3P2WA

Unliganded form of polo-like kinase i polo-box domain
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
225
structure length
219
Chain Sequence
FDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPRRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 219
sequence length 225
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2wA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2wA01
3BZIA 3P36A 3P2WA 3P34A 4J7BB 4WHLA 3HIHA 1Q4OA 4O6WA 4RS6A 3P2ZA 4HY2A 4WHKA 4DFWA 4E9DA 4H71A 4E67A 5J19A 3C5LA 4O9WA 3RQ7A 1Q4KA 3P35A 4LKMA 5DMVC 4LKLA 4WHHA 2OJXA 5DMSA 4H5XA 4YYPA 4X9VA 4HCOA 4E9CA 4RCPA 1UMWA 3HIKA 2N19A 4X9RA 4XB0A 5DNJA 4X9WA 3P37A 4O56A 3FVHA 4HABA 5LHZA 3Q1IA 2OGQA
chains in the Genus database with same CATH superfamily
3HIHA 4FDJA 4O6WA 2I9XA 4WHKA 4DFWA 3HMJG 3RQ7A 4O9WA 3P35A 1E33P 4WHHA 4H5XA 4E9CA 4CXSA 2N19A 4CXUA 4X9RA 1N2LA 1E1ZP 4G7NA 1F34B 3FS3A 3P37A 3FVHA 1FSUA 5LHZA 3Q1IA 3P36A 3P2WA 5AJ9A 2E50A 4CYRA 4RS6A 1F32A 4E9DA 1A87A 4E67A 3C5LA 5DMSA 4YYPA 4RCPA 1UMWA 4FDIA 4X9WA 1P49A 4CYSA 2QZUA 4WHLA 4N7VA 1E2TA 1E2SP 1Q4OA 4N7ZA 4N9JA 3KDRA 4HY2A 3GYWA 3HFDA 5J19A 5DAYA 4NK7A 4LKMA 5DMVC 4CXKA 2OJXA 4HCOA 2I9ZA 2UV8G 1HDHA 4XB0A 5DNJA 4O56A 3GYVA 4HABA 4X9VA 2OGQA 3BZIA 3P34A 4J7BB 1N2KA 3ED4A 1AUKA 3P2ZA 4H71A 2IA9A 1Q4KA 3LM3A 3LXQA 4LKLA 3HIKA 4NKBA 1E3CP 2VKZG
chains in the Genus database with same CATH topology
3BZIA 3P36A 3P2WA 3P34A 4J7BB 4WHLA 3HIHA 1Q4OA 4O6WA 4RS6A 3P2ZA 4HY2A 4WHKA 4DFWA 4E9DA 4H71A 4E67A 5J19A 3C5LA 4O9WA 3RQ7A 1Q4KA 3P35A 4LKMA 5DMVC 4LKLA 4WHHA 2OJXA 5DMSA 4H5XA 4YYPA 4X9VA 4HCOA 4E9CA 4RCPA 1UMWA 3HIKA 2N19A 4X9RA 4XB0A 5DNJA 4X9WA 3P37A 4O56A 3FVHA 4HABA 5LHZA 3Q1IA 2OGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZI A;  3P36 A;  3P2W A;  3P34 A;  4J7B B;  4WHL A;  3HIH A;  1Q4O A;  4O6W A;  4RS6 A;  3P2Z A;  4HY2 A;  4WHK A;  4DFW A;  4E9D A;  4H71 A;  4E67 A;  5J19 A;  3C5L A;  4O9W A;  3RQ7 A;  1Q4K A;  3P35 A;  4LKM A;  5DMV C;  4LKL A;  4WHH A;  2OJX A;  5DMS A;  4H5X A;  4YYP A;  4X9V A;  4HCO A;  4E9C A;  4RCP A;  1UMW A;  3HIK A;  2N19 A;  4X9R A;  4XB0 A;  5DNJ A;  4X9W A;  3P37 A;  4O56 A;  3FVH A;  4HAB A;  5LHZ A;  3Q1I A;  2OGQ A; 
#chains in the Genus database with same CATH topology
 3HIH A;  4FDJ A;  4O6W A;  2I9X A;  4WHK A;  4DFW A;  3HMJ G;  3RQ7 A;  4O9W A;  3P35 A;  1E33 P;  4WHH A;  4H5X A;  4E9C A;  4CXS A;  2N19 A;  4CXU A;  4X9R A;  1N2L A;  1E1Z P;  4G7N A;  1F34 B;  3FS3 A;  3P37 A;  3FVH A;  1FSU A;  5LHZ A;  3Q1I A;  3P36 A;  3P2W A;  5AJ9 A;  2E50 A;  4CYR A;  4RS6 A;  1F32 A;  4E9D A;  1A87 A;  4E67 A;  3C5L A;  5DMS A;  4YYP A;  4RCP A;  1UMW A;  4FDI A;  4X9W A;  1P49 A;  4CYS A;  2QZU A;  4WHL A;  4N7V A;  1E2T A;  1E2S P;  1Q4O A;  4N7Z A;  4N9J A;  3KDR A;  4HY2 A;  3GYW A;  3HFD A;  5J19 A;  5DAY A;  4NK7 A;  4LKM A;  5DMV C;  4CXK A;  2OJX A;  4HCO A;  2I9Z A;  2UV8 G;  1HDH A;  4XB0 A;  5DNJ A;  4O56 A;  3GYV A;  4HAB A;  4X9V A;  2OGQ A;  3BZI A;  3P34 A;  4J7B B;  1N2K A;  3ED4 A;  1AUK A;  3P2Z A;  4H71 A;  2IA9 A;  1Q4K A;  3LM3 A;  3LXQ A;  4LKL A;  3HIK A;  4NKB A;  1E3C P;  2VKZ G; 
#chains in the Genus database with same CATH homology
 3BZI A;  3P36 A;  3P2W A;  3P34 A;  4J7B B;  4WHL A;  3HIH A;  1Q4O A;  4O6W A;  4RS6 A;  3P2Z A;  4HY2 A;  4WHK A;  4DFW A;  4E9D A;  4H71 A;  4E67 A;  5J19 A;  3C5L A;  4O9W A;  3RQ7 A;  1Q4K A;  3P35 A;  4LKM A;  5DMV C;  4LKL A;  4WHH A;  2OJX A;  5DMS A;  4H5X A;  4YYP A;  4X9V A;  4HCO A;  4E9C A;  4RCP A;  1UMW A;  3HIK A;  2N19 A;  4X9R A;  4XB0 A;  5DNJ A;  4X9W A;  3P37 A;  4O56 A;  3FVH A;  4HAB A;  5LHZ A;  3Q1I A;  2OGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...