2OGQA

Molecular and structural basis of plk1 substrate recognition: implications in centrosomal localization
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
223
structure length
211
Chain Sequence
DCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular and structural basis of polo-like kinase 1 substrate recognition: Implications in centrosomal localization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
total genus 71
structure length 211
sequence length 223
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2ogqA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2ogqA01
4LKMA 2OGQA 4O56A 3HIHA 4O6WA 3FVHA 1UMWA 3BZIA 4O9WA 3P2ZA 4RS6A 3P36A 4X9WA 4LKLA 3RQ7A 2OJXA 4HY2A 4HABA 3C5LA 4YYPA 3P34A 3P37A 5DMSA 4XB0A 1Q4KA 3P35A 4WHLA 3Q1IA 5DMVC 4X9RA 4H5XA 4WHKA 4E9CA 4E9DA 1Q4OA 4HCOA 5J19A 4H71A 4RCPA 4DFWA 4WHHA 3P2WA 2N19A 4J7BB 3HIKA 5DNJA 4X9VA 5LHZA 4E67A
chains in the Genus database with same CATH superfamily
1N2LA 3HIHA 1FSUA 3HFDA 1UMWA 3BZIA 3GYVA 4RS6A 3FS3A 5AJ9A 2OJXA 1E33P 3HMJG 4YYPA 1F32A 3P34A 1Q4KA 1E2TA 3Q1IA 4WHKA 3ED4A 4DFWA 2I9XA 4LKMA 4O6WA 4NKBA 3RQ7A 4CXUA 4N9JA 4HY2A 3KDRA 4N7VA 2I9ZA 4XB0A 5DMVC 4H5XA 1E2SP 4N7ZA 2QZUA 4E9DA 4H71A 4RCPA 4WHHA 2N19A 3HIKA 1F34B 4E67A 4G7NA 4O56A 3FVHA 4CYRA 4O9WA 3P36A 4LKLA 2UV8G 4HABA 4CYSA 4WHLA 2VKZG 4NK7A 4FDIA 1Q4OA 4HCOA 5J19A 1E1ZP 1AUKA 4FDJA 3P2WA 1P49A 4CXSA 5LHZA 5DNJA 1N2KA 2OGQA 3GYWA 3LXQA 3P2ZA 1A87A 4X9WA 5DAYA 2IA9A 3C5LA 3P37A 5DMSA 1HDHA 3P35A 4X9RA 4E9CA 1E3CP 3LM3A 2E50A 4J7BB 4X9VA 4CXKA
chains in the Genus database with same CATH topology
4LKMA 2OGQA 4O56A 3HIHA 4O6WA 3FVHA 1UMWA 3BZIA 4O9WA 3P2ZA 4RS6A 3P36A 4X9WA 4LKLA 3RQ7A 2OJXA 4HY2A 4HABA 3C5LA 4YYPA 3P34A 3P37A 5DMSA 4XB0A 1Q4KA 3P35A 4WHLA 3Q1IA 5DMVC 4X9RA 4H5XA 4WHKA 4E9CA 4E9DA 1Q4OA 4HCOA 5J19A 4H71A 4RCPA 4DFWA 4WHHA 3P2WA 2N19A 4J7BB 3HIKA 5DNJA 4X9VA 5LHZA 4E67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LKM A;  2OGQ A;  4O56 A;  3HIH A;  4O6W A;  3FVH A;  1UMW A;  3BZI A;  4O9W A;  3P2Z A;  4RS6 A;  3P36 A;  4X9W A;  4LKL A;  3RQ7 A;  2OJX A;  4HY2 A;  4HAB A;  3C5L A;  4YYP A;  3P34 A;  3P37 A;  5DMS A;  4XB0 A;  1Q4K A;  3P35 A;  4WHL A;  3Q1I A;  5DMV C;  4X9R A;  4H5X A;  4WHK A;  4E9C A;  4E9D A;  1Q4O A;  4HCO A;  5J19 A;  4H71 A;  4RCP A;  4DFW A;  4WHH A;  3P2W A;  2N19 A;  4J7B B;  3HIK A;  5DNJ A;  4X9V A;  5LHZ A;  4E67 A; 
#chains in the Genus database with same CATH topology
 1N2L A;  3HIH A;  1FSU A;  3HFD A;  1UMW A;  3BZI A;  3GYV A;  4RS6 A;  3FS3 A;  5AJ9 A;  2OJX A;  1E33 P;  3HMJ G;  4YYP A;  1F32 A;  3P34 A;  1Q4K A;  1E2T A;  3Q1I A;  4WHK A;  3ED4 A;  4DFW A;  2I9X A;  4LKM A;  4O6W A;  4NKB A;  3RQ7 A;  4CXU A;  4N9J A;  4HY2 A;  3KDR A;  4N7V A;  2I9Z A;  4XB0 A;  5DMV C;  4H5X A;  1E2S P;  4N7Z A;  2QZU A;  4E9D A;  4H71 A;  4RCP A;  4WHH A;  2N19 A;  3HIK A;  1F34 B;  4E67 A;  4G7N A;  4O56 A;  3FVH A;  4CYR A;  4O9W A;  3P36 A;  4LKL A;  2UV8 G;  4HAB A;  4CYS A;  4WHL A;  2VKZ G;  4NK7 A;  4FDI A;  1Q4O A;  4HCO A;  5J19 A;  1E1Z P;  1AUK A;  4FDJ A;  3P2W A;  1P49 A;  4CXS A;  5LHZ A;  5DNJ A;  1N2K A;  2OGQ A;  3GYW A;  3LXQ A;  3P2Z A;  1A87 A;  4X9W A;  5DAY A;  2IA9 A;  3C5L A;  3P37 A;  5DMS A;  1HDH A;  3P35 A;  4X9R A;  4E9C A;  1E3C P;  3LM3 A;  2E50 A;  4J7B B;  4X9V A;  4CXK A; 
#chains in the Genus database with same CATH homology
 4LKM A;  2OGQ A;  4O56 A;  3HIH A;  4O6W A;  3FVH A;  1UMW A;  3BZI A;  4O9W A;  3P2Z A;  4RS6 A;  3P36 A;  4X9W A;  4LKL A;  3RQ7 A;  2OJX A;  4HY2 A;  4HAB A;  3C5L A;  4YYP A;  3P34 A;  3P37 A;  5DMS A;  4XB0 A;  1Q4K A;  3P35 A;  4WHL A;  3Q1I A;  5DMV C;  4X9R A;  4H5X A;  4WHK A;  4E9C A;  4E9D A;  1Q4O A;  4HCO A;  5J19 A;  4H71 A;  4RCP A;  4DFW A;  4WHH A;  3P2W A;  2N19 A;  4J7B B;  3HIK A;  5DNJ A;  4X9V A;  5LHZ A;  4E67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...