4NK7A

Crystal structure of the d. melanogaster plk4 cryptic polo box (cpb)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
212
Chain Sequence
HMRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK4
publication title Structure of the C. elegans ZYG-1 Cryptic Polo Box Suggests a Conserved Mechanism for Centriolar Docking of Plk4 Kinases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 47
structure length 212
sequence length 216
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18190 Plk4_PB1 Polo-like Kinase 4 Polo Box 1
A PF18409 Plk4_PB2 Polo-like Kinase 4 Polo Box 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nk7A01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nk7A02
4G7NA 4N7ZA 4N9JA 4N7VA 4NKBA 4NK7A
chains in the Genus database with same CATH superfamily
4HABA 3RQ7A 3HIKA 1E2SP 4E9DA 2VKZG 5DMSA 3BZIA 3HMJG 4FDIA 2I9ZA 4N7VA 4LKLA 5J19A 3LXQA 5AJ9A 1F34B 4N9JA 2E50A 4E9CA 1E33P 3P2ZA 4CXKA 2OGQA 1Q4OA 4WHLA 2UV8G 4X9RA 4YYPA 1E3CP 4N7ZA 3GYVA 4O6WA 4WHHA 1A87A 4HCOA 4E67A 3P34A 3FS3A 4HY2A 1F32A 1FSUA 3HFDA 3P2WA 4XB0A 3GYWA 4X9WA 4J7BB 5DAYA 1E1ZP 3FVHA 5DMVC 3ED4A 3LM3A 3P37A 4FDJA 4NKBA 2N19A 1E2TA 5DNJA 1Q4KA 3C5LA 4CYSA 4H5XA 2I9XA 2QZUA 1AUKA 4X9VA 4CXUA 1N2LA 4NK7A 1P49A 4RS6A 1UMWA 2OJXA 3P35A 3Q1IA 4CYRA 4G7NA 4WHKA 3KDRA 4LKMA 3HIHA 3P36A 4O56A 2IA9A 4O9WA 4DFWA 4CXSA 1HDHA 4H71A 5LHZA 1N2KA 4RCPA
chains in the Genus database with same CATH topology
1E1ZP 5DAYA 2QZUA 1E2SP 1AUKA 4CXUA 1N2LA 3ED4A 1P49A 2VKZG 3LM3A 4NK7A 4CYRA 3HMJG 1E3CP 4G7NA 4FDIA 4N7ZA 3GYVA 3KDRA 4N7VA 3LXQA 5AJ9A 4FDJA 4N9JA 4NKBA 2E50A 3FS3A 1E2TA 1FSUA 3HFDA 1E33P 4CYSA 4CXKA 4CXSA 3GYWA 1HDHA 2UV8G 1N2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7N A;  4N7Z A;  4N9J A;  4N7V A;  4NKB A;  4NK7 A; 
#chains in the Genus database with same CATH topology
 4HAB A;  3RQ7 A;  3HIK A;  1E2S P;  4E9D A;  2VKZ G;  5DMS A;  3BZI A;  3HMJ G;  4FDI A;  2I9Z A;  4N7V A;  4LKL A;  5J19 A;  3LXQ A;  5AJ9 A;  1F34 B;  4N9J A;  2E50 A;  4E9C A;  1E33 P;  3P2Z A;  4CXK A;  2OGQ A;  1Q4O A;  4WHL A;  2UV8 G;  4X9R A;  4YYP A;  1E3C P;  4N7Z A;  3GYV A;  4O6W A;  4WHH A;  1A87 A;  4HCO A;  4E67 A;  3P34 A;  3FS3 A;  4HY2 A;  1F32 A;  1FSU A;  3HFD A;  3P2W A;  4XB0 A;  3GYW A;  4X9W A;  4J7B B;  5DAY A;  1E1Z P;  3FVH A;  5DMV C;  3ED4 A;  3LM3 A;  3P37 A;  4FDJ A;  4NKB A;  2N19 A;  1E2T A;  5DNJ A;  1Q4K A;  3C5L A;  4CYS A;  4H5X A;  2I9X A;  2QZU A;  1AUK A;  4X9V A;  4CXU A;  1N2L A;  4NK7 A;  1P49 A;  4RS6 A;  1UMW A;  2OJX A;  3P35 A;  3Q1I A;  4CYR A;  4G7N A;  4WHK A;  3KDR A;  4LKM A;  3HIH A;  3P36 A;  4O56 A;  2IA9 A;  4O9W A;  4DFW A;  4CXS A;  1HDH A;  4H71 A;  5LHZ A;  1N2K A;  4RCP A; 
#chains in the Genus database with same CATH homology
 1E1Z P;  5DAY A;  2QZU A;  1E2S P;  1AUK A;  4CXU A;  1N2L A;  3ED4 A;  1P49 A;  2VKZ G;  3LM3 A;  4NK7 A;  4CYR A;  3HMJ G;  1E3C P;  4G7N A;  4FDI A;  4N7Z A;  3GYV A;  3KDR A;  4N7V A;  3LXQ A;  5AJ9 A;  4FDJ A;  4N9J A;  4NKB A;  2E50 A;  3FS3 A;  1E2T A;  1FSU A;  3HFD A;  1E33 P;  4CYS A;  4CXK A;  4CXS A;  3GYW A;  1HDH A;  2UV8 G;  1N2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...