3GYVA

Crystal structure of nucleosome assembly protein from plasmodium falciparum
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
187
Chain Sequence
TEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYGFILSFYFATNPFFSNSVLTKTYHMLHTEATVIDWYDNKNILKRDSFFHFFTSHKEVAQLEMIIEGDYEVALTIKERIIPYAVDYYLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Nucleosome assembly protein 1, putative
publication title Iodide-SAD, SIR and SIRAS phasing for structure solution of a nucleosome assembly protein.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 60
structure length 187
sequence length 246
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3gyvA02
5DAYA 3FS3A 2E50A 3GYVA 3HFDA 3GYWA
chains in the Genus database with same CATH superfamily
5DMVC 1E2SP 1E33P 4YYPA 1A87A 5DAYA 1FSUA 2QZUA 1E2TA 3HFDA 4H71A 4O6WA 4WHKA 1E1ZP 3FS3A 5J19A 4CYSA 4X9VA 5DMSA 4NKBA 3ED4A 3LM3A 3RQ7A 1P49A 4HABA 4G7NA 1F34B 4FDJA 4NK7A 4LKMA 4O9WA 4J7BB 3KDRA 3P37A 3GYWA 4CXUA 4N9JA 4WHLA 2N19A 4FDIA 1HDHA 3Q1IA 1N2LA 4HCOA 4WHHA 3P2ZA 4N7VA 2IA9A 4N7ZA 4X9WA 2I9ZA 4HY2A 3LXQA 3P34A 4CYRA 1F32A 4DFWA 2UV8G 4LKLA 3P2WA 4E67A 4CXSA 5AJ9A 3P35A 4H5XA 3BZIA 3P36A 2OGQA 2OJXA 1AUKA 3GYVA 4X9RA 1UMWA 3HMJG 4E9DA 2E50A 3C5LA 3HIHA 4E9CA 3HIKA 4CXKA 1Q4OA 1N2KA 4RS6A 3FVHA 2VKZG 5LHZA 5DNJA 1Q4KA 4RCPA 1E3CP 4O56A 2I9XA 4XB0A
chains in the Genus database with same CATH topology
1P49A 3HMJG 3LXQA 4G7NA 4CYRA 2E50A 4FDJA 1E2SP 4NK7A 1E33P 3KDRA 2UV8G 3GYWA 4CXUA 4N9JA 5DAYA 4CXKA 1FSUA 4CXSA 5AJ9A 2QZUA 1E2TA 3HFDA 4FDIA 1HDHA 1N2KA 1E1ZP 1N2LA 3FS3A 2VKZG 4CYSA 1AUKA 1E3CP 4N7VA 4NKBA 4N7ZA 3GYVA 3ED4A 3LM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAY A;  3FS3 A;  2E50 A;  3GYV A;  3HFD A;  3GYW A; 
#chains in the Genus database with same CATH topology
 5DMV C;  1E2S P;  1E33 P;  4YYP A;  1A87 A;  5DAY A;  1FSU A;  2QZU A;  1E2T A;  3HFD A;  4H71 A;  4O6W A;  4WHK A;  1E1Z P;  3FS3 A;  5J19 A;  4CYS A;  4X9V A;  5DMS A;  4NKB A;  3ED4 A;  3LM3 A;  3RQ7 A;  1P49 A;  4HAB A;  4G7N A;  1F34 B;  4FDJ A;  4NK7 A;  4LKM A;  4O9W A;  4J7B B;  3KDR A;  3P37 A;  3GYW A;  4CXU A;  4N9J A;  4WHL A;  2N19 A;  4FDI A;  1HDH A;  3Q1I A;  1N2L A;  4HCO A;  4WHH A;  3P2Z A;  4N7V A;  2IA9 A;  4N7Z A;  4X9W A;  2I9Z A;  4HY2 A;  3LXQ A;  3P34 A;  4CYR A;  1F32 A;  4DFW A;  2UV8 G;  4LKL A;  3P2W A;  4E67 A;  4CXS A;  5AJ9 A;  3P35 A;  4H5X A;  3BZI A;  3P36 A;  2OGQ A;  2OJX A;  1AUK A;  3GYV A;  4X9R A;  1UMW A;  3HMJ G;  4E9D A;  2E50 A;  3C5L A;  3HIH A;  4E9C A;  3HIK A;  4CXK A;  1Q4O A;  1N2K A;  4RS6 A;  3FVH A;  2VKZ G;  5LHZ A;  5DNJ A;  1Q4K A;  4RCP A;  1E3C P;  4O56 A;  2I9X A;  4XB0 A; 
#chains in the Genus database with same CATH homology
 1P49 A;  3HMJ G;  3LXQ A;  4G7N A;  4CYR A;  2E50 A;  4FDJ A;  1E2S P;  4NK7 A;  1E33 P;  3KDR A;  2UV8 G;  3GYW A;  4CXU A;  4N9J A;  5DAY A;  4CXK A;  1FSU A;  4CXS A;  5AJ9 A;  2QZU A;  1E2T A;  3HFD A;  4FDI A;  1HDH A;  1N2K A;  1E1Z P;  1N2L A;  3FS3 A;  2VKZ G;  4CYS A;  1AUK A;  1E3C P;  4N7V A;  4NKB A;  4N7Z A;  3GYV A;  3ED4 A;  3LM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...