2IA9A

Structural genomics, the crystal structure of spovg from bacillus subtilis subsp. subtilis str. 168
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
NAMEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDITHPINSSTRGKIQDAVLNEYHRLGDTEALEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative septation protein spoVG
publication title The crystal structure of SpoVG from Bacillus subtilis subsp. subtilis str. 168
rcsb
source organism Bacillus subtilis
total genus 18
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04026 SpoVG SpoVG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.40 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Stage V sporulation protein G 2ia9A00
2I9ZA 2I9XA 2IA9A
chains in the Genus database with same CATH superfamily
4CYSA 3HIKA 4E67A 2N19A 4H5XA 4CYRA 4HCOA 3HFDA 4WHLA 3HMJG 4WHHA 3HIHA 2UV8G 3P2WA 1UMWA 5DNJA 4O6WA 4HABA 4N7ZA 4O56A 4FDIA 3GYWA 2QZUA 3LXQA 4N7VA 4RCPA 5DMVC 4RS6A 2I9ZA 1E2TA 4YYPA 1F34B 3ED4A 3P35A 4N9JA 3P37A 3GYVA 1HDHA 2E50A 1N2KA 4NKBA 5LHZA 4CXUA 4HY2A 1E1ZP 3KDRA 1FSUA 2IA9A 4X9WA 5DMSA 3P34A 4X9RA 2OGQA 5J19A 1E3CP 3Q1IA 4E9CA 2OJXA 1E2SP 4CXKA 4E9DA 4LKMA 1AUKA 2I9XA 3FS3A 1E33P 3RQ7A 1Q4OA 3BZIA 4LKLA 1F32A 3P2ZA 1P49A 4WHKA 1A87A 5AJ9A 1Q4KA 4NK7A 2VKZG 4H71A 3LM3A 1N2LA 5DAYA 4XB0A 4DFWA 4X9VA 3FVHA 4J7BB 3C5LA 4O9WA 4CXSA 3P36A 4G7NA 4FDJA
chains in the Genus database with same CATH topology
2I9ZA 2I9XA 2IA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9Z A;  2I9X A;  2IA9 A; 
#chains in the Genus database with same CATH topology
 4CYS A;  3HIK A;  4E67 A;  2N19 A;  4H5X A;  4CYR A;  4HCO A;  3HFD A;  4WHL A;  3HMJ G;  4WHH A;  3HIH A;  2UV8 G;  3P2W A;  1UMW A;  5DNJ A;  4O6W A;  4HAB A;  4N7Z A;  4O56 A;  4FDI A;  3GYW A;  2QZU A;  3LXQ A;  4N7V A;  4RCP A;  5DMV C;  4RS6 A;  2I9Z A;  1E2T A;  4YYP A;  1F34 B;  3ED4 A;  3P35 A;  4N9J A;  3P37 A;  3GYV A;  1HDH A;  2E50 A;  1N2K A;  4NKB A;  5LHZ A;  4CXU A;  4HY2 A;  1E1Z P;  3KDR A;  1FSU A;  2IA9 A;  4X9W A;  5DMS A;  3P34 A;  4X9R A;  2OGQ A;  5J19 A;  1E3C P;  3Q1I A;  4E9C A;  2OJX A;  1E2S P;  4CXK A;  4E9D A;  4LKM A;  1AUK A;  2I9X A;  3FS3 A;  1E33 P;  3RQ7 A;  1Q4O A;  3BZI A;  4LKL A;  1F32 A;  3P2Z A;  1P49 A;  4WHK A;  1A87 A;  5AJ9 A;  1Q4K A;  4NK7 A;  2VKZ G;  4H71 A;  3LM3 A;  1N2L A;  5DAY A;  4XB0 A;  4DFW A;  4X9V A;  3FVH A;  4J7B B;  3C5L A;  4O9W A;  4CXS A;  3P36 A;  4G7N A;  4FDJ A; 
#chains in the Genus database with same CATH homology
 2I9Z A;  2I9X A;  2IA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...