2IA9A

Structural genomics, the crystal structure of spovg from bacillus subtilis subsp. subtilis str. 168
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
b'NAMEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDITHPINSSTRGKIQDAVLNEYHRLGDTEALEFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative septation protein spoVG
publication title The crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 18
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04026 SpoVG SpoVG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.40 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Stage V sporulation protein G 2ia9A00
2I9ZA 2IA9A 2I9XA
chains in the Genus database with same CATH superfamily
4X9VA 4LKMA 1E33P 4CXKA 5DAYA 5DMVC 3HMJG 4O6WA 2OGQA 2QZUA 1Q4KA 4N9JA 1P49A 1N2LA 3ED4A 3P2WA 4XB0A 4CYRA 4FDIA 2VKZG 4RCPA 1Q4OA 3FS3A 1F32A 2OJXA 4CYSA 4O9WA 1N2KA 3P2ZA 4WHKA 5LHZA 4G7NA 3P34A 3GYWA 4WHLA 1HDHA 1UMWA 4HABA 4HCOA 5DMSA 1E1ZP 5AJ9A 4YYPA 4HY2A 1E2SP 3Q1IA 3GYVA 1F34B 2IA9A 3HIKA 3FVHA 3LM3A 4N7VA 4H71A 3P35A 1FSUA 4LKLA 2N19A 4DFWA 4J7BB 1E3CP 4NK7A 3HFDA 3C5LA 4NKBA 1E2TA 3P36A 3RQ7A 4FDJA 4O56A 3LXQA 4WHHA 4X9WA 3HIHA 4H5XA 4E67A 4X9RA 4E9DA 2E50A 3KDRA 4E9CA 5J19A 4CXSA 3P37A 4RS6A 2UV8G 2I9ZA 1AUKA 4CXUA 4N7ZA 1A87A 5DNJA 2I9XA 3BZIA
chains in the Genus database with same CATH topology
2I9ZA 2IA9A 2I9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9Z A;  2IA9 A;  2I9X A; 
#chains in the Genus database with same CATH topology
 4X9V A;  4LKM A;  1E33 P;  4CXK A;  5DAY A;  5DMV C;  3HMJ G;  4O6W A;  2OGQ A;  2QZU A;  1Q4K A;  4N9J A;  1P49 A;  1N2L A;  3ED4 A;  3P2W A;  4XB0 A;  4CYR A;  4FDI A;  2VKZ G;  4RCP A;  1Q4O A;  3FS3 A;  1F32 A;  2OJX A;  4CYS A;  4O9W A;  1N2K A;  3P2Z A;  4WHK A;  5LHZ A;  4G7N A;  3P34 A;  3GYW A;  4WHL A;  1HDH A;  1UMW A;  4HAB A;  4HCO A;  5DMS A;  1E1Z P;  5AJ9 A;  4YYP A;  4HY2 A;  1E2S P;  3Q1I A;  3GYV A;  1F34 B;  2IA9 A;  3HIK A;  3FVH A;  3LM3 A;  4N7V A;  4H71 A;  3P35 A;  1FSU A;  4LKL A;  2N19 A;  4DFW A;  4J7B B;  1E3C P;  4NK7 A;  3HFD A;  3C5L A;  4NKB A;  1E2T A;  3P36 A;  3RQ7 A;  4FDJ A;  4O56 A;  3LXQ A;  4WHH A;  4X9W A;  3HIH A;  4H5X A;  4E67 A;  4X9R A;  4E9D A;  2E50 A;  3KDR A;  4E9C A;  5J19 A;  4CXS A;  3P37 A;  4RS6 A;  2UV8 G;  2I9Z A;  1AUK A;  4CXU A;  4N7Z A;  1A87 A;  5DNJ A;  2I9X A;  3BZI A; 
#chains in the Genus database with same CATH homology
 2I9Z A;  2IA9 A;  2I9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...