3P2ZA

Polo-like kinase i polo-box domain in complex with plhspta phosphopeptide from pbip1
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
210
Chain Sequence
SPEFDCHLSDMLQQLHSVEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 210
sequence length 227
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2zA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2zA01
4XB0A 3P37A 4WHHA 4X9RA 3P34A 5DMSA 3C5LA 2OGQA 2N19A 3RQ7A 1Q4KA 4O6WA 3P2ZA 3FVHA 4E67A 4HY2A 4O9WA 1UMWA 2OJXA 3P2WA 4HABA 1Q4OA 4X9VA 3HIKA 3Q1IA 4J7BB 4RS6A 4E9DA 4LKMA 4E9CA 4DFWA 3P35A 3P36A 4X9WA 3HIHA 4LKLA 4H71A 5J19A 5DNJA 5DMVC 3BZIA 5LHZA 4YYPA 4WHKA 4RCPA 4HCOA 4O56A 4WHLA 4H5XA
chains in the Genus database with same CATH superfamily
2IA9A 4X9RA 4O6WA 3KDRA 1UMWA 3P2WA 2I9ZA 3HIKA 3Q1IA 4RS6A 4E9DA 4CYSA 1F34B 5DNJA 5DMVC 1P49A 3BZIA 5LHZA 4RCPA 4CXUA 3LXQA 1E3CP 1A87A 5DMSA 4G7NA 4FDJA 3ED4A 3P2ZA 3GYWA 2VKZG 4HY2A 4O9WA 2OJXA 4E9CA 1E2TA 1HDHA 3FS3A 4N7ZA 1E2SP 3LM3A 4O56A 4CXKA 4WHLA 4FDIA 2OGQA 2N19A 1Q4KA 3FVHA 1E33P 1N2LA 4J7BB 4DFWA 3P35A 3P36A 4X9WA 3HIHA 4N9JA 4LKLA 1N2KA 4H71A 1F32A 3GYVA 4NKBA 4YYPA 4CXSA 4HCOA 4H5XA 4XB0A 2E50A 3P37A 4WHHA 3P34A 2QZUA 4N7VA 3C5LA 3RQ7A 1AUKA 4NK7A 1E1ZP 5AJ9A 4E67A 5DAYA 4HABA 4X9VA 1Q4OA 1FSUA 3HFDA 4LKMA 3HMJG 4CYRA 2I9XA 5J19A 4WHKA 2UV8G
chains in the Genus database with same CATH topology
4XB0A 3P37A 4WHHA 4X9RA 3P34A 5DMSA 3C5LA 2OGQA 2N19A 3RQ7A 1Q4KA 4O6WA 3P2ZA 3FVHA 4E67A 4HY2A 4O9WA 1UMWA 2OJXA 3P2WA 4HABA 1Q4OA 4X9VA 3HIKA 3Q1IA 4J7BB 4RS6A 4E9DA 4LKMA 4E9CA 4DFWA 3P35A 3P36A 4X9WA 3HIHA 4LKLA 4H71A 5J19A 5DNJA 5DMVC 3BZIA 5LHZA 4YYPA 4WHKA 4RCPA 4HCOA 4O56A 4WHLA 4H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XB0 A;  3P37 A;  4WHH A;  4X9R A;  3P34 A;  5DMS A;  3C5L A;  2OGQ A;  2N19 A;  3RQ7 A;  1Q4K A;  4O6W A;  3P2Z A;  3FVH A;  4E67 A;  4HY2 A;  4O9W A;  1UMW A;  2OJX A;  3P2W A;  4HAB A;  1Q4O A;  4X9V A;  3HIK A;  3Q1I A;  4J7B B;  4RS6 A;  4E9D A;  4LKM A;  4E9C A;  4DFW A;  3P35 A;  3P36 A;  4X9W A;  3HIH A;  4LKL A;  4H71 A;  5J19 A;  5DNJ A;  5DMV C;  3BZI A;  5LHZ A;  4YYP A;  4WHK A;  4RCP A;  4HCO A;  4O56 A;  4WHL A;  4H5X A; 
#chains in the Genus database with same CATH topology
 2IA9 A;  4X9R A;  4O6W A;  3KDR A;  1UMW A;  3P2W A;  2I9Z A;  3HIK A;  3Q1I A;  4RS6 A;  4E9D A;  4CYS A;  1F34 B;  5DNJ A;  5DMV C;  1P49 A;  3BZI A;  5LHZ A;  4RCP A;  4CXU A;  3LXQ A;  1E3C P;  1A87 A;  5DMS A;  4G7N A;  4FDJ A;  3ED4 A;  3P2Z A;  3GYW A;  2VKZ G;  4HY2 A;  4O9W A;  2OJX A;  4E9C A;  1E2T A;  1HDH A;  3FS3 A;  4N7Z A;  1E2S P;  3LM3 A;  4O56 A;  4CXK A;  4WHL A;  4FDI A;  2OGQ A;  2N19 A;  1Q4K A;  3FVH A;  1E33 P;  1N2L A;  4J7B B;  4DFW A;  3P35 A;  3P36 A;  4X9W A;  3HIH A;  4N9J A;  4LKL A;  1N2K A;  4H71 A;  1F32 A;  3GYV A;  4NKB A;  4YYP A;  4CXS A;  4HCO A;  4H5X A;  4XB0 A;  2E50 A;  3P37 A;  4WHH A;  3P34 A;  2QZU A;  4N7V A;  3C5L A;  3RQ7 A;  1AUK A;  4NK7 A;  1E1Z P;  5AJ9 A;  4E67 A;  5DAY A;  4HAB A;  4X9V A;  1Q4O A;  1FSU A;  3HFD A;  4LKM A;  3HMJ G;  4CYR A;  2I9X A;  5J19 A;  4WHK A;  2UV8 G; 
#chains in the Genus database with same CATH homology
 4XB0 A;  3P37 A;  4WHH A;  4X9R A;  3P34 A;  5DMS A;  3C5L A;  2OGQ A;  2N19 A;  3RQ7 A;  1Q4K A;  4O6W A;  3P2Z A;  3FVH A;  4E67 A;  4HY2 A;  4O9W A;  1UMW A;  2OJX A;  3P2W A;  4HAB A;  1Q4O A;  4X9V A;  3HIK A;  3Q1I A;  4J7B B;  4RS6 A;  4E9D A;  4LKM A;  4E9C A;  4DFW A;  3P35 A;  3P36 A;  4X9W A;  3HIH A;  4LKL A;  4H71 A;  5J19 A;  5DNJ A;  5DMV C;  3BZI A;  5LHZ A;  4YYP A;  4WHK A;  4RCP A;  4HCO A;  4O56 A;  4WHL A;  4H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...