5LHZA

Pb3 domain of human plk4 in complex with coiled-coil domain of stil
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
78
Chain Sequence
QLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK4
publication title A key centriole assembly interaction interface between human PLK4 and STIL appears to not be conserved in flies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 18
structure length 78
sequence length 78
chains with identical sequence B, C
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 5lhzA00
4LKMA 5DMVC 4X9WA 3HIKA 3P37A 3Q1IA 4J7BB 2OGQA 1UMWA 3P35A 4RS6A 4E67A 3BZIA 2N19A 1Q4KA 4WHLA 3P34A 4WHKA 4XB0A 4O9WA 4E9DA 5DNJA 4O6WA 1Q4OA 2OJXA 4WHHA 4HCOA 5DMSA 3RQ7A 4DFWA 4X9RA 5J19A 3P2ZA 4H5XA 4O56A 3HIHA 4YYPA 4E9CA 4H71A 4RCPA 4HABA 3FVHA 4X9VA 4HY2A 3C5LA 3P2WA 5LHZA 3P36A 4LKLA
chains in the Genus database with same CATH superfamily
4LKMA 5DMVC 2IA9A 4X9WA 3HIKA 4CXSA 5AJ9A 4FDJA 1UMWA 3P35A 3BZIA 4WHLA 3P34A 4O9WA 2OJXA 4DFWA 5J19A 4O56A 4YYPA 3ED4A 1E2SP 2UV8G 4X9VA 1HDHA 4CYSA 3Q1IA 4NK7A 4RS6A 4G7NA 4NKBA 4N7ZA 4E9DA 3HFDA 3P36A 4HCOA 3FS3A 1E33P 1FSUA 4RCPA 4N9JA 4CYRA 3P2WA 2I9ZA 3HMJG 4CXUA 3GYVA 2I9XA 1N2KA 3GYWA 4J7BB 4E67A 1E3CP 1Q4KA 1F34B 4XB0A 1AUKA 4O6WA 1P49A 4WHHA 1N2LA 5DMSA 3P2ZA 4H5XA 3HIHA 4HABA 1A87A 4CXKA 2QZUA 5DAYA 3P37A 2OGQA 2VKZG 2E50A 2N19A 4WHKA 5DNJA 1Q4OA 3RQ7A 4X9RA 3LXQA 4E9CA 1E2TA 4N7VA 4H71A 1F32A 3FVHA 3KDRA 3LM3A 1E1ZP 3C5LA 4HY2A 5LHZA 4FDIA 4LKLA
chains in the Genus database with same CATH topology
4LKMA 5DMVC 4X9WA 3HIKA 3P37A 3Q1IA 4J7BB 2OGQA 1UMWA 3P35A 4RS6A 4E67A 3BZIA 2N19A 1Q4KA 4WHLA 3P34A 4WHKA 4XB0A 4O9WA 4E9DA 5DNJA 4O6WA 1Q4OA 2OJXA 4WHHA 4HCOA 5DMSA 3RQ7A 4DFWA 4X9RA 5J19A 3P2ZA 4H5XA 4O56A 3HIHA 4YYPA 4E9CA 4H71A 4RCPA 4HABA 3FVHA 4X9VA 4HY2A 3C5LA 3P2WA 5LHZA 3P36A 4LKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LKM A;  5DMV C;  4X9W A;  3HIK A;  3P37 A;  3Q1I A;  4J7B B;  2OGQ A;  1UMW A;  3P35 A;  4RS6 A;  4E67 A;  3BZI A;  2N19 A;  1Q4K A;  4WHL A;  3P34 A;  4WHK A;  4XB0 A;  4O9W A;  4E9D A;  5DNJ A;  4O6W A;  1Q4O A;  2OJX A;  4WHH A;  4HCO A;  5DMS A;  3RQ7 A;  4DFW A;  4X9R A;  5J19 A;  3P2Z A;  4H5X A;  4O56 A;  3HIH A;  4YYP A;  4E9C A;  4H71 A;  4RCP A;  4HAB A;  3FVH A;  4X9V A;  4HY2 A;  3C5L A;  3P2W A;  5LHZ A;  3P36 A;  4LKL A; 
#chains in the Genus database with same CATH topology
 4LKM A;  5DMV C;  2IA9 A;  4X9W A;  3HIK A;  4CXS A;  5AJ9 A;  4FDJ A;  1UMW A;  3P35 A;  3BZI A;  4WHL A;  3P34 A;  4O9W A;  2OJX A;  4DFW A;  5J19 A;  4O56 A;  4YYP A;  3ED4 A;  1E2S P;  2UV8 G;  4X9V A;  1HDH A;  4CYS A;  3Q1I A;  4NK7 A;  4RS6 A;  4G7N A;  4NKB A;  4N7Z A;  4E9D A;  3HFD A;  3P36 A;  4HCO A;  3FS3 A;  1E33 P;  1FSU A;  4RCP A;  4N9J A;  4CYR A;  3P2W A;  2I9Z A;  3HMJ G;  4CXU A;  3GYV A;  2I9X A;  1N2K A;  3GYW A;  4J7B B;  4E67 A;  1E3C P;  1Q4K A;  1F34 B;  4XB0 A;  1AUK A;  4O6W A;  1P49 A;  4WHH A;  1N2L A;  5DMS A;  3P2Z A;  4H5X A;  3HIH A;  4HAB A;  1A87 A;  4CXK A;  2QZU A;  5DAY A;  3P37 A;  2OGQ A;  2VKZ G;  2E50 A;  2N19 A;  4WHK A;  5DNJ A;  1Q4O A;  3RQ7 A;  4X9R A;  3LXQ A;  4E9C A;  1E2T A;  4N7V A;  4H71 A;  1F32 A;  3FVH A;  3KDR A;  3LM3 A;  1E1Z P;  3C5L A;  4HY2 A;  5LHZ A;  4FDI A;  4LKL A; 
#chains in the Genus database with same CATH homology
 4LKM A;  5DMV C;  4X9W A;  3HIK A;  3P37 A;  3Q1I A;  4J7B B;  2OGQ A;  1UMW A;  3P35 A;  4RS6 A;  4E67 A;  3BZI A;  2N19 A;  1Q4K A;  4WHL A;  3P34 A;  4WHK A;  4XB0 A;  4O9W A;  4E9D A;  5DNJ A;  4O6W A;  1Q4O A;  2OJX A;  4WHH A;  4HCO A;  5DMS A;  3RQ7 A;  4DFW A;  4X9R A;  5J19 A;  3P2Z A;  4H5X A;  4O56 A;  3HIH A;  4YYP A;  4E9C A;  4H71 A;  4RCP A;  4HAB A;  3FVH A;  4X9V A;  4HY2 A;  3C5L A;  3P2W A;  5LHZ A;  3P36 A;  4LKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...