3GYVA

Crystal structure of nucleosome assembly protein from plasmodium falciparum
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
187
Chain Sequence
TEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYGFILSFYFATNPFFSNSVLTKTYHMLHTEATVIDWYDNKNILKRDSFFHFFTSHKEVAQLEMIIEGDYEVALTIKERIIPYAVDYYLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome assembly protein 1, putative
publication title Iodide-SAD, SIR and SIRAS phasing for structure solution of a nucleosome assembly protein.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
total genus 60
structure length 187
sequence length 246
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3gyvA02
3GYWA 3HFDA 2E50A 3GYVA 5DAYA 3FS3A
chains in the Genus database with same CATH superfamily
4X9RA 2OJXA 3GYVA 3P2WA 4CYRA 1AUKA 5DNJA 4N7ZA 4NKBA 4N9JA 4WHHA 4O56A 4H5XA 1N2LA 4O9WA 4N7VA 4G7NA 4FDIA 4O6WA 1E2SP 4E67A 1A87A 2I9ZA 1E3CP 2QZUA 1E33P 4WHKA 4CXKA 3GYWA 3C5LA 4WHLA 1E1ZP 4H71A 3LM3A 3ED4A 4FDJA 4X9WA 2OGQA 4E9DA 1N2KA 3P2ZA 1P49A 4J7BB 1Q4KA 2IA9A 4X9VA 3HIHA 4RCPA 3KDRA 1FSUA 1F32A 5DAYA 2N19A 2VKZG 4LKMA 3LXQA 2E50A 3BZIA 5DMVC 4RS6A 4YYPA 1F34B 2I9XA 3Q1IA 3P36A 4CYSA 1Q4OA 4CXSA 5J19A 3HFDA 5LHZA 4HCOA 4NK7A 4HY2A 5AJ9A 4E9CA 3FS3A 5DMSA 4HABA 3FVHA 1UMWA 1HDHA 2UV8G 3HIKA 4XB0A 1E2TA 3P34A 4LKLA 3P35A 4CXUA 4DFWA 3RQ7A 3P37A 3HMJG
chains in the Genus database with same CATH topology
2VKZG 3GYWA 5AJ9A 3LXQA 1E1ZP 2E50A 3GYVA 3LM3A 4CYRA 3ED4A 3FS3A 4FDJA 1AUKA 4N7ZA 1N2KA 1HDHA 4N9JA 4NKBA 2UV8G 1P49A 1N2LA 4CYSA 4N7VA 4G7NA 4FDIA 1E2TA 4CXSA 1E2SP 1E3CP 3HFDA 4CXUA 2QZUA 3KDRA 1E33P 1FSUA 4NK7A 5DAYA 3HMJG 4CXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYW A;  3HFD A;  2E50 A;  3GYV A;  5DAY A;  3FS3 A; 
#chains in the Genus database with same CATH topology
 4X9R A;  2OJX A;  3GYV A;  3P2W A;  4CYR A;  1AUK A;  5DNJ A;  4N7Z A;  4NKB A;  4N9J A;  4WHH A;  4O56 A;  4H5X A;  1N2L A;  4O9W A;  4N7V A;  4G7N A;  4FDI A;  4O6W A;  1E2S P;  4E67 A;  1A87 A;  2I9Z A;  1E3C P;  2QZU A;  1E33 P;  4WHK A;  4CXK A;  3GYW A;  3C5L A;  4WHL A;  1E1Z P;  4H71 A;  3LM3 A;  3ED4 A;  4FDJ A;  4X9W A;  2OGQ A;  4E9D A;  1N2K A;  3P2Z A;  1P49 A;  4J7B B;  1Q4K A;  2IA9 A;  4X9V A;  3HIH A;  4RCP A;  3KDR A;  1FSU A;  1F32 A;  5DAY A;  2N19 A;  2VKZ G;  4LKM A;  3LXQ A;  2E50 A;  3BZI A;  5DMV C;  4RS6 A;  4YYP A;  1F34 B;  2I9X A;  3Q1I A;  3P36 A;  4CYS A;  1Q4O A;  4CXS A;  5J19 A;  3HFD A;  5LHZ A;  4HCO A;  4NK7 A;  4HY2 A;  5AJ9 A;  4E9C A;  3FS3 A;  5DMS A;  4HAB A;  3FVH A;  1UMW A;  1HDH A;  2UV8 G;  3HIK A;  4XB0 A;  1E2T A;  3P34 A;  4LKL A;  3P35 A;  4CXU A;  4DFW A;  3RQ7 A;  3P37 A;  3HMJ G; 
#chains in the Genus database with same CATH homology
 2VKZ G;  3GYW A;  5AJ9 A;  3LXQ A;  1E1Z P;  2E50 A;  3GYV A;  3LM3 A;  4CYR A;  3ED4 A;  3FS3 A;  4FDJ A;  1AUK A;  4N7Z A;  1N2K A;  1HDH A;  4N9J A;  4NKB A;  2UV8 G;  1P49 A;  1N2L A;  4CYS A;  4N7V A;  4G7N A;  4FDI A;  1E2T A;  4CXS A;  1E2S P;  1E3C P;  3HFD A;  4CXU A;  2QZU A;  3KDR A;  1E33 P;  1FSU A;  4NK7 A;  5DAY A;  3HMJ G;  4CXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...