3P2ZA

Polo-like kinase i polo-box domain in complex with plhspta phosphopeptide from pbip1
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
210
Chain Sequence
SPEFDCHLSDMLQQLHSVEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
total genus 67
structure length 210
sequence length 227
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2zA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2zA01
1UMWA 3P2ZA 5DNJA 3P37A 4E9CA 4HCOA 2OJXA 4LKMA 3C5LA 5LHZA 4X9RA 4YYPA 3RQ7A 4RS6A 4X9VA 5DMSA 4HABA 5J19A 3Q1IA 4WHHA 4DFWA 4O9WA 4E67A 3BZIA 4H5XA 4E9DA 4J7BB 4XB0A 3P34A 4RCPA 4H71A 4WHLA 4WHKA 1Q4OA 4HY2A 4O6WA 4X9WA 3P35A 1Q4KA 2OGQA 2N19A 5DMVC 3P36A 3FVHA 4O56A 3HIHA 3P2WA 3HIKA 4LKLA
chains in the Genus database with same CATH superfamily
1UMWA 5AJ9A 5LHZA 4X9RA 4YYPA 5DAYA 4FDJA 2QZUA 1HDHA 5J19A 1E3CP 3BZIA 4H71A 4FDIA 4G7NA 5DMVC 3HFDA 2I9ZA 3LXQA 3HIHA 4LKLA 1E1ZP 3P2ZA 4CXUA 2OJXA 4N7VA 3C5LA 4LKMA 4N7ZA 1A87A 4RS6A 4X9VA 1N2LA 3Q1IA 4WHHA 3ED4A 4E9DA 3GYVA 4N9JA 4RCPA 4WHLA 1Q4OA 4NK7A 4X9WA 3FS3A 1AUKA 2IA9A 3P36A 1P49A 3P37A 1E2SP 4HABA 3KDRA 4E67A 3HMJG 4CXSA 1N2KA 1E33P 4WHKA 1F34B 4HY2A 4O6WA 2VKZG 4CXKA 2OGQA 2N19A 3FVHA 4J7BB 3P2WA 3HIKA 5DNJA 4E9CA 3GYWA 4HCOA 2E50A 3RQ7A 2UV8G 2I9XA 5DMSA 1FSUA 4NKBA 4CYSA 4DFWA 4O9WA 1E2TA 4H5XA 3LM3A 4XB0A 3P34A 3P35A 1Q4KA 4CYRA 4O56A 1F32A
chains in the Genus database with same CATH topology
1UMWA 3P2ZA 5DNJA 3P37A 4E9CA 4HCOA 2OJXA 4LKMA 3C5LA 5LHZA 4X9RA 4YYPA 3RQ7A 4RS6A 4X9VA 5DMSA 4HABA 5J19A 3Q1IA 4WHHA 4DFWA 4O9WA 4E67A 3BZIA 4H5XA 4E9DA 4J7BB 4XB0A 3P34A 4RCPA 4H71A 4WHLA 4WHKA 1Q4OA 4HY2A 4O6WA 4X9WA 3P35A 1Q4KA 2OGQA 2N19A 5DMVC 3P36A 3FVHA 4O56A 3HIHA 3P2WA 3HIKA 4LKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMW A;  3P2Z A;  5DNJ A;  3P37 A;  4E9C A;  4HCO A;  2OJX A;  4LKM A;  3C5L A;  5LHZ A;  4X9R A;  4YYP A;  3RQ7 A;  4RS6 A;  4X9V A;  5DMS A;  4HAB A;  5J19 A;  3Q1I A;  4WHH A;  4DFW A;  4O9W A;  4E67 A;  3BZI A;  4H5X A;  4E9D A;  4J7B B;  4XB0 A;  3P34 A;  4RCP A;  4H71 A;  4WHL A;  4WHK A;  1Q4O A;  4HY2 A;  4O6W A;  4X9W A;  3P35 A;  1Q4K A;  2OGQ A;  2N19 A;  5DMV C;  3P36 A;  3FVH A;  4O56 A;  3HIH A;  3P2W A;  3HIK A;  4LKL A; 
#chains in the Genus database with same CATH topology
 1UMW A;  5AJ9 A;  5LHZ A;  4X9R A;  4YYP A;  5DAY A;  4FDJ A;  2QZU A;  1HDH A;  5J19 A;  1E3C P;  3BZI A;  4H71 A;  4FDI A;  4G7N A;  5DMV C;  3HFD A;  2I9Z A;  3LXQ A;  3HIH A;  4LKL A;  1E1Z P;  3P2Z A;  4CXU A;  2OJX A;  4N7V A;  3C5L A;  4LKM A;  4N7Z A;  1A87 A;  4RS6 A;  4X9V A;  1N2L A;  3Q1I A;  4WHH A;  3ED4 A;  4E9D A;  3GYV A;  4N9J A;  4RCP A;  4WHL A;  1Q4O A;  4NK7 A;  4X9W A;  3FS3 A;  1AUK A;  2IA9 A;  3P36 A;  1P49 A;  3P37 A;  1E2S P;  4HAB A;  3KDR A;  4E67 A;  3HMJ G;  4CXS A;  1N2K A;  1E33 P;  4WHK A;  1F34 B;  4HY2 A;  4O6W A;  2VKZ G;  4CXK A;  2OGQ A;  2N19 A;  3FVH A;  4J7B B;  3P2W A;  3HIK A;  5DNJ A;  4E9C A;  3GYW A;  4HCO A;  2E50 A;  3RQ7 A;  2UV8 G;  2I9X A;  5DMS A;  1FSU A;  4NKB A;  4CYS A;  4DFW A;  4O9W A;  1E2T A;  4H5X A;  3LM3 A;  4XB0 A;  3P34 A;  3P35 A;  1Q4K A;  4CYR A;  4O56 A;  1F32 A; 
#chains in the Genus database with same CATH homology
 1UMW A;  3P2Z A;  5DNJ A;  3P37 A;  4E9C A;  4HCO A;  2OJX A;  4LKM A;  3C5L A;  5LHZ A;  4X9R A;  4YYP A;  3RQ7 A;  4RS6 A;  4X9V A;  5DMS A;  4HAB A;  5J19 A;  3Q1I A;  4WHH A;  4DFW A;  4O9W A;  4E67 A;  3BZI A;  4H5X A;  4E9D A;  4J7B B;  4XB0 A;  3P34 A;  4RCP A;  4H71 A;  4WHL A;  4WHK A;  1Q4O A;  4HY2 A;  4O6W A;  4X9W A;  3P35 A;  1Q4K A;  2OGQ A;  2N19 A;  5DMV C;  3P36 A;  3FVH A;  4O56 A;  3HIH A;  3P2W A;  3HIK A;  4LKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...