;  1P49 A;  3GYW A;  3P36 A;  2E50 A;  4LKM A;  1UMW A;  4DFW A;  4E9C A;  4CYS A;  4RS6 A;  1Q4K A;  4CXK A;  1F34 B;  3HIK A;  4CYR A;  1HDH A;  3BZI A;  1FSU A;  5DAY A;  3RQ7 A;  4N9J A;  2OGQ A;  1F32 A;  1E1Z P;  2I9Z A;  4RCP A;  2VKZ G;  4X9V A;  4X9R A;  1A87 A;  4WHK A;  4NKB A;  3FS3 A;  3P34 A;  5LHZ A;  3LXQ A;  3Q1I A;  5DMS A;  3KDR A;  2N19 A;  3C5L A;  4E9D A;  3LM3 A;  3P2Z A;  4O56 A;  1E2S P;  4WHH A;  4X9W A;  3GYV A;  2QZU A;  4YYP A;  4H5X A;  1E3C P;  4CXU A;  1E33 P;  3FVH A;  4HAB A;  4FDI A;  3P35 A;  3HMJ G;  4FDJ A;  5J19 A;  5AJ9 A;  5DNJ A;  3P2W A;  2UV8 G;  4LKL A;  5DMV C;  4H71 A;  3ED4 A;  4O6W A;  1E2T A;  1AUK A;  4HCO A;  4NK7 A;  4O9W A;  2IA9 A;  4XB0 A;  4J7B B;  3HIH A;  4HY2 A;  3P37 A;  4E67 A;  4N7Z A;  2OJX A;  1N2L A;  1N2K A;  4WHL A;  4CXS A; 
#chains in the Genus database with same CATH homology
 1F32 A;  1F34 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...