5LHZA

Pb3 domain of human plk4 in complex with coiled-coil domain of stil
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
78
Chain Sequence
QLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A key centriole assembly interaction interface between human PLK4 and STIL appears to not be conserved in flies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Serine/threonine-protein kinase PLK4
total genus 18
structure length 78
sequence length 78
chains with identical sequence B, C
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 5lhzA00
4WHHA 4WHKA 3HIKA 5DMVC 4X9WA 4O6WA 5DMSA 3FVHA 4YYPA 4WHLA 1Q4OA 4X9VA 4H71A 4HABA 4HCOA 1UMWA 4DFWA 3P36A 4E9CA 4XB0A 4E67A 3P2WA 4O56A 5J19A 4LKLA 3BZIA 2N19A 4LKMA 3P35A 4X9RA 2OJXA 4J7BB 3RQ7A 4RCPA 3HIHA 4O9WA 3Q1IA 5LHZA 3C5LA 3P37A 4E9DA 4RS6A 3P34A 5DNJA 4HY2A 2OGQA 3P2ZA 1Q4KA 4H5XA
chains in the Genus database with same CATH superfamily
4WHKA 5DAYA 5DMSA 4YYPA 1FSUA 2UV8G 4NK7A 4WHLA 1Q4OA 4X9VA 1HDHA 2QZUA 3P2WA 5J19A 4CYSA 1AUKA 3BZIA 4CXUA 1E33P 3P35A 3GYVA 2I9XA 4O9WA 4N9JA 3P2ZA 5DMVC 3HFDA 3LM3A 4FDJA 4G7NA 1P49A 4N7VA 4HABA 4CXKA 4XB0A 4O56A 4NKBA 2N19A 2OJXA 4J7BB 4RCPA 3HIHA 3Q1IA 5LHZA 4E9DA 4CXSA 3P34A 4CYRA 2OGQA 4H5XA 4WHHA 2IA9A 1N2KA 4X9WA 1F32A 3LXQA 1E2TA 3KDRA 1UMWA 3ED4A 3FS3A 1E3CP 4X9RA 4N7ZA 4FDIA 3C5LA 3P37A 5AJ9A 5DNJA 4HY2A 1Q4KA 3HIKA 2I9ZA 4O6WA 1A87A 3FVHA 3GYWA 4H71A 2VKZG 4HCOA 4DFWA 3P36A 4E9CA 4E67A 4LKLA 1N2LA 4LKMA 3RQ7A 1E1ZP 2E50A 1E2SP 4RS6A 1F34B 3HMJG
chains in the Genus database with same CATH topology
4WHHA 4WHKA 3HIKA 5DMVC 4X9WA 4O6WA 5DMSA 3FVHA 4YYPA 4WHLA 1Q4OA 4X9VA 4H71A 4HABA 4HCOA 1UMWA 4DFWA 3P36A 4E9CA 4XB0A 4E67A 3P2WA 4O56A 5J19A 4LKLA 3BZIA 2N19A 4LKMA 3P35A 4X9RA 2OJXA 4J7BB 3RQ7A 4RCPA 3HIHA 4O9WA 3Q1IA 5LHZA 3C5LA 3P37A 4E9DA 4RS6A 3P34A 5DNJA 4HY2A 2OGQA 3P2ZA 1Q4KA 4H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHH A;  4WHK A;  3HIK A;  5DMV C;  4X9W A;  4O6W A;  5DMS A;  3FVH A;  4YYP A;  4WHL A;  1Q4O A;  4X9V A;  4H71 A;  4HAB A;  4HCO A;  1UMW A;  4DFW A;  3P36 A;  4E9C A;  4XB0 A;  4E67 A;  3P2W A;  4O56 A;  5J19 A;  4LKL A;  3BZI A;  2N19 A;  4LKM A;  3P35 A;  4X9R A;  2OJX A;  4J7B B;  3RQ7 A;  4RCP A;  3HIH A;  4O9W A;  3Q1I A;  5LHZ A;  3C5L A;  3P37 A;  4E9D A;  4RS6 A;  3P34 A;  5DNJ A;  4HY2 A;  2OGQ A;  3P2Z A;  1Q4K A;  4H5X A; 
#chains in the Genus database with same CATH topology
 4WHK A;  5DAY A;  5DMS A;  4YYP A;  1FSU A;  2UV8 G;  4NK7 A;  4WHL A;  1Q4O A;  4X9V A;  1HDH A;  2QZU A;  3P2W A;  5J19 A;  4CYS A;  1AUK A;  3BZI A;  4CXU A;  1E33 P;  3P35 A;  3GYV A;  2I9X A;  4O9W A;  4N9J A;  3P2Z A;  5DMV C;  3HFD A;  3LM3 A;  4FDJ A;  4G7N A;  1P49 A;  4N7V A;  4HAB A;  4CXK A;  4XB0 A;  4O56 A;  4NKB A;  2N19 A;  2OJX A;  4J7B B;  4RCP A;  3HIH A;  3Q1I A;  5LHZ A;  4E9D A;  4CXS A;  3P34 A;  4CYR A;  2OGQ A;  4H5X A;  4WHH A;  2IA9 A;  1N2K A;  4X9W A;  1F32 A;  3LXQ A;  1E2T A;  3KDR A;  1UMW A;  3ED4 A;  3FS3 A;  1E3C P;  4X9R A;  4N7Z A;  4FDI A;  3C5L A;  3P37 A;  5AJ9 A;  5DNJ A;  4HY2 A;  1Q4K A;  3HIK A;  2I9Z A;  4O6W A;  1A87 A;  3FVH A;  3GYW A;  4H71 A;  2VKZ G;  4HCO A;  4DFW A;  3P36 A;  4E9C A;  4E67 A;  4LKL A;  1N2L A;  4LKM A;  3RQ7 A;  1E1Z P;  2E50 A;  1E2S P;  4RS6 A;  1F34 B;  3HMJ G; 
#chains in the Genus database with same CATH homology
 4WHH A;  4WHK A;  3HIK A;  5DMV C;  4X9W A;  4O6W A;  5DMS A;  3FVH A;  4YYP A;  4WHL A;  1Q4O A;  4X9V A;  4H71 A;  4HAB A;  4HCO A;  1UMW A;  4DFW A;  3P36 A;  4E9C A;  4XB0 A;  4E67 A;  3P2W A;  4O56 A;  5J19 A;  4LKL A;  3BZI A;  2N19 A;  4LKM A;  3P35 A;  4X9R A;  2OJX A;  4J7B B;  3RQ7 A;  4RCP A;  3HIH A;  4O9W A;  3Q1I A;  5LHZ A;  3C5L A;  3P37 A;  4E9D A;  4RS6 A;  3P34 A;  5DNJ A;  4HY2 A;  2OGQ A;  3P2Z A;  1Q4K A;  4H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...