3GYVA

Crystal structure of nucleosome assembly protein from plasmodium falciparum
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
246
structure length
187
Chain Sequence
TEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYGFILSFYFATNPFFSNSVLTKTYHMLHTEATVIDWYDNKNILKRDSFFHFFTSHKEVAQLEMIIEGDYEVALTIKERIIPYAVDYYLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome assembly protein 1, putative
publication title Iodide-SAD, SIR and SIRAS phasing for structure solution of a nucleosome assembly protein.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Chaperone
total genus 60
structure length 187
sequence length 246
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00956 NAP Nucleosome assembly protein (NAP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3gyvA02
3GYWA 3GYVA 3FS3A 5DAYA 2E50A 3HFDA
chains in the Genus database with same CATH superfamily
4O56A 4X9WA 4WHKA 5DMSA 4E9DA 4X9RA 1F32A 4RS6A 2IA9A 5DAYA 1N2LA 3HIKA 5J19A 4HCOA 3FS3A 4NK7A 4HABA 1E3CP 4DFWA 4YYPA 4FDJA 1F34B 4CYSA 4XB0A 4RCPA 5AJ9A 4CXUA 3KDRA 3LXQA 3RQ7A 1Q4OA 2OJXA 1A87A 4LKMA 5LHZA 4FDIA 4WHLA 4H71A 1FSUA 3BZIA 4CXSA 1E2TA 4CXKA 2I9XA 1Q4KA 3GYWA 3GYVA 4X9VA 4H5XA 1P49A 2E50A 3LM3A 4CYRA 4O6WA 4O9WA 3P2WA 1UMWA 5DMVC 4WHHA 4N7ZA 3HIHA 2OGQA 2I9ZA 3P35A 3P36A 1E1ZP 3P2ZA 3C5LA 1AUKA 4LKLA 4G7NA 3Q1IA 4HY2A 1HDHA 4N7VA 3HFDA 1N2KA 2QZUA 2VKZG 2UV8G 1E2SP 1E33P 4NKBA 2N19A 4E67A 3P34A 4N9JA 5DNJA 3HMJG 4E9CA 3ED4A 3P37A 4J7BB 3FVHA
chains in the Genus database with same CATH topology
4G7NA 3GYWA 4CYSA 3GYVA 1HDHA 5AJ9A 4N7VA 4CXUA 1P49A 2E50A 3KDRA 3HFDA 2QZUA 1N2KA 3LM3A 2VKZG 3LXQA 2UV8G 4CYRA 1E2SP 1E33P 4NKBA 5DAYA 1N2LA 4N7ZA 4N9JA 3FS3A 4NK7A 4FDIA 1E3CP 1E1ZP 1FSUA 4FDJA 3HMJG 4CXSA 1E2TA 4CXKA 1AUKA 3ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYW A;  3GYV A;  3FS3 A;  5DAY A;  2E50 A;  3HFD A; 
#chains in the Genus database with same CATH topology
 4O56 A;  4X9W A;  4WHK A;  5DMS A;  4E9D A;  4X9R A;  1F32 A;  4RS6 A;  2IA9 A;  5DAY A;  1N2L A;  3HIK A;  5J19 A;  4HCO A;  3FS3 A;  4NK7 A;  4HAB A;  1E3C P;  4DFW A;  4YYP A;  4FDJ A;  1F34 B;  4CYS A;  4XB0 A;  4RCP A;  5AJ9 A;  4CXU A;  3KDR A;  3LXQ A;  3RQ7 A;  1Q4O A;  2OJX A;  1A87 A;  4LKM A;  5LHZ A;  4FDI A;  4WHL A;  4H71 A;  1FSU A;  3BZI A;  4CXS A;  1E2T A;  4CXK A;  2I9X A;  1Q4K A;  3GYW A;  3GYV A;  4X9V A;  4H5X A;  1P49 A;  2E50 A;  3LM3 A;  4CYR A;  4O6W A;  4O9W A;  3P2W A;  1UMW A;  5DMV C;  4WHH A;  4N7Z A;  3HIH A;  2OGQ A;  2I9Z A;  3P35 A;  3P36 A;  1E1Z P;  3P2Z A;  3C5L A;  1AUK A;  4LKL A;  4G7N A;  3Q1I A;  4HY2 A;  1HDH A;  4N7V A;  3HFD A;  1N2K A;  2QZU A;  2VKZ G;  2UV8 G;  1E2S P;  1E33 P;  4NKB A;  2N19 A;  4E67 A;  3P34 A;  4N9J A;  5DNJ A;  3HMJ G;  4E9C A;  3ED4 A;  3P37 A;  4J7B B;  3FVH A; 
#chains in the Genus database with same CATH homology
 4G7N A;  3GYW A;  4CYS A;  3GYV A;  1HDH A;  5AJ9 A;  4N7V A;  4CXU A;  1P49 A;  2E50 A;  3KDR A;  3HFD A;  2QZU A;  1N2K A;  3LM3 A;  2VKZ G;  3LXQ A;  2UV8 G;  4CYR A;  1E2S P;  1E33 P;  4NKB A;  5DAY A;  1N2L A;  4N7Z A;  4N9J A;  3FS3 A;  4NK7 A;  4FDI A;  1E3C P;  1E1Z P;  1FSU A;  4FDJ A;  3HMJ G;  4CXS A;  1E2T A;  4CXK A;  1AUK A;  3ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...