3GYVA

Crystal structure of nucleosome assembly protein from plasmodium falciparum
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
187
Chain Sequence
TEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYGFILSFYFATNPFFSNSVLTKTYHMLHTEATVIDWYDNKNILKRDSFFHFFTSHKEVAQLEMIIEGDYEVALTIKERIIPYAVDYYLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iodide-SAD, SIR and SIRAS phasing for structure solution of a nucleosome assembly protein.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
molecule keywords Nucleosome assembly protein 1, putative
total genus 60
structure length 187
sequence length 246
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3gyvA02
5DAYA 3HFDA 2E50A 3GYWA 3FS3A 3GYVA
chains in the Genus database with same CATH superfamily
2QZUA 4RS6A 1Q4OA 4NKBA 4RCPA 4O56A 5DAYA 2UV8G 5J19A 4X9VA 3KDRA 3GYWA 3P2WA 1E1ZP 2I9XA 4NK7A 1AUKA 1Q4KA 4LKMA 4E9DA 1N2KA 3Q1IA 1F34B 2VKZG 4HCOA 4X9RA 5AJ9A 1UMWA 4J7BB 3RQ7A 1A87A 3P36A 3BZIA 3P37A 3FS3A 4HABA 1E2TA 3HFDA 4CXKA 4WHHA 1E3CP 1F32A 1P49A 5DNJA 4FDJA 3C5LA 4CYSA 3P34A 5LHZA 4E67A 3HIKA 4CXUA 2I9ZA 4WHKA 1E33P 4G7NA 4H5XA 4LKLA 4N9JA 1HDHA 2OGQA 1FSUA 4X9WA 4XB0A 1N2LA 3LXQA 4O9WA 4N7VA 4YYPA 3HIHA 5DMVC 3HMJG 4E9CA 4WHLA 1E2SP 3GYVA 5DMSA 2OJXA 3ED4A 4HY2A 4CXSA 2E50A 4CYRA 3P2ZA 4H71A 2IA9A 3LM3A 4DFWA 4N7ZA 4FDIA 3P35A 3FVHA 2N19A 4O6WA
chains in the Genus database with same CATH topology
1N2KA 2QZUA 1E2SP 4CXUA 2VKZG 5AJ9A 3GYVA 4NKBA 1E33P 3ED4A 4G7NA 4CXSA 5DAYA 2E50A 4N9JA 4CYRA 1HDHA 2UV8G 1FSUA 1N2LA 3LM3A 3KDRA 3GYWA 4N7ZA 1E1ZP 3FS3A 3LXQA 4FDIA 4NK7A 4N7VA 1AUKA 1E2TA 3HFDA 4CXKA 1E3CP 1P49A 4FDJA 3HMJG 4CYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAY A;  3HFD A;  2E50 A;  3GYW A;  3FS3 A;  3GYV A; 
#chains in the Genus database with same CATH topology
 2QZU A;  4RS6 A;  1Q4O A;  4NKB A;  4RCP A;  4O56 A;  5DAY A;  2UV8 G;  5J19 A;  4X9V A;  3KDR A;  3GYW A;  3P2W A;  1E1Z P;  2I9X A;  4NK7 A;  1AUK A;  1Q4K A;  4LKM A;  4E9D A;  1N2K A;  3Q1I A;  1F34 B;  2VKZ G;  4HCO A;  4X9R A;  5AJ9 A;  1UMW A;  4J7B B;  3RQ7 A;  1A87 A;  3P36 A;  3BZI A;  3P37 A;  3FS3 A;  4HAB A;  1E2T A;  3HFD A;  4CXK A;  4WHH A;  1E3C P;  1F32 A;  1P49 A;  5DNJ A;  4FDJ A;  3C5L A;  4CYS A;  3P34 A;  5LHZ A;  4E67 A;  3HIK A;  4CXU A;  2I9Z A;  4WHK A;  1E33 P;  4G7N A;  4H5X A;  4LKL A;  4N9J A;  1HDH A;  2OGQ A;  1FSU A;  4X9W A;  4XB0 A;  1N2L A;  3LXQ A;  4O9W A;  4N7V A;  4YYP A;  3HIH A;  5DMV C;  3HMJ G;  4E9C A;  4WHL A;  1E2S P;  3GYV A;  5DMS A;  2OJX A;  3ED4 A;  4HY2 A;  4CXS A;  2E50 A;  4CYR A;  3P2Z A;  4H71 A;  2IA9 A;  3LM3 A;  4DFW A;  4N7Z A;  4FDI A;  3P35 A;  3FVH A;  2N19 A;  4O6W A; 
#chains in the Genus database with same CATH homology
 1N2K A;  2QZU A;  1E2S P;  4CXU A;  2VKZ G;  5AJ9 A;  3GYV A;  4NKB A;  1E33 P;  3ED4 A;  4G7N A;  4CXS A;  5DAY A;  2E50 A;  4N9J A;  4CYR A;  1HDH A;  2UV8 G;  1FSU A;  1N2L A;  3LM3 A;  3KDR A;  3GYW A;  4N7Z A;  1E1Z P;  3FS3 A;  3LXQ A;  4FDI A;  4NK7 A;  4N7V A;  1AUK A;  1E2T A;  3HFD A;  4CXK A;  1E3C P;  1P49 A;  4FDJ A;  3HMJ G;  4CYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...