3P2WA

Unliganded form of polo-like kinase i polo-box domain
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
225
structure length
219
Chain Sequence
FDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPRRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK1
publication title From crystal packing to molecular recognition: prediction and discovery of a binding site on the surface of polo-like kinase 1
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 219
sequence length 225
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2wA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3p2wA01
4RCPA 4H5XA 4WHLA 4HCOA 3HIHA 2OJXA 3P34A 4X9WA 2OGQA 3BZIA 4YYPA 4LKMA 3P37A 2N19A 1Q4OA 3P2ZA 5DNJA 5J19A 1Q4KA 4XB0A 3C5LA 4O56A 4X9VA 1UMWA 4E9CA 3P36A 3RQ7A 3P35A 4HY2A 5DMVC 4RS6A 4E9DA 3Q1IA 4LKLA 3HIKA 3FVHA 4J7BB 4H71A 4WHKA 4DFWA 4E67A 4HABA 4O9WA 3P2WA 4WHHA 5DMSA 4O6WA 5LHZA 4X9RA
chains in the Genus database with same CATH superfamily
4CXSA 3HIHA 4N7ZA 4LKMA 1E2TA 3BZIA 2QZUA 3P37A 1Q4OA 5DNJA 5J19A 4XB0A 2E50A 1N2KA 1E3CP 3LXQA 4E9CA 3P36A 3HFDA 3HIKA 1N2LA 3ED4A 4O9WA 3FS3A 1E1ZP 2IA9A 4NK7A 4RCPA 4WHLA 2OJXA 2OGQA 4CYRA 3HMJG 4O56A 1UMWA 1AUKA 2UV8G 3RQ7A 4HY2A 4RS6A 1F34B 4FDJA 2VKZG 3FVHA 1P49A 4E67A 1A87A 1F32A 1E2SP 3KDRA 3GYWA 4X9WA 4YYPA 3P2ZA 1HDHA 1Q4KA 4CYSA 2I9ZA 4N7VA 4N9JA 4G7NA 3P35A 4NKBA 4E9DA 3Q1IA 4LKLA 4J7BB 4WHKA 5AJ9A 4DFWA 2I9XA 3P2WA 5DMSA 4O6WA 5LHZA 4X9RA 1E33P 4H5XA 4HCOA 3P34A 2N19A 3C5LA 4X9VA 3GYVA 4FDIA 4CXUA 4H71A 3LM3A 1FSUA 4CXKA 4HABA 4WHHA 5DAYA 5DMVC
chains in the Genus database with same CATH topology
4RCPA 4H5XA 4WHLA 4HCOA 3HIHA 2OJXA 3P34A 4X9WA 2OGQA 3BZIA 4YYPA 4LKMA 3P37A 2N19A 1Q4OA 3P2ZA 5DNJA 5J19A 1Q4KA 4XB0A 3C5LA 4O56A 4X9VA 1UMWA 4E9CA 3P36A 3RQ7A 3P35A 4HY2A 5DMVC 4RS6A 4E9DA 3Q1IA 4LKLA 3HIKA 3FVHA 4J7BB 4H71A 4WHKA 4DFWA 4E67A 4HABA 4O9WA 3P2WA 4WHHA 5DMSA 4O6WA 5LHZA 4X9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCP A;  4H5X A;  4WHL A;  4HCO A;  3HIH A;  2OJX A;  3P34 A;  4X9W A;  2OGQ A;  3BZI A;  4YYP A;  4LKM A;  3P37 A;  2N19 A;  1Q4O A;  3P2Z A;  5DNJ A;  5J19 A;  1Q4K A;  4XB0 A;  3C5L A;  4O56 A;  4X9V A;  1UMW A;  4E9C A;  3P36 A;  3RQ7 A;  3P35 A;  4HY2 A;  5DMV C;  4RS6 A;  4E9D A;  3Q1I A;  4LKL A;  3HIK A;  3FVH A;  4J7B B;  4H71 A;  4WHK A;  4DFW A;  4E67 A;  4HAB A;  4O9W A;  3P2W A;  4WHH A;  5DMS A;  4O6W A;  5LHZ A;  4X9R A; 
#chains in the Genus database with same CATH topology
 4CXS A;  3HIH A;  4N7Z A;  4LKM A;  1E2T A;  3BZI A;  2QZU A;  3P37 A;  1Q4O A;  5DNJ A;  5J19 A;  4XB0 A;  2E50 A;  1N2K A;  1E3C P;  3LXQ A;  4E9C A;  3P36 A;  3HFD A;  3HIK A;  1N2L A;  3ED4 A;  4O9W A;  3FS3 A;  1E1Z P;  2IA9 A;  4NK7 A;  4RCP A;  4WHL A;  2OJX A;  2OGQ A;  4CYR A;  3HMJ G;  4O56 A;  1UMW A;  1AUK A;  2UV8 G;  3RQ7 A;  4HY2 A;  4RS6 A;  1F34 B;  4FDJ A;  2VKZ G;  3FVH A;  1P49 A;  4E67 A;  1A87 A;  1F32 A;  1E2S P;  3KDR A;  3GYW A;  4X9W A;  4YYP A;  3P2Z A;  1HDH A;  1Q4K A;  4CYS A;  2I9Z A;  4N7V A;  4N9J A;  4G7N A;  3P35 A;  4NKB A;  4E9D A;  3Q1I A;  4LKL A;  4J7B B;  4WHK A;  5AJ9 A;  4DFW A;  2I9X A;  3P2W A;  5DMS A;  4O6W A;  5LHZ A;  4X9R A;  1E33 P;  4H5X A;  4HCO A;  3P34 A;  2N19 A;  3C5L A;  4X9V A;  3GYV A;  4FDI A;  4CXU A;  4H71 A;  3LM3 A;  1FSU A;  4CXK A;  4HAB A;  4WHH A;  5DAY A;  5DMV C; 
#chains in the Genus database with same CATH homology
 4RCP A;  4H5X A;  4WHL A;  4HCO A;  3HIH A;  2OJX A;  3P34 A;  4X9W A;  2OGQ A;  3BZI A;  4YYP A;  4LKM A;  3P37 A;  2N19 A;  1Q4O A;  3P2Z A;  5DNJ A;  5J19 A;  1Q4K A;  4XB0 A;  3C5L A;  4O56 A;  4X9V A;  1UMW A;  4E9C A;  3P36 A;  3RQ7 A;  3P35 A;  4HY2 A;  5DMV C;  4RS6 A;  4E9D A;  3Q1I A;  4LKL A;  3HIK A;  3FVH A;  4J7B B;  4H71 A;  4WHK A;  4DFW A;  4E67 A;  4HAB A;  4O9W A;  3P2W A;  4WHH A;  5DMS A;  4O6W A;  5LHZ A;  4X9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...