4NK7A

Crystal structure of the d. melanogaster plk4 cryptic polo box (cpb)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
212
Chain Sequence
b'HMRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK4
publication title Structure of the C. elegans ZYG-1 Cryptic Polo Box Suggests a Conserved Mechanism for Centriolar Docking of Plk4 Kinases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 47
structure length 212
sequence length 216
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18190 Plk4_PB1 Polo-like Kinase 4 Polo Box 1
A PF18409 Plk4_PB2 Polo-like Kinase 4 Polo Box 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nk7A01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nk7A02
4NKBA 4N7VA 4N7ZA 4G7NA 4NK7A 4N9JA
chains in the Genus database with same CATH superfamily
3FVHA 3HFDA 3Q1IA 4E9DA 3P35A 4FDJA 1UMWA 4WHLA 4YYPA 4E9CA 1F34B 1E2SP 2OGQA 4O6WA 2E50A 3KDRA 2OJXA 1AUKA 4O9WA 4X9VA 1E1ZP 2QZUA 4HABA 3FS3A 3HMJG 4J7BB 4LKMA 4N7ZA 1Q4OA 3GYWA 3LXQA 4X9WA 1F32A 2UV8G 4H5XA 1FSUA 4O56A 2I9ZA 4WHKA 3GYVA 3P37A 4NKBA 5LHZA 2I9XA 3BZIA 5DAYA 4HCOA 4DFWA 3LM3A 2N19A 3P36A 2VKZG 1N2KA 1E3CP 3ED4A 3C5LA 3P2WA 4FDIA 4CXUA 4CYRA 4G7NA 4RCPA 1E33P 4X9RA 3HIHA 5DMVC 4RS6A 3P34A 3P2ZA 4NK7A 3HIKA 3RQ7A 4HY2A 5AJ9A 4WHHA 1Q4KA 2IA9A 1A87A 4LKLA 5DNJA 1P49A 4E67A 4CYSA 4CXKA 4N9JA 4XB0A 5J19A 1E2TA 1HDHA 5DMSA 4CXSA 4H71A 4N7VA 1N2LA
chains in the Genus database with same CATH topology
3FS3A 3HFDA 3HMJG 2VKZG 4N7ZA 3GYWA 3LXQA 5AJ9A 4FDJA 1N2KA 3ED4A 1E3CP 2UV8G 1P49A 4FDIA 4CYSA 1FSUA 4CXUA 4CYRA 4G7NA 4CXKA 3GYVA 4N9JA 1E33P 1E2TA 4NKBA 1E2SP 1HDHA 2E50A 4CXSA 3KDRA 1AUKA 5DAYA 1E1ZP 4NK7A 3LM3A 2QZUA 4N7VA 1N2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKB A;  4N7V A;  4N7Z A;  4G7N A;  4NK7 A;  4N9J A; 
#chains in the Genus database with same CATH topology
 3FVH A;  3HFD A;  3Q1I A;  4E9D A;  3P35 A;  4FDJ A;  1UMW A;  4WHL A;  4YYP A;  4E9C A;  1F34 B;  1E2S P;  2OGQ A;  4O6W A;  2E50 A;  3KDR A;  2OJX A;  1AUK A;  4O9W A;  4X9V A;  1E1Z P;  2QZU A;  4HAB A;  3FS3 A;  3HMJ G;  4J7B B;  4LKM A;  4N7Z A;  1Q4O A;  3GYW A;  3LXQ A;  4X9W A;  1F32 A;  2UV8 G;  4H5X A;  1FSU A;  4O56 A;  2I9Z A;  4WHK A;  3GYV A;  3P37 A;  4NKB A;  5LHZ A;  2I9X A;  3BZI A;  5DAY A;  4HCO A;  4DFW A;  3LM3 A;  2N19 A;  3P36 A;  2VKZ G;  1N2K A;  1E3C P;  3ED4 A;  3C5L A;  3P2W A;  4FDI A;  4CXU A;  4CYR A;  4G7N A;  4RCP A;  1E33 P;  4X9R A;  3HIH A;  5DMV C;  4RS6 A;  3P34 A;  3P2Z A;  4NK7 A;  3HIK A;  3RQ7 A;  4HY2 A;  5AJ9 A;  4WHH A;  1Q4K A;  2IA9 A;  1A87 A;  4LKL A;  5DNJ A;  1P49 A;  4E67 A;  4CYS A;  4CXK A;  4N9J A;  4XB0 A;  5J19 A;  1E2T A;  1HDH A;  5DMS A;  4CXS A;  4H71 A;  4N7V A;  1N2L A; 
#chains in the Genus database with same CATH homology
 3FS3 A;  3HFD A;  3HMJ G;  2VKZ G;  4N7Z A;  3GYW A;  3LXQ A;  5AJ9 A;  4FDJ A;  1N2K A;  3ED4 A;  1E3C P;  2UV8 G;  1P49 A;  4FDI A;  4CYS A;  1FSU A;  4CXU A;  4CYR A;  4G7N A;  4CXK A;  3GYV A;  4N9J A;  1E33 P;  1E2T A;  4NKB A;  1E2S P;  1HDH A;  2E50 A;  4CXS A;  3KDR A;  1AUK A;  5DAY A;  1E1Z P;  4NK7 A;  3LM3 A;  2QZU A;  4N7V A;  1N2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...