4NK7A

Crystal structure of the d. melanogaster plk4 cryptic polo box (cpb)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
212
Chain Sequence
HMRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C. elegans ZYG-1 Cryptic Polo Box Suggests a Conserved Mechanism for Centriolar Docking of Plk4 Kinases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK4
total genus 47
structure length 212
sequence length 216
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18190 Plk4_PB1 Polo-like Kinase 4 Polo Box 1
A PF18409 Plk4_PB2 Polo-like Kinase 4 Polo Box 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nk7A01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4nk7A02
4G7NA 4N7VA 4N9JA 4NKBA 4N7ZA 4NK7A
chains in the Genus database with same CATH superfamily
1UMWA 5AJ9A 5LHZA 4X9RA 4YYPA 5DAYA 4FDJA 2QZUA 1HDHA 5J19A 1E3CP 3BZIA 4H71A 4FDIA 4G7NA 5DMVC 3HFDA 2I9ZA 3LXQA 3HIHA 4LKLA 1E1ZP 3P2ZA 4CXUA 2OJXA 4N7VA 3C5LA 4LKMA 4N7ZA 1A87A 4RS6A 4X9VA 1N2LA 3Q1IA 4WHHA 3ED4A 4E9DA 3GYVA 4N9JA 4RCPA 4WHLA 1Q4OA 4NK7A 4X9WA 3FS3A 1AUKA 2IA9A 3P36A 1P49A 3P37A 1E2SP 4HABA 3KDRA 4E67A 3HMJG 4CXSA 1N2KA 1E33P 4WHKA 1F34B 4HY2A 4O6WA 2VKZG 4CXKA 2OGQA 2N19A 3FVHA 4J7BB 3P2WA 3HIKA 5DNJA 4E9CA 3GYWA 4HCOA 2E50A 3RQ7A 2UV8G 2I9XA 5DMSA 1FSUA 4NKBA 4CYSA 4DFWA 4O9WA 1E2TA 4H5XA 3LM3A 4XB0A 3P34A 3P35A 1Q4KA 4CYRA 4O56A 1F32A
chains in the Genus database with same CATH topology
5AJ9A 4CXUA 1E2SP 3GYWA 4N7VA 2E50A 4N7ZA 5DAYA 2UV8G 4FDJA 2QZUA 1HDHA 1FSUA 1N2LA 3KDRA 4NKBA 4CYSA 1E3CP 3HMJG 3ED4A 1E2TA 4CXSA 3GYVA 3LM3A 4N9JA 1N2KA 1E33P 4NK7A 2VKZG 4FDIA 4CXKA 4G7NA 3FS3A 1AUKA 4CYRA 3HFDA 3LXQA 1E1ZP 1P49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7N A;  4N7V A;  4N9J A;  4NKB A;  4N7Z A;  4NK7 A; 
#chains in the Genus database with same CATH topology
 1UMW A;  5AJ9 A;  5LHZ A;  4X9R A;  4YYP A;  5DAY A;  4FDJ A;  2QZU A;  1HDH A;  5J19 A;  1E3C P;  3BZI A;  4H71 A;  4FDI A;  4G7N A;  5DMV C;  3HFD A;  2I9Z A;  3LXQ A;  3HIH A;  4LKL A;  1E1Z P;  3P2Z A;  4CXU A;  2OJX A;  4N7V A;  3C5L A;  4LKM A;  4N7Z A;  1A87 A;  4RS6 A;  4X9V A;  1N2L A;  3Q1I A;  4WHH A;  3ED4 A;  4E9D A;  3GYV A;  4N9J A;  4RCP A;  4WHL A;  1Q4O A;  4NK7 A;  4X9W A;  3FS3 A;  1AUK A;  2IA9 A;  3P36 A;  1P49 A;  3P37 A;  1E2S P;  4HAB A;  3KDR A;  4E67 A;  3HMJ G;  4CXS A;  1N2K A;  1E33 P;  4WHK A;  1F34 B;  4HY2 A;  4O6W A;  2VKZ G;  4CXK A;  2OGQ A;  2N19 A;  3FVH A;  4J7B B;  3P2W A;  3HIK A;  5DNJ A;  4E9C A;  3GYW A;  4HCO A;  2E50 A;  3RQ7 A;  2UV8 G;  2I9X A;  5DMS A;  1FSU A;  4NKB A;  4CYS A;  4DFW A;  4O9W A;  1E2T A;  4H5X A;  3LM3 A;  4XB0 A;  3P34 A;  3P35 A;  1Q4K A;  4CYR A;  4O56 A;  1F32 A; 
#chains in the Genus database with same CATH homology
 5AJ9 A;  4CXU A;  1E2S P;  3GYW A;  4N7V A;  2E50 A;  4N7Z A;  5DAY A;  2UV8 G;  4FDJ A;  2QZU A;  1HDH A;  1FSU A;  1N2L A;  3KDR A;  4NKB A;  4CYS A;  1E3C P;  3HMJ G;  3ED4 A;  1E2T A;  4CXS A;  3GYV A;  3LM3 A;  4N9J A;  1N2K A;  1E33 P;  4NK7 A;  2VKZ G;  4FDI A;  4CXK A;  4G7N A;  3FS3 A;  1AUK A;  4CYR A;  3HFD A;  3LXQ A;  1E1Z P;  1P49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...