1F34B

Crystal structure of ascaris pepsin inhibitor-3 bound to porcine pepsin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
148
structure length
138
Chain Sequence
QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPAGGLSPPPPPSFCTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibition of porcine pepsin by Ascaris pepsin inhibitor-3.
pubmed doi rcsb
source organism Ascaris suum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PEPSIN A
total genus 34
structure length 138
sequence length 148
ec nomenclature
pdb deposition date 2000-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06394 Pepsin-I3 Pepsin inhibitor-3-like repeated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f34B01
3.30.1120.50 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Pepsin inhibitor-3 1f34B02
1F34B 1F32A
chains in the Genus database with same CATH superfamily
4H5XA 2N19A 2OJXA 3GYVA 4WHKA 3P2ZA 4N7ZA 1P49A 3KDRA 4X9WA 2UV8G 5DNJA 3LXQA 1Q4OA 4FDJA 2IA9A 4N9JA 4HCOA 4O9WA 3HMJG 4CXUA 3P34A 1F32A 4O56A 4CXKA 3LM3A 4H71A 3P2WA 1UMWA 4CXSA 1AUKA 1F34B 3ED4A 4YYPA 3C5LA 4G7NA 5LHZA 2VKZG 4NKBA 1FSUA 4CYRA 1E33P 3HFDA 5DAYA 3GYWA 4N7VA 3FS3A 4CYSA 5DMVC 4FDIA 4WHHA 4NK7A 4LKLA 4WHLA 3P36A 2I9ZA 3BZIA 2OGQA 3RQ7A 4RS6A 1E1ZP 4E9DA 3HIHA 1A87A 1E2TA 3P37A 1E3CP 2E50A 2I9XA 3Q1IA 4E9CA 3HIKA 4HY2A 4HABA 4XB0A 4E67A 3FVHA 4RCPA 4J7BB 5J19A 4LKMA 1HDHA 2QZUA 4X9VA 1Q4KA 5AJ9A 1N2LA 5DMSA 4DFWA 4X9RA 1N2KA 1E2SP 4O6WA 3P35A
chains in the Genus database with same CATH topology
1F34B 1F32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F34 B;  1F32 A; 
#chains in the Genus database with same CATH topology
 4H5X A;  2N19 A;  2OJX A;  3GYV A;  4WHK A;  3P2Z A;  4N7Z A;  1P49 A;  3KDR A;  4X9W A;  2UV8 G;  5DNJ A;  3LXQ A;  1Q4O A;  4FDJ A;  2IA9 A;  4N9J A;  4HCO A;  4O9W A;  3HMJ G;  4CXU A;  3P34 A;  1F32 A;  4O56 A;  4CXK A;  3LM3 A;  4H71 A;  3P2W A;  1UMW A;  4CXS A;  1AUK A;  1F34 B;  3ED4 A;  4YYP A;  3C5L A;  4G7N A;  5LHZ A;  2VKZ G;  4NKB A;  1FSU A;  4CYR A;  1E33 P;  3HFD A;  5DAY A;  3GYW A;  4N7V A;  3FS3 A;  4CYS A;  5DMV C;  4FDI A;  4WHH A;  4NK7 A;  4LKL A;  4WHL A;  3P36 A;  2I9Z A;  3BZI A;  2OGQ A;  3RQ7 A;  4RS6 A;  1E1Z P;  4E9D A;  3HIH A;  1A87 A;  1E2T A;  3P37 A;  1E3C P;  2E50 A;  2I9X A;  3Q1I A;  4E9C A;  3HIK A;  4HY2 A;  4HAB A;  4XB0 A;  4E67 A;  3FVH A;  4RCP A;  4J7B B;  5J19 A;  4LKM A;  1HDH A;  2QZU A;  4X9V A;  1Q4K A;  5AJ9 A;  1N2L A;  5DMS A;  4DFW A;  4X9R A;  1N2K A;  1E2S P;  4O6W A;  3P35 A; 
#chains in the Genus database with same CATH homology
 1F34 B;  1F32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...