2IA9A

Structural genomics, the crystal structure of spovg from bacillus subtilis subsp. subtilis str. 168
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
NAMEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDITHPINSSTRGKIQDAVLNEYHRLGDTEALEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative septation protein spoVG
publication title The crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 18
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04026 SpoVG SpoVG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.40 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Stage V sporulation protein G 2ia9A00
2IA9A 2I9ZA 2I9XA
chains in the Genus database with same CATH superfamily
4E67A 4HABA 4N7ZA 3P37A 4N9JA 4N7VA 4XB0A 1P49A 3BZIA 3HFDA 3C5LA 1E2SP 1N2KA 2I9ZA 1E1ZP 3LXQA 3RQ7A 2I9XA 5DAYA 4E9DA 4CXKA 4RS6A 4FDJA 3P2WA 4DFWA 1F32A 2IA9A 1E3CP 4WHLA 4FDIA 1E2TA 3KDRA 1F34B 1N2LA 4X9RA 4X9WA 4WHHA 2OGQA 5DMVC 4O9WA 2N19A 4H5XA 1A87A 4X9VA 3HIHA 3GYVA 1Q4KA 4NK7A 2UV8G 4CXSA 3Q1IA 4YYPA 5LHZA 4LKMA 3P35A 2QZUA 4CXUA 1Q4OA 3P36A 4CYRA 3GYWA 3HIKA 2OJXA 4CYSA 4HCOA 4LKLA 4NKBA 4RCPA 3P2ZA 3FVHA 4O6WA 3LM3A 4J7BB 1E33P 4WHKA 3P34A 5AJ9A 2E50A 4E9CA 3HMJG 1UMWA 1FSUA 4G7NA 4HY2A 4O56A 5J19A 5DNJA 1AUKA 5DMSA 4H71A 2VKZG 3FS3A 3ED4A 1HDHA
chains in the Genus database with same CATH topology
2IA9A 2I9ZA 2I9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IA9 A;  2I9Z A;  2I9X A; 
#chains in the Genus database with same CATH topology
 4E67 A;  4HAB A;  4N7Z A;  3P37 A;  4N9J A;  4N7V A;  4XB0 A;  1P49 A;  3BZI A;  3HFD A;  3C5L A;  1E2S P;  1N2K A;  2I9Z A;  1E1Z P;  3LXQ A;  3RQ7 A;  2I9X A;  5DAY A;  4E9D A;  4CXK A;  4RS6 A;  4FDJ A;  3P2W A;  4DFW A;  1F32 A;  2IA9 A;  1E3C P;  4WHL A;  4FDI A;  1E2T A;  3KDR A;  1F34 B;  1N2L A;  4X9R A;  4X9W A;  4WHH A;  2OGQ A;  5DMV C;  4O9W A;  2N19 A;  4H5X A;  1A87 A;  4X9V A;  3HIH A;  3GYV A;  1Q4K A;  4NK7 A;  2UV8 G;  4CXS A;  3Q1I A;  4YYP A;  5LHZ A;  4LKM A;  3P35 A;  2QZU A;  4CXU A;  1Q4O A;  3P36 A;  4CYR A;  3GYW A;  3HIK A;  2OJX A;  4CYS A;  4HCO A;  4LKL A;  4NKB A;  4RCP A;  3P2Z A;  3FVH A;  4O6W A;  3LM3 A;  4J7B B;  1E33 P;  4WHK A;  3P34 A;  5AJ9 A;  2E50 A;  4E9C A;  3HMJ G;  1UMW A;  1FSU A;  4G7N A;  4HY2 A;  4O56 A;  5J19 A;  5DNJ A;  1AUK A;  5DMS A;  4H71 A;  2VKZ G;  3FS3 A;  3ED4 A;  1HDH A; 
#chains in the Genus database with same CATH homology
 2IA9 A;  2I9Z A;  2I9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...