5LHZA

Pb3 domain of human plk4 in complex with coiled-coil domain of stil
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
78
Chain Sequence
QLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Serine/threonine-protein kinase PLK4
publication title A key centriole assembly interaction interface between human PLK4 and STIL appears to not be conserved in flies.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 78
sequence length 78
chains with identical sequence B, C
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 5lhzA00
4O9WA 3P35A 3P34A 4X9RA 3BZIA 4WHHA 5DMSA 3P2ZA 4WHLA 4X9WA 1UMWA 4E9CA 3C5LA 2OJXA 3HIHA 4HCOA 5DNJA 4HY2A 4LKLA 1Q4KA 4LKMA 3RQ7A 5J19A 3FVHA 3P2WA 2OGQA 4RCPA 5DMVC 5LHZA 3Q1IA 4WHKA 2N19A 4E67A 4X9VA 3P37A 4J7BB 1Q4OA 4O56A 4HABA 4XB0A 4YYPA 4H5XA 4O6WA 4E9DA 3HIKA 4H71A 4RS6A 3P36A 4DFWA
chains in the Genus database with same CATH superfamily
5DAYA 4O9WA 3P35A 3P34A 4WHHA 1E1ZP 3GYVA 2VKZG 3P2ZA 4WHLA 3HFDA 2I9XA 1E33P 1E2SP 3ED4A 3RQ7A 1F34B 5J19A 2OGQA 5DMVC 4HABA 4FDJA 1N2KA 4O56A 2I9ZA 1FSUA 4X9RA 3LXQA 4CXKA 4X9WA 1E3CP 4HCOA 2IA9A 4LKMA 3P2WA 5LHZA 3Q1IA 4E67A 1P49A 5AJ9A 3P37A 3HMJG 4XB0A 4E9DA 3HIKA 4H71A 4RS6A 3P36A 2UV8G 4NK7A 1UMWA 4CXSA 2OJXA 4CYSA 4HY2A 3FVHA 4X9VA 4N9JA 4J7BB 4YYPA 3GYWA 1Q4OA 1E2TA 3BZIA 5DMSA 3FS3A 4N7VA 4CXUA 4E9CA 3C5LA 1HDHA 1A87A 3LM3A 3HIHA 4NKBA 5DNJA 1Q4KA 1N2LA 4RCPA 4FDIA 1F32A 4N7ZA 4G7NA 4WHKA 2N19A 4H5XA 4O6WA 2E50A 1AUKA 4LKLA 4CYRA 2QZUA 4DFWA 3KDRA
chains in the Genus database with same CATH topology
4O9WA 3P35A 3P34A 4X9RA 3BZIA 4WHHA 5DMSA 3P2ZA 4WHLA 4X9WA 1UMWA 4E9CA 3C5LA 2OJXA 3HIHA 4HCOA 5DNJA 4HY2A 4LKLA 1Q4KA 4LKMA 3RQ7A 5J19A 3FVHA 3P2WA 2OGQA 4RCPA 5DMVC 5LHZA 3Q1IA 4WHKA 2N19A 4E67A 4X9VA 3P37A 4J7BB 1Q4OA 4O56A 4HABA 4XB0A 4YYPA 4H5XA 4O6WA 4E9DA 3HIKA 4H71A 4RS6A 3P36A 4DFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O9W A;  3P35 A;  3P34 A;  4X9R A;  3BZI A;  4WHH A;  5DMS A;  3P2Z A;  4WHL A;  4X9W A;  1UMW A;  4E9C A;  3C5L A;  2OJX A;  3HIH A;  4HCO A;  5DNJ A;  4HY2 A;  4LKL A;  1Q4K A;  4LKM A;  3RQ7 A;  5J19 A;  3FVH A;  3P2W A;  2OGQ A;  4RCP A;  5DMV C;  5LHZ A;  3Q1I A;  4WHK A;  2N19 A;  4E67 A;  4X9V A;  3P37 A;  4J7B B;  1Q4O A;  4O56 A;  4HAB A;  4XB0 A;  4YYP A;  4H5X A;  4O6W A;  4E9D A;  3HIK A;  4H71 A;  4RS6 A;  3P36 A;  4DFW A; 
#chains in the Genus database with same CATH topology
 5DAY A;  4O9W A;  3P35 A;  3P34 A;  4WHH A;  1E1Z P;  3GYV A;  2VKZ G;  3P2Z A;  4WHL A;  3HFD A;  2I9X A;  1E33 P;  1E2S P;  3ED4 A;  3RQ7 A;  1F34 B;  5J19 A;  2OGQ A;  5DMV C;  4HAB A;  4FDJ A;  1N2K A;  4O56 A;  2I9Z A;  1FSU A;  4X9R A;  3LXQ A;  4CXK A;  4X9W A;  1E3C P;  4HCO A;  2IA9 A;  4LKM A;  3P2W A;  5LHZ A;  3Q1I A;  4E67 A;  1P49 A;  5AJ9 A;  3P37 A;  3HMJ G;  4XB0 A;  4E9D A;  3HIK A;  4H71 A;  4RS6 A;  3P36 A;  2UV8 G;  4NK7 A;  1UMW A;  4CXS A;  2OJX A;  4CYS A;  4HY2 A;  3FVH A;  4X9V A;  4N9J A;  4J7B B;  4YYP A;  3GYW A;  1Q4O A;  1E2T A;  3BZI A;  5DMS A;  3FS3 A;  4N7V A;  4CXU A;  4E9C A;  3C5L A;  1HDH A;  1A87 A;  3LM3 A;  3HIH A;  4NKB A;  5DNJ A;  1Q4K A;  1N2L A;  4RCP A;  4FDI A;  1F32 A;  4N7Z A;  4G7N A;  4WHK A;  2N19 A;  4H5X A;  4O6W A;  2E50 A;  1AUK A;  4LKL A;  4CYR A;  2QZU A;  4DFW A;  3KDR A; 
#chains in the Genus database with same CATH homology
 4O9W A;  3P35 A;  3P34 A;  4X9R A;  3BZI A;  4WHH A;  5DMS A;  3P2Z A;  4WHL A;  4X9W A;  1UMW A;  4E9C A;  3C5L A;  2OJX A;  3HIH A;  4HCO A;  5DNJ A;  4HY2 A;  4LKL A;  1Q4K A;  4LKM A;  3RQ7 A;  5J19 A;  3FVH A;  3P2W A;  2OGQ A;  4RCP A;  5DMV C;  5LHZ A;  3Q1I A;  4WHK A;  2N19 A;  4E67 A;  4X9V A;  3P37 A;  4J7B B;  1Q4O A;  4O56 A;  4HAB A;  4XB0 A;  4YYP A;  4H5X A;  4O6W A;  4E9D A;  3HIK A;  4H71 A;  4RS6 A;  3P36 A;  4DFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...