2OGQA

Molecular and structural basis of plk1 substrate recognition: implications in centrosomal localization
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
223
structure length
211
Chain Sequence
DCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
publication title Molecular and structural basis of polo-like kinase 1 substrate recognition: Implications in centrosomal localization.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 211
sequence length 223
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2ogqA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2ogqA01
4DFWA 4E67A 3HIKA 5LHZA 3HIHA 4RS6A 1UMWA 3FVHA 4HY2A 4HCOA 4LKLA 4H5XA 5DMSA 5DNJA 4J7BB 5DMVC 3P2WA 2OGQA 3P37A 4O56A 4E9DA 4WHLA 3P34A 4O9WA 3Q1IA 3BZIA 4H71A 1Q4OA 4HABA 5J19A 3P2ZA 4E9CA 3P35A 4XB0A 4WHKA 4YYPA 4X9WA 4X9RA 4O6WA 4X9VA 2N19A 4WHHA 2OJXA 4LKMA 3RQ7A 4RCPA 3C5LA 3P36A 1Q4KA
chains in the Genus database with same CATH superfamily
1E3CP 3FS3A 4E67A 1UMWA 1A87A 4CYSA 4NK7A 1AUKA 3P37A 3KDRA 4O56A 2I9ZA 4CYRA 3P34A 4N9JA 3BZIA 4H71A 4HABA 4NKBA 1P49A 1FSUA 4X9WA 3HMJG 4WHHA 2OJXA 3RQ7A 4CXKA 3GYWA 3C5LA 3P36A 4RCPA 4DFWA 2IA9A 5LHZA 3HIHA 4HCOA 1HDHA 3ED4A 4J7BB 5DMVC 2I9XA 4O9WA 5DAYA 4WHKA 2E50A 5AJ9A 4X9RA 3LM3A 4O6WA 4LKMA 1N2LA 3GYVA 1Q4KA 4CXSA 3HIKA 1E2SP 4RS6A 3FVHA 4LKLA 1F32A 3LXQA 4G7NA 4YYPA 1E1ZP 2N19A 2VKZG 4N7ZA 1E33P 5DNJA 4HY2A 4H5XA 5DMSA 4N7VA 1N2KA 1F34B 1E2TA 4FDIA 3HFDA 3P2WA 2OGQA 4E9DA 4WHLA 2UV8G 3Q1IA 1Q4OA 2QZUA 5J19A 3P2ZA 4E9CA 3P35A 4XB0A 4X9VA 4FDJA 4CXUA
chains in the Genus database with same CATH topology
4DFWA 4E67A 3HIKA 5LHZA 3HIHA 4RS6A 1UMWA 3FVHA 4HY2A 4HCOA 4LKLA 4H5XA 5DMSA 5DNJA 4J7BB 5DMVC 3P2WA 2OGQA 3P37A 4O56A 4E9DA 4WHLA 3P34A 4O9WA 3Q1IA 3BZIA 4H71A 1Q4OA 4HABA 5J19A 3P2ZA 4E9CA 3P35A 4XB0A 4WHKA 4YYPA 4X9WA 4X9RA 4O6WA 4X9VA 2N19A 4WHHA 2OJXA 4LKMA 3RQ7A 4RCPA 3C5LA 3P36A 1Q4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DFW A;  4E67 A;  3HIK A;  5LHZ A;  3HIH A;  4RS6 A;  1UMW A;  3FVH A;  4HY2 A;  4HCO A;  4LKL A;  4H5X A;  5DMS A;  5DNJ A;  4J7B B;  5DMV C;  3P2W A;  2OGQ A;  3P37 A;  4O56 A;  4E9D A;  4WHL A;  3P34 A;  4O9W A;  3Q1I A;  3BZI A;  4H71 A;  1Q4O A;  4HAB A;  5J19 A;  3P2Z A;  4E9C A;  3P35 A;  4XB0 A;  4WHK A;  4YYP A;  4X9W A;  4X9R A;  4O6W A;  4X9V A;  2N19 A;  4WHH A;  2OJX A;  4LKM A;  3RQ7 A;  4RCP A;  3C5L A;  3P36 A;  1Q4K A; 
#chains in the Genus database with same CATH topology
 1E3C P;  3FS3 A;  4E67 A;  1UMW A;  1A87 A;  4CYS A;  4NK7 A;  1AUK A;  3P37 A;  3KDR A;  4O56 A;  2I9Z A;  4CYR A;  3P34 A;  4N9J A;  3BZI A;  4H71 A;  4HAB A;  4NKB A;  1P49 A;  1FSU A;  4X9W A;  3HMJ G;  4WHH A;  2OJX A;  3RQ7 A;  4CXK A;  3GYW A;  3C5L A;  3P36 A;  4RCP A;  4DFW A;  2IA9 A;  5LHZ A;  3HIH A;  4HCO A;  1HDH A;  3ED4 A;  4J7B B;  5DMV C;  2I9X A;  4O9W A;  5DAY A;  4WHK A;  2E50 A;  5AJ9 A;  4X9R A;  3LM3 A;  4O6W A;  4LKM A;  1N2L A;  3GYV A;  1Q4K A;  4CXS A;  3HIK A;  1E2S P;  4RS6 A;  3FVH A;  4LKL A;  1F32 A;  3LXQ A;  4G7N A;  4YYP A;  1E1Z P;  2N19 A;  2VKZ G;  4N7Z A;  1E33 P;  5DNJ A;  4HY2 A;  4H5X A;  5DMS A;  4N7V A;  1N2K A;  1F34 B;  1E2T A;  4FDI A;  3HFD A;  3P2W A;  2OGQ A;  4E9D A;  4WHL A;  2UV8 G;  3Q1I A;  1Q4O A;  2QZU A;  5J19 A;  3P2Z A;  4E9C A;  3P35 A;  4XB0 A;  4X9V A;  4FDJ A;  4CXU A; 
#chains in the Genus database with same CATH homology
 4DFW A;  4E67 A;  3HIK A;  5LHZ A;  3HIH A;  4RS6 A;  1UMW A;  3FVH A;  4HY2 A;  4HCO A;  4LKL A;  4H5X A;  5DMS A;  5DNJ A;  4J7B B;  5DMV C;  3P2W A;  2OGQ A;  3P37 A;  4O56 A;  4E9D A;  4WHL A;  3P34 A;  4O9W A;  3Q1I A;  3BZI A;  4H71 A;  1Q4O A;  4HAB A;  5J19 A;  3P2Z A;  4E9C A;  3P35 A;  4XB0 A;  4WHK A;  4YYP A;  4X9W A;  4X9R A;  4O6W A;  4X9V A;  2N19 A;  4WHH A;  2OJX A;  4LKM A;  3RQ7 A;  4RCP A;  3C5L A;  3P36 A;  1Q4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...