3P35A

Polo-like kinase i polo-box domain in complex with mqspspl phosphopeptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
223
structure length
217
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPRRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 217
sequence length 223
chains with identical sequence B, C
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p35A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p35A01
3P37A 4HCOA 4RS6A 3P35A 2OJXA 3Q1IA 3C5LA 4RCPA 4E9CA 4O9WA 4H71A 5DNJA 5DMVC 2OGQA 4LKLA 4XB0A 4X9VA 4WHLA 3P2WA 4O56A 1Q4KA 4X9WA 4E9DA 3P2ZA 4YYPA 3BZIA 3P34A 4E67A 3RQ7A 3HIHA 5LHZA 4J7BB 2N19A 4HY2A 5J19A 4X9RA 5DMSA 3FVHA 4HABA 1UMWA 3P36A 4WHHA 4WHKA 3HIKA 4DFWA 4LKMA 1Q4OA 4H5XA 4O6WA
chains in the Genus database with same CATH superfamily
2VKZG 3Q1IA 4E9CA 4H71A 2OGQA 1E2TA 4X9VA 1N2LA 4O56A 3P2ZA 4X9RA 5DMSA 1E33P 1AUKA 2I9ZA 3HFDA 4HCOA 2UV8G 3C5LA 4RCPA 3GYVA 5DMVC 4LKLA 4N9JA 1HDHA 2QZUA 1Q4KA 3BZIA 3P34A 3RQ7A 5DAYA 3KDRA 4DFWA 1Q4OA 4O6WA 3LM3A 3P37A 4RS6A 3P35A 2OJXA 4O9WA 5AJ9A 5DNJA 4CXKA 1N2KA 2E50A 3P2WA 3HMJG 4G7NA 4E9DA 4CYSA 4E67A 5LHZA 2N19A 3ED4A 1F34B 1A87A 5J19A 4CXUA 4WHHA 1UMWA 2IA9A 3P36A 4NK7A 4WHKA 4N7ZA 3LXQA 1E2SP 1FSUA 1P49A 4FDJA 4XB0A 4CYRA 4WHLA 2I9XA 4FDIA 1E1ZP 3FS3A 4X9WA 4YYPA 1F32A 4CXSA 3HIHA 1E3CP 4J7BB 4HY2A 3FVHA 4HABA 4N7VA 3HIKA 4NKBA 4LKMA 4H5XA 3GYWA
chains in the Genus database with same CATH topology
3P37A 4HCOA 4RS6A 3P35A 2OJXA 3Q1IA 3C5LA 4RCPA 4E9CA 4O9WA 4H71A 5DNJA 5DMVC 2OGQA 4LKLA 4XB0A 4X9VA 4WHLA 3P2WA 4O56A 1Q4KA 4X9WA 4E9DA 3P2ZA 4YYPA 3BZIA 3P34A 4E67A 3RQ7A 3HIHA 5LHZA 4J7BB 2N19A 4HY2A 5J19A 4X9RA 5DMSA 3FVHA 4HABA 1UMWA 3P36A 4WHHA 4WHKA 3HIKA 4DFWA 4LKMA 1Q4OA 4H5XA 4O6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P37 A;  4HCO A;  4RS6 A;  3P35 A;  2OJX A;  3Q1I A;  3C5L A;  4RCP A;  4E9C A;  4O9W A;  4H71 A;  5DNJ A;  5DMV C;  2OGQ A;  4LKL A;  4XB0 A;  4X9V A;  4WHL A;  3P2W A;  4O56 A;  1Q4K A;  4X9W A;  4E9D A;  3P2Z A;  4YYP A;  3BZI A;  3P34 A;  4E67 A;  3RQ7 A;  3HIH A;  5LHZ A;  4J7B B;  2N19 A;  4HY2 A;  5J19 A;  4X9R A;  5DMS A;  3FVH A;  4HAB A;  1UMW A;  3P36 A;  4WHH A;  4WHK A;  3HIK A;  4DFW A;  4LKM A;  1Q4O A;  4H5X A;  4O6W A; 
#chains in the Genus database with same CATH topology
 2VKZ G;  3Q1I A;  4E9C A;  4H71 A;  2OGQ A;  1E2T A;  4X9V A;  1N2L A;  4O56 A;  3P2Z A;  4X9R A;  5DMS A;  1E33 P;  1AUK A;  2I9Z A;  3HFD A;  4HCO A;  2UV8 G;  3C5L A;  4RCP A;  3GYV A;  5DMV C;  4LKL A;  4N9J A;  1HDH A;  2QZU A;  1Q4K A;  3BZI A;  3P34 A;  3RQ7 A;  5DAY A;  3KDR A;  4DFW A;  1Q4O A;  4O6W A;  3LM3 A;  3P37 A;  4RS6 A;  3P35 A;  2OJX A;  4O9W A;  5AJ9 A;  5DNJ A;  4CXK A;  1N2K A;  2E50 A;  3P2W A;  3HMJ G;  4G7N A;  4E9D A;  4CYS A;  4E67 A;  5LHZ A;  2N19 A;  3ED4 A;  1F34 B;  1A87 A;  5J19 A;  4CXU A;  4WHH A;  1UMW A;  2IA9 A;  3P36 A;  4NK7 A;  4WHK A;  4N7Z A;  3LXQ A;  1E2S P;  1FSU A;  1P49 A;  4FDJ A;  4XB0 A;  4CYR A;  4WHL A;  2I9X A;  4FDI A;  1E1Z P;  3FS3 A;  4X9W A;  4YYP A;  1F32 A;  4CXS A;  3HIH A;  1E3C P;  4J7B B;  4HY2 A;  3FVH A;  4HAB A;  4N7V A;  3HIK A;  4NKB A;  4LKM A;  4H5X A;  3GYW A; 
#chains in the Genus database with same CATH homology
 3P37 A;  4HCO A;  4RS6 A;  3P35 A;  2OJX A;  3Q1I A;  3C5L A;  4RCP A;  4E9C A;  4O9W A;  4H71 A;  5DNJ A;  5DMV C;  2OGQ A;  4LKL A;  4XB0 A;  4X9V A;  4WHL A;  3P2W A;  4O56 A;  1Q4K A;  4X9W A;  4E9D A;  3P2Z A;  4YYP A;  3BZI A;  3P34 A;  4E67 A;  3RQ7 A;  3HIH A;  5LHZ A;  4J7B B;  2N19 A;  4HY2 A;  5J19 A;  4X9R A;  5DMS A;  3FVH A;  4HAB A;  1UMW A;  3P36 A;  4WHH A;  4WHK A;  3HIK A;  4DFW A;  4LKM A;  1Q4O A;  4H5X A;  4O6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...