3P2ZA

Polo-like kinase i polo-box domain in complex with plhspta phosphopeptide from pbip1
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
210
Chain Sequence
SPEFDCHLSDMLQQLHSVEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 210
sequence length 227
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2zA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2zA01
1Q4OA 4RS6A 4O9WA 4H5XA 3P2ZA 4HABA 4RCPA 3C5LA 4J7BB 4WHKA 3P37A 4H71A 5DMSA 3FVHA 3P2WA 2OJXA 2N19A 3HIKA 1UMWA 4HY2A 4WHLA 2OGQA 4O56A 1Q4KA 3BZIA 4E67A 5DMVC 3P36A 4LKLA 5J19A 4X9RA 3P35A 4YYPA 4HCOA 4X9VA 4XB0A 5DNJA 4DFWA 3Q1IA 4X9WA 3HIHA 4E9CA 4WHHA 4O6WA 3RQ7A 5LHZA 4LKMA 4E9DA 3P34A
chains in the Genus database with same CATH superfamily
4RS6A 4O9WA 1AUKA 4WHKA 5DAYA 2N19A 4N7ZA 1Q4KA 4X9VA 2E50A 4G7NA 3Q1IA 3GYVA 4E9CA 3ED4A 1A87A 1P49A 1E3CP 3KDRA 5LHZA 2UV8G 4FDJA 4E9DA 4CXSA 4H5XA 4N9JA 4NKBA 4J7BB 1F32A 3P37A 4H71A 5DMSA 2OJXA 1E2SP 4WHLA 4LKLA 4X9RA 4CYRA 1F34B 4XB0A 5DNJA 4DFWA 1E2TA 3HMJG 1N2KA 3HFDA 1FSUA 4O6WA 3LM3A 3FS3A 4CXKA 1Q4OA 1HDHA 2I9ZA 1E1ZP 2QZUA 3P2ZA 4NK7A 2VKZG 3C5LA 3FVHA 3P2WA 3HIKA 1UMWA 4HY2A 2OGQA 4O56A 3BZIA 4E67A 5AJ9A 3HIHA 4FDIA 3P34A 4HABA 4RCPA 4CYSA 1N2LA 5J19A 5DMVC 3P36A 3P35A 1E33P 4YYPA 4HCOA 3LXQA 4X9WA 2IA9A 4CXUA 4WHHA 2I9XA 3RQ7A 4LKMA 4N7VA 3GYWA
chains in the Genus database with same CATH topology
1Q4OA 4RS6A 4O9WA 4H5XA 3P2ZA 4HABA 4RCPA 3C5LA 4J7BB 4WHKA 3P37A 4H71A 5DMSA 3FVHA 3P2WA 2OJXA 2N19A 3HIKA 1UMWA 4HY2A 4WHLA 2OGQA 4O56A 1Q4KA 3BZIA 4E67A 5DMVC 3P36A 4LKLA 5J19A 4X9RA 3P35A 4YYPA 4HCOA 4X9VA 4XB0A 5DNJA 4DFWA 3Q1IA 4X9WA 3HIHA 4E9CA 4WHHA 4O6WA 3RQ7A 5LHZA 4LKMA 4E9DA 3P34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q4O A;  4RS6 A;  4O9W A;  4H5X A;  3P2Z A;  4HAB A;  4RCP A;  3C5L A;  4J7B B;  4WHK A;  3P37 A;  4H71 A;  5DMS A;  3FVH A;  3P2W A;  2OJX A;  2N19 A;  3HIK A;  1UMW A;  4HY2 A;  4WHL A;  2OGQ A;  4O56 A;  1Q4K A;  3BZI A;  4E67 A;  5DMV C;  3P36 A;  4LKL A;  5J19 A;  4X9R A;  3P35 A;  4YYP A;  4HCO A;  4X9V A;  4XB0 A;  5DNJ A;  4DFW A;  3Q1I A;  4X9W A;  3HIH A;  4E9C A;  4WHH A;  4O6W A;  3RQ7 A;  5LHZ A;  4LKM A;  4E9D A;  3P34 A; 
#chains in the Genus database with same CATH topology
 4RS6 A;  4O9W A;  1AUK A;  4WHK A;  5DAY A;  2N19 A;  4N7Z A;  1Q4K A;  4X9V A;  2E50 A;  4G7N A;  3Q1I A;  3GYV A;  4E9C A;  3ED4 A;  1A87 A;  1P49 A;  1E3C P;  3KDR A;  5LHZ A;  2UV8 G;  4FDJ A;  4E9D A;  4CXS A;  4H5X A;  4N9J A;  4NKB A;  4J7B B;  1F32 A;  3P37 A;  4H71 A;  5DMS A;  2OJX A;  1E2S P;  4WHL A;  4LKL A;  4X9R A;  4CYR A;  1F34 B;  4XB0 A;  5DNJ A;  4DFW A;  1E2T A;  3HMJ G;  1N2K A;  3HFD A;  1FSU A;  4O6W A;  3LM3 A;  3FS3 A;  4CXK A;  1Q4O A;  1HDH A;  2I9Z A;  1E1Z P;  2QZU A;  3P2Z A;  4NK7 A;  2VKZ G;  3C5L A;  3FVH A;  3P2W A;  3HIK A;  1UMW A;  4HY2 A;  2OGQ A;  4O56 A;  3BZI A;  4E67 A;  5AJ9 A;  3HIH A;  4FDI A;  3P34 A;  4HAB A;  4RCP A;  4CYS A;  1N2L A;  5J19 A;  5DMV C;  3P36 A;  3P35 A;  1E33 P;  4YYP A;  4HCO A;  3LXQ A;  4X9W A;  2IA9 A;  4CXU A;  4WHH A;  2I9X A;  3RQ7 A;  4LKM A;  4N7V A;  3GYW A; 
#chains in the Genus database with same CATH homology
 1Q4O A;  4RS6 A;  4O9W A;  4H5X A;  3P2Z A;  4HAB A;  4RCP A;  3C5L A;  4J7B B;  4WHK A;  3P37 A;  4H71 A;  5DMS A;  3FVH A;  3P2W A;  2OJX A;  2N19 A;  3HIK A;  1UMW A;  4HY2 A;  4WHL A;  2OGQ A;  4O56 A;  1Q4K A;  3BZI A;  4E67 A;  5DMV C;  3P36 A;  4LKL A;  5J19 A;  4X9R A;  3P35 A;  4YYP A;  4HCO A;  4X9V A;  4XB0 A;  5DNJ A;  4DFW A;  3Q1I A;  4X9W A;  3HIH A;  4E9C A;  4WHH A;  4O6W A;  3RQ7 A;  5LHZ A;  4LKM A;  4E9D A;  3P34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...