3P2ZA

Polo-like kinase i polo-box domain in complex with plhspta phosphopeptide from pbip1
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
210
Chain Sequence
SPEFDCHLSDMLQQLHSVEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 210
sequence length 227
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2zA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2zA01
4E9CA 4HY2A 3FVHA 1Q4KA 3P37A 3HIKA 2N19A 3HIHA 4H5XA 4X9WA 4LKLA 3P35A 4HCOA 4RS6A 4E67A 2OGQA 4O9WA 3BZIA 1Q4OA 2OJXA 3P2WA 3P34A 3P2ZA 5LHZA 4X9RA 4J7BB 4O56A 4E9DA 3P36A 4X9VA 3Q1IA 4YYPA 4WHHA 1UMWA 5DNJA 3C5LA 4WHKA 5DMVC 4LKMA 3RQ7A 4H71A 5J19A 4WHLA 4O6WA 4XB0A 5DMSA 4HABA 4DFWA 4RCPA
chains in the Genus database with same CATH superfamily
4E9CA 1F34B 4X9WA 4FDIA 4HCOA 4E67A 4O9WA 3BZIA 3P2WA 5LHZA 4E9DA 4CXSA 1AUKA 2E50A 4NKBA 5AJ9A 4XB0A 4CXUA 3ED4A 3HMJG 3FVHA 1Q4KA 3P37A 3HIKA 3GYVA 2N19A 3LXQA 4N7ZA 1Q4OA 3P34A 4X9RA 4J7BB 3P36A 4G7NA 5DNJA 1HDHA 4WHKA 1N2LA 3RQ7A 4CYSA 1E3CP 3LM3A 1F32A 4O6WA 3HFDA 3FS3A 4HABA 4RCPA 4HY2A 3GYWA 3HIHA 4H5XA 2UV8G 4LKLA 1E1ZP 4RS6A 1N2KA 2OJXA 1FSUA 4O56A 3Q1IA 4N7VA 4WHHA 4FDJA 3C5LA 5J19A 2VKZG 4WHLA 4CXKA 4DFWA 4NK7A 1E33P 1E2TA 3P35A 2OGQA 1P49A 3P2ZA 2I9XA 2IA9A 4X9VA 4YYPA 4CYRA 1UMWA 4N9JA 5DAYA 5DMVC 4LKMA 4H71A 1A87A 3KDRA 1E2SP 2QZUA 5DMSA 2I9ZA
chains in the Genus database with same CATH topology
4E9CA 4HY2A 3FVHA 1Q4KA 3P37A 3HIKA 2N19A 3HIHA 4H5XA 4X9WA 4LKLA 3P35A 4HCOA 4RS6A 4E67A 2OGQA 4O9WA 3BZIA 1Q4OA 2OJXA 3P2WA 3P34A 3P2ZA 5LHZA 4X9RA 4J7BB 4O56A 4E9DA 3P36A 4X9VA 3Q1IA 4YYPA 4WHHA 1UMWA 5DNJA 3C5LA 4WHKA 5DMVC 4LKMA 3RQ7A 4H71A 5J19A 4WHLA 4O6WA 4XB0A 5DMSA 4HABA 4DFWA 4RCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E9C A;  4HY2 A;  3FVH A;  1Q4K A;  3P37 A;  3HIK A;  2N19 A;  3HIH A;  4H5X A;  4X9W A;  4LKL A;  3P35 A;  4HCO A;  4RS6 A;  4E67 A;  2OGQ A;  4O9W A;  3BZI A;  1Q4O A;  2OJX A;  3P2W A;  3P34 A;  3P2Z A;  5LHZ A;  4X9R A;  4J7B B;  4O56 A;  4E9D A;  3P36 A;  4X9V A;  3Q1I A;  4YYP A;  4WHH A;  1UMW A;  5DNJ A;  3C5L A;  4WHK A;  5DMV C;  4LKM A;  3RQ7 A;  4H71 A;  5J19 A;  4WHL A;  4O6W A;  4XB0 A;  5DMS A;  4HAB A;  4DFW A;  4RCP A; 
#chains in the Genus database with same CATH topology
 4E9C A;  1F34 B;  4X9W A;  4FDI A;  4HCO A;  4E67 A;  4O9W A;  3BZI A;  3P2W A;  5LHZ A;  4E9D A;  4CXS A;  1AUK A;  2E50 A;  4NKB A;  5AJ9 A;  4XB0 A;  4CXU A;  3ED4 A;  3HMJ G;  3FVH A;  1Q4K A;  3P37 A;  3HIK A;  3GYV A;  2N19 A;  3LXQ A;  4N7Z A;  1Q4O A;  3P34 A;  4X9R A;  4J7B B;  3P36 A;  4G7N A;  5DNJ A;  1HDH A;  4WHK A;  1N2L A;  3RQ7 A;  4CYS A;  1E3C P;  3LM3 A;  1F32 A;  4O6W A;  3HFD A;  3FS3 A;  4HAB A;  4RCP A;  4HY2 A;  3GYW A;  3HIH A;  4H5X A;  2UV8 G;  4LKL A;  1E1Z P;  4RS6 A;  1N2K A;  2OJX A;  1FSU A;  4O56 A;  3Q1I A;  4N7V A;  4WHH A;  4FDJ A;  3C5L A;  5J19 A;  2VKZ G;  4WHL A;  4CXK A;  4DFW A;  4NK7 A;  1E33 P;  1E2T A;  3P35 A;  2OGQ A;  1P49 A;  3P2Z A;  2I9X A;  2IA9 A;  4X9V A;  4YYP A;  4CYR A;  1UMW A;  4N9J A;  5DAY A;  5DMV C;  4LKM A;  4H71 A;  1A87 A;  3KDR A;  1E2S P;  2QZU A;  5DMS A;  2I9Z A; 
#chains in the Genus database with same CATH homology
 4E9C A;  4HY2 A;  3FVH A;  1Q4K A;  3P37 A;  3HIK A;  2N19 A;  3HIH A;  4H5X A;  4X9W A;  4LKL A;  3P35 A;  4HCO A;  4RS6 A;  4E67 A;  2OGQ A;  4O9W A;  3BZI A;  1Q4O A;  2OJX A;  3P2W A;  3P34 A;  3P2Z A;  5LHZ A;  4X9R A;  4J7B B;  4O56 A;  4E9D A;  3P36 A;  4X9V A;  3Q1I A;  4YYP A;  4WHH A;  1UMW A;  5DNJ A;  3C5L A;  4WHK A;  5DMV C;  4LKM A;  3RQ7 A;  4H71 A;  5J19 A;  4WHL A;  4O6W A;  4XB0 A;  5DMS A;  4HAB A;  4DFW A;  4RCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...