1E2TA

Arylamine n-acetyltransferase (nat) from salmonella typhimurium
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPFENLDVLLPREIQLDETALEEKLLYARRGGYCFELNGLFERALRDIGFNVRSLLGRVILSHPASLPPRTHRLLLVDVEDEQWIADVGFGGQTLTAPLRLQAEIAQQTPHGEYRLMQEGSTWILQFRHHEHWQSMYCFDLGVQQQSDHVMGNFWSAHWPQSHFRHHLLMCRHLPDGGKLTLTNFHFTRYHQGHAVEQVNVPDVPSLYQLLQQQFGLGVNDVKHGFTEAELAAVMAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-HYDROXYARYLAMINE O-ACETYLTRANSFERASE
publication title Structure of Arylamine N-Acetyltransferase Reveals a Catalytic Triad
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 78
structure length 274
sequence length 274
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.118: N-hydroxyarylamine O-acetyltransferase.
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 1e2tA03
3.30.1120.150 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1e2tA02
4C5PA 1E2TA 3D9WA 4NV8A 4BGFA 1W4TA 3LTWA 4NV7A 4GUZA 2VFBA 1W6FA 1W5RA 2VFCA 4B55A 1GX3A 2BSZA
chains in the Genus database with same CATH superfamily
1ACDA 2FLJA 3SZIA 3NX2A 3FMZA 1SWAA 1YWBA 2FKJA 3EW2A 2OFAA 4Z2OA 1HMSA 4HPDA 3ZI8A 2FGSA 3ED4A 2AT6X 4MIRA 1DC9A 4O3WA 5EDCA 1LF7A 1OSPO 2X56A 3ZW0A 2FR3A 1N4JA 1YWDA 2IZIA 4GGTA 1TOWA 5L8IA 3BSZE 2JU3A 3HOEA 5L8OA 1NP1A 2W2AA 4Y0QA 1RAVA 1AVGI 1SXWA 3NBXX 3S5VA 4HPAA 1SRHA 2X8TA 3C78X 4GRJA 1VWKB 2RTAA 1G85A 1N43A 3FW4A 1EIOA 3P02A 2IZKA 3VG4A 2X8FA 1I04A 1LELA 4ZFXA 4M7MA 2AMMX 3SLJA 2BLGA 1P6PA 4CPFA 2WEXA 1NGLA 3O22A 4CDEA 1W5RA 4CDDA 3FA8A 4ZGFA 4WHIA 5LJCA 1DF8A 1LCZA 2MO5A 1EQDA 4GK9A 2UZ2A 1FENA 4OMWA 4WHHA 2RTIB 2Q2MA 1OPBA 1KQXA 1HMRA 3WOVA 4YGHA 4HPBA 3P6FA 2QOSC 5IO7A 5FFHA 1UMWA 1ML7A 3P6GA 2HYSA 2RTBB 2KW1A 3WZQA 5F58A 4KIIA 2LFOA 1RSTB 4ZHCA 3Q34A 3HOLA 1PBYA 5IRAA 2IZAA 4IAXA 3U9PC 5AEOA 3T2WA 2FTBA 1E1ZP 2WQ9A 1KT5A 2AF5A 3VG5A 4O9SA 2MM3A 1UZ2X 3WJGA 2OGQA 2FRSA 4ZH6A 1SRFA 1X8QA 2WEWA 1VWGB 2QO5A 2RTEB 4Z27A 2R56A 3HWEA 2Z4IA 3APWA 1GT1A 1KT3A 1TW4A 2G7BA 4GNYA 1ERBA 5K68A 3RBYA 1XCAA 1U17A 1A2DA 4CPHB 2OY1O 2FHNX 5AJCA 1ICMA 3U0DA 4CK4A 1BSOA 3WZPA 2HMBA 1EPAA 1NBXA 3OJYC 2C1SA 2R74A 3FIDA 1JQPA 2RA6A 5FAZA 4MVEA 4FBVA 3P2WA 2OL6O 4ORXA 1VYFA 4XMCA 2IZLB 1BEBA 4ZHGA 1QG5A 4YBPA 2OFBA 3T6FA 5HA1A 1TXLA 2GC9A 1D2UA 1EPBA 1Q4OA 1TVQA 1VYOA 3WVMA 3PH6A 4J7BB 4BCSA 1N2LA 1SWKA 4RUNA 1BM5A 1E00A 2W2BA 3RZYA 2CZTA 1SLEB 4OMXA 1PEEA 1NP4A 4A60A 1MX8A 3MX7A 4AZRA 4HCOA 4NK7A 2KT4B 1VWDB 3CWKA 2IZEB 4ORWA 5BVSA 2RTLA 2I9ZA 3WJFA 1VWEB 4TKHA 1Z24A 3UAQA 3HWGA 1AELA 4QQ1A 3F9DA 4WHLA 3PDFA 1BJ7A 4BX7B 2QMIA 2GTLM 3GAQA 3B2JA 4LKLA 3WXQA 3VGWA 1SWEA 3RDSA 3CKFA 1IJ8A 3C5LA 4AYHA 4I3CA 1CBQA 3BX8A 1SA8A 3B2LA 4X9RA 1Y55X 1QY2A 1F34B 2BS6A 1SREA 1YWAA 1LIEA 4IBAA 3HWDA 4EFGA 1YUPA 1CRBA 4Z2VA 4NV8A 1UYNX 3GE2A 4DFWA 1YP7A 1KT6A 4LZUA 1SLDB 2KTDA 4EDEA 2X4MA 1X8UA 1JYDA 4CXSA 2IZGB 1LIFA 4CPIA 1YP6A 1HQQA 4U46A 2FWVA 2Z4HA 4RCPA 1DZPA 1BRPA 4GGRA 1LUQA 1SWGA 4R0BA 1Y0GA 4G7NA 2CZUA 4MVKA 4GNWA 1K24A 1QABE 3NP1A 1A18A 2K23A 2JU8A 1N9YA 4ZCBA 4KCAA 4C5PA 1B56A 5DAYA 1KL5A 5B10O 2VFBA 4N7ZA 4BX6B 5F6ZA 4DQ4A 5DNJA 2X32A 5LJKA 3NQKA 1Y9TA 5HTDA 2ZAGA 4GU8A 4XMEA 4A1HA 4QGXA 4E9DA 5HZQA 4OS3A 1R0UA 1SWPA 5IXGA 5AJBA 2RTRB 3VG6A 2L67A 1CJ5A 4YDBA 1HBPA 4O56A 3X00A 1N0SA 1MVGA 1VWCB 1KZXA 2RTDB 1KT4A 3AEHA 4HABA 1SWTA 1TOUA 3FEKA 1AUKA 2WUTA 4AZPA 3TZSA 4FBOA 2VFCA 3APVA 5HZ6A 4AZMA 2RCTA 2NNDA 1LIDA 3FEPA 1YWCA 4QYPA 3APXA 5HZ5A 1PMPA 1VYGA 5J19A 4U8UM 2Y32A 3JSQA 2BHVA 3NQ3A 3GYVA 1I06A 1JJUA 4GDZA 4XB0A 1BSQA 1CBIA 3K3LA 4O3XB 4TLJA 1GT4A 1ALBA 1E33P 3STMX 3LHNA 3WYQA 4RUUA 4ZH9A 4LQZA 1SRIA 4YFRA 1EALA 4OELA 2AT8X 4CDFA 4OEMA 1OBPA 3EM0A 5EEDA 4MEEA 1LICA 2RTHB 4NP1A 4NYRA 2K62A 4GGZA 3RY1A 1KT7A 3NX1A 1GXAA 1FEMA 3KDRA 1KL4A 2X8SA 2RD7C 3BRNA 1VWPB 5FQ6E 2Q9SA 4LKMA 3IA8A 2ACPX 2ANSA 2WPUA 4WBKA 1GX9A 2I5ZO 3T1DA 4ZHFA 1EUOA 1I78A 4QRLA 2HNXA 2BT9A 4ZR2A 4JGLA 4BBOA 5DMSA 4DNEA 4IMOA 2N93A 3BU1A 1S7DA 1E06A 1AVEA 2WWPA 4NYQA 1X89A 2YG2A 4GE1A 3D95A 2OVEA 2IA9A 1RXJA 4A1YA 4LKPA 2L5PA 3WJCA 1H91A 3RDXA 1ZNGA 4Z6JA 4Y0SA 5B11O 4PSQA 3ZW1B 5LKEA 3EC5A 2OZQA 2BS5A 2RN4A 2A2GA 3BZIA 3RQ7A 1PBOA 1N2KA 4ID2A 1HBQA 4XMGA 2IZJA 1EIIA 2A13A 3VHHA 4KH8A 5LJDA 4QYNA 3BS2A 2HZRA 1MDCA 5DPQA 3S5XA 2ZAIA 2I9XA 1W4TA 3WYPA 2F01A 1O8VA 2ACOA 4BGFA 2LA7A 1QY0A 4ODDA 4BOEA 2FS7A 2DM5A 1U0XA 3ZW2A 4WFUA 5CHKA 1EXSA 2OJXA 2JOZA 1FJ1E 1FTPA 2LBVA 4O3YA 2M4LA 3L4RA 4WFVA 3FENA 1X8NA 1SWHA 1IKEA 3WZOA 4IMNA 2POAA 4B55A 3HIKA 1E5PA 2QO4A 1KZWA 1SWNA 2G78A 4H71A 1IW2A 5H9AA 1MM9A 4I6SA 2IZFB 5DG4A 4L3RA 1ZNLA 2L9CA 3VU1A 2HKDA 3PK2A 4OS8A 2MHDA 3RKGA 1VWBB 1IFCA 5HAEA 3HK1A 3IFBA 4XMDA 3SZHA 1SMPI 2R73A 4DQ3A 3CMPA 2PY1A 1STSB 2IFBA 5HTEA 1P49A 3TGBA 1MUPA 4COTA 1NQNA 3T6LA 4ON1A 4NV7A 4I9SA 4CV7A 3SLTA 3BY0A 4X9WA 1SWOA 4BX5A 5AQ6A 5CYBA 4I95A 5K67A 2XSTA 5LJEA 3OBLA 4BJ8A 1GX3A 2YMSA 4EQAC 5LHZA 1VWNB 3UEXA 4NLJA 1DZMA 2O62A 5JD2A 2WSJA 2HLVA 3RDQA 1WUBA 3ZWEA 5F2BA 4KC8A 1DFVA 2AL0X 3UEVA 1SY1A 3HIHA 3WJBA 5EEEA 1Y52X 3TGCA 4TNNA 4O49A 4UU2A 3MM0A 1HN2A 5LJGA 2OF8A 1A87A 3AKMA 2QCBA 3FA6A 1JMZA 4ZJ0A 5CSEA 1VWQB 3D4RA 1HQPA 1SRJA 5B27A 3ZUOA 1GT3A 4YCEA 4MVLA 1YIVA 1MX7A 3EBWA 2F73A 3P37A 1D3SA 3RE6A 4CYSA 4YFPA 2AT0X 5HBSA 5EDBA 3P6EA 1VWIB 2VDFA 5LKFA 2N19A 1HXZA 2OFRX 4ALBA 2FT9A 2OVDA 3KFFA 1HXLA 4CXKA 3D9WA 3P2ZA 4DCBA 1SY0A 3P24A 4ZHHA 3S60A 1BWYA 2A5CA 4INNA 1B4MA 4I3DA 1PM1X 3RE5A 1IIUA 4TQ2A 4ES7A 1L6MA 2KTSA 5HWZA 4OS0A 2GJ5A 5KIDA 2FHLA 1IFBA 3H3IA 4MVIA 3CQNA 1XKIA 1SWJA 1DZKA 2RTMA 4Y0PA 4FDJA 1QWDA 4YMYA 4X9VA 1QFVA 4YH0A 1OEKA 2DJGA 5IO6A 5BVQA 1FDQA 3MG5A 5B5FA 4QGVA 2JMBA 3AUMO 2GTLO 4YCHA 3FR2A 3Q6LA 4N7DA 1K3BA 2G79A 3KQ0A 2Y3FA 4ORUA 4HPCA 4GJSA 1JJXA 3CQRA 4CXUA 1I9HA 4YYPA 3BDRA 2Q4NA 3FR5A 3D97A 1U18A 4M6SA 1AB0A 4I9RA 3MVFA 3KFHA 5DMVC 3OE3A 4K19A 2NNQA 1QFTA 1ZNHA 3VG3A 1HY2A 4YGZA 1E2SP 3FLLA 3CBSA 4PJ2A 3G7XA 1SWQA 4JHQA 4YFQA 2I5VO 3PH5A 5H8TA 4CPHA 5IRWA 1E02A 4ORYA 5BVTA 1QQSA 2OY7A 1SWLA 3FIQA 5F1EA 5H9KA 1SWDA 3NPOA 4IAWA 1JJJA 1ZNEA 1DV9A 1KOIA 2JW1A 4OKAA 4YGGA 4EXZA 5KHPA 2RCQA 2RTFB 4Z28A 1SXYA 3VE1A 2CBSA 3B2KA 1SXXA 2GH7A 2CBRA 5IO5A 3PP6A 1SY2A 3MBTA 2RTOB 2X45A 1EW3A 4IRWA 3FW5A 3FDCA 4IB8A 4CSBA 2X55A 2OY8A 4FQBB 5C0NA 3P6HA 2A5BA 4GETA 2PI3O 2ZSCA 1MOYA 3RDMA 3GYWA 2RTPB 1GKAB 2RTKA 4GDAA 3VG2A 4NW4A 3KFIA 1SLGB 3SOTA 5JR8A 1KL3A 1OEJA 4H5XA 5LJHA 2X46A 5AJ9A 2AH7X 2P8GA 1WBIA 4N9JA 5EZ2A 2RQ0A 2E4JA 1VWOB 3EMMA 4IB9A 3F8AA 3FA7A 1X8PA 5D4AA 1I05A 1SXUA 3EW1A 4Y0RA 4YVBA 1EI5A 4Y59A 2RTJA 3PPTA 1Y53X 3AKNA 5D8JA 3NR3A 2JU7A 1DF3A 2Q39A 5HZ8A 3JS1A 4U8UO 1S44A 1PTSA 3C77X 1T0VA 1KQWA 4Z2PA 4U3QA 2RTCB 3I17A 4Y5DA 4BX7A 1N9MA 1GM6A 4U9CA 3BLGA 4NNSA 1O1VA 2OL7A 5EPQA 5D45A 1OPAA 1JV4A 3NQ9A 2OYBO 5F6BA 4ORRA 3PECA 1OBUA 3CKGA 4IB7A 2C4IA 3VHMA 3RY2A 2IZBA 5FQ8E 2OVSA 4GH7A 1SWCA 2HZQA 1VWJB 4JNJA 1VWMB 1N7YA 4AZNA 4AZQA 5L3YA 3HMJG 2AT5X 4E67A 1MK5A 1NDJA 2C1QA 1SWRA 5BYPA 4FBRA 1Q4KA 4HY2A 3DTQA 2Y3EA 5HA0A 4YBUA 4I60A 4O4XA 5F7GA 3WZNA 2L68A 2RTNB 1UYOX 4QZTA 4ZGUA 2XKLA 3UEWA 2QZUA 1VWFB 1STPA 3LXQA 2FR2A 4BX6A 3HWFA 4I3BA 1KGLA 2A3FX 2E50A 5FQ7E 3P36A 4CYRA 1T8VA 2QOMA 3VHIA 3SAOA 3CR6A 1LPJA 1HDHA 1AVDA 1RXKA 1RXHA 2LKKA 1STRB 1X71A 2UYWA 3HPEA 2G5LA 3APUA 1SY3A 1ADLA 4NKBA 5KICA 1LNMA 4AW8A 1FSUA 3STKA 1SRGA 4N7VA 4O4SA 5L8NA 1ICNA 4XMHA 2IZDB 4L1NA 2QM9A 2BSZA 3P34A 5HZ9A 4HFOA 2AT3X 4KC7A 2ASNX 3LV4A 1GGLA 2FS6A 3PEDA 2NP1A 3EBKA 4IABA 1KFFA 4GD9A 4FDIA 4D6AA 2RTGB 5B5GA 4ML7B 2A2UA 3STNA 5CE4A 2A8GA 2MJIA 5FENA 1LKEA 2NNEA 3OD9A 3WJDA 1CBSA 2CM4A 1E2TA 4GJVA 3ZQ3A 3ELZA 2BC3A 4O9WA 4TKJA 2VKZG 3FELA 2DJFA 4QNIA 1AQBA 4LZVA 2LB6A 1O1UA 3Q1IA 1NQMA 2X34A 3WJEA 1RBPA 2EU7X 3VE2A 4NLIA 3I0AA 1FELA 1GKAA 3UEUA 3KFGA 5IRUA 4O4UA 3ZW0B 3LTWA 4TJZA 4IB6A 4AZOA 2GTFX 4BVMA 3BX7A 1GT5A 1SWFA 2G8CO 3FR4A 3QKGA 1RSUB 1W6FA 1B0OA 2MWHA 2A0AA 1ZNKA 1LCWA 1KXOA 1HMTA 4A8ZA 1SLFB 1BSYA 4KT5A 1VWRB 1G7NA 1LIBA 1OBQA 4FGIB 5B29A 2JN3A 3B2HA 1JZUA 1B8EA 4TKBA 4BQUA 1A57A 3D96A 3TF6A 1I4UA 2OVAA 5HCCC 3ZW1A 1JBHA 2OY5O 1ZNDA 2WQAE 3BU9A 3RSWA 3NADA 3LM3A 3KVNA 2GTLN 2CAMA 3E3CA 4QZUA 3ELXA 1E3CP 1BRQA 3EYCA 4YDAA 1SWUA 3P35A 4O3ZA 3RDUA 1FE3A 1LDQA 3VPJE 1LDOA 1JIWI 1VWLB 3FS3A 4UU3A 4ORSA 3ZZVA 1S2PA 2JGSA 4YKMA 2KD2A 2QO6A 2FKGA 4HWMA 2W2FA 1IKJA 3PQUA 3T2XA 4D6BA 4N7CA 1A3YA 3B2IA 1F32A 4QAEA 5H9LA 5B2AO 2Q2PA 4QGWA 3O19A 4YKOA 4O4OA 3FA9A 4NNTA 1UREA 4XMFA 2RTQB 3F6ZB 3S26A 4O6WA 1LCVA 5LJBA 3N91A 2WR6A 3VG7A 4WHKA 5D47A 3JQOA 2AVIA 5H9NA 4RS6A 4E9CA 2LBAA 1SWBA 2ALLX 2UV8G 3HFDA 5HCEC 2F09A 3C76X 3QQ2A 3FVHA 4MISA 5D48A 1RLBE 3U03A 4EEJA 1SWSA 4ZHDA 2MF6A 4CDCA 1BLRA 4GKCA 1VPRA 2CM9A 1MEPA 4CPEA 2IZCB 3TGAA 1GX8A 4BX5B 4GZVA 1JYJA 4JO6A 1CBRA 1ERXA 3DSZA 3FYFA 3SZJA 2OFMX 4GUZA 1G74A 1NC9A 3WBGA 2OF9A 1ZRYA 1VWHB 3P6DA 4EKVA 3HTYA 3PQSA 3RDOA 3V8UA 3KZAA 1DZJA 3ZUIA 1VWAB 1BBPA 2OL8O 1X8OA 5B3MO 4ARHA 4ALOA 1LFOA 1OEEA 3SLOA 4U8UN 5K06A 3P6CA 1QY1A 1Y9LA 1JMXA 2AKQA 1T68X 2IZHB 5HCDC 3RWXA 3O2YA 1G5WA 4LKTA 3CBCA
chains in the Genus database with same CATH topology
5CVMA 4PP1A 4Q8HA 4QRXA 1QMYA 1GMYA 2E50A 2NQIA 1XKGA 1DEUA 3U8EA 4CYRA 1EF7A 4YYQA 1EWLA 3ED4A 1F2BA 1HDHA 1GLOA 4QRVA 1CJLA 4MSXA 2CIOA 1MHWA 1QDQA 1BY8A 2BDLA 2PBHA 4MZSA 1ICFA 2E02A 2ACTA 4CYSA 4NKBA 3ERVA 3BOWA 3LFYA 1CB5A 1U9VA 3S3RA 1AU2A 8PCHA 1YT7A 3KSEA 3O0UA 1AUKA 3C9EA 1PPPA 2VFCA 3KW9A 4PP2E 2OULA 1FSUA 3BPFA 2AIMA 3N3KA 2IBIA 2PREA 1GECE 3AI8A 5JA7A 2YJBA 2DC6A 3IHPA 4N7VA 4DMXA 5EGWA 2R9OA 3CH3X 2DZYA 1Q6KA 3NHEA 4CXKA 2BSZA 1BP4A 2AYNA 2AU1A 3D9WA 1NB5A 2DC7A 3M99A 5CHTA 3HWNA 5PADA 3E1ZB 3PNRA 4AXLA 2G8EA 2R9CA 3USVA 4I07A 2P86A 1IWDA 2Y5BA 4PI3A 5FPWA 2BDZA 4W5CA 1X9YA 2H7JA 1NL6A 2E00A 1AIMA 3GYVA 4FDIA 2DCAA 1W5RA 2DCDA 3B79A 3BCNA 1BQIA 1GCBA 1PCIA 2AUZA 1MDWA 2F1GA 2C0YA 2FT2A 3MORA 4P6EA 2HH5A 1Y4HA 2AYOA 4BS5A 3H8CA 1E33P 3P5XA 4FJCA 4XUIA 1EWPA 4HWYA 4PADA 3CBKA 2GHUA 2FRAA 3KWBX 2VHFA 3OVXA 1E2TA 1PADA 4CDFB 2DJFB 3CH2X 1AECA 1AU3A 3K8UA 4OELA 2VKZG 1CVZA 4OEMA 4W4UA 1HUCB 7PCKA 2AVWA 3WXEA 2AUXA 4FDJA 1ME3A 4YYSA 2HD5A 6PADA 3N4CA 1E1ZP 4QH6A 3KDRA 3MHSA 2ATOA 1PE6A 4N79A 1M6DA 1K3BB 3MTNA 3BWKA 1YK8A 1YVBA 2PADA 1VSNA 3LTWA 4G54A 2VHSA 2DZZA 4N4ZA 2OP3A 4CXUA 1PPNA 1EWMA 3IV2A 3K9MA 3V6CA 2XU1A 5F02A 3KKUA 1PPDA 2G6DA 1W6FA 2YJ9A 4RY2A 1NLJA 2YJ2A 1CS8A 2FUDA 3MHHA 4AXMA 1AYUA 4QRGA 1E2SP 1AU4A 3IOQA 3OVZA 2FO5A 5A24A 1KFXL 1ITOA 3QSDA 2XU5A 4XR7A 1F2CA 2R9FA 2IPPB 2CB5A 3OF9A 4I05A 4WA6A 2G7YA 1YALA 4ZUXU 2DC9A 1KFUL 4YVAA 1CTEA 1PPOA 1AYWA 4CDEB 1NQCA 3HHAA 2P7UA 4CDDB 1N2KA 1U9XA 3I06A 3LM3A 3S3QA 3P5UA 1SNKA 1AU0A 1ME4A 5CHVA 1JQPA 3HHIA 1DF0A 4BSQA 1F29A 3D6SA 3KWZA 9PAPA 1ATKA 1E3CP 1W4TA 1TU6A 3ZUAA 2FQ9A 1BGOA 4BGFA 2WBFX 3K24A 2B1NA 2OZ2A 2NQGA 4FK5A 1CPJA 1Y08A 3FS3A 4N8WA 4YV8A 1MEGA 1VJVA 1QXPA 3LXSA 5JH3A 2DJGB 1KHQA 1N2LA 4YYVA 3GYWA 2HHNA 1POPA 1ZCMA 1MEMA 1S4VA 1FH0A 3RVXA 1NB3A 1MIRA 3GCBA 4FIPA 4B55A 2DC8A 4K7CA 4CZWA 5AJ9A 1CSBB 2FTDA 4N9JA 4NK7A 3N3GA 2E01A 3I3TA 3IUTA 3IMAA 4I04A 2YJ8A 4MZOA 2PNSA 3H89A 1SP4B 2NQDB 3P5WA 3CBJA 3WXFA 4BQVA 1TLOA 3F75A 2ARYA 4W5BA 3H6SA 2UV8G 2F7DA 2R9NA 3HFDA 1QOLA 1KHPA 4X6HA 1PBHA 4Q8GA 2YJCA 3PDFA 5CVOB 3TNXA 3F5VA 4CDCB 3H8BA 3BPMA 1CQDA 3QT4A 4YYWA 3QJ3A 2AS8A 4BPVA 1THEA 1P49A 3H7DA 2O6XA 4NV7A 2XU4A 2G8JA 3HD3A 2GFOA 3PBHA 1ZIVA 4P6GA 5K16A 3WXGA 3V6EA 4YYRA 3OF8A 1NPZA 2P0RA 4NV8A 4GUZA 5J94A 1GX3A 1PXVA 2R6NA 3BC3A 1TL9A 2FYEA 1A6RA 3O1GA 2Y6EA 1U5IA 1CV8A 2JQFR 3IEJA 1STFE 1U9WA 2B1MA 4QBBA 4CXSA 3KFQA 4YYUA 2FRQA 4X6IA 1F2AA 3P5VA 3HMJG 1MS6A 5CVNB 2NQAA 1AYVA 1YK7A 1U9QX 3DF0A 2XU3A 4DMYA 4G7NA 3OISA 2E03A 1KXRA 4KLBA 2JQGR 1O0EA 4X6JA 3RVVA 4BS6A 2R9MA 2DCCA 5EF4A 3KX1A 4C5PA 2HXZA 1PIPA 2QZUA 5DAYA 3PW3A 2VFBA 4N7ZA 2DCBA 1EWOA 3RVWA 3LXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5P A;  1E2T A;  3D9W A;  4NV8 A;  4BGF A;  1W4T A;  3LTW A;  4NV7 A;  4GUZ A;  2VFB A;  1W6F A;  1W5R A;  2VFC A;  4B55 A;  1GX3 A;  2BSZ A; 
#chains in the Genus database with same CATH topology
 1ACD A;  2FLJ A;  3SZI A;  3NX2 A;  3FMZ A;  1SWA A;  1YWB A;  2FKJ A;  3EW2 A;  2OFA A;  4Z2O A;  1HMS A;  4HPD A;  3ZI8 A;  2FGS A;  3ED4 A;  2AT6 X;  4MIR A;  1DC9 A;  4O3W A;  5EDC A;  1LF7 A;  1OSP O;  2X56 A;  3ZW0 A;  2FR3 A;  1N4J A;  1YWD A;  2IZI A;  4GGT A;  1TOW A;  5L8I A;  3BSZ E;  2JU3 A;  3HOE A;  5L8O A;  1NP1 A;  2W2A A;  4Y0Q A;  1RAV A;  1AVG I;  1SXW A;  3NBX X;  3S5V A;  4HPA A;  1SRH A;  2X8T A;  3C78 X;  4GRJ A;  1VWK B;  2RTA A;  1G85 A;  1N43 A;  3FW4 A;  1EIO A;  3P02 A;  2IZK A;  3VG4 A;  2X8F A;  1I04 A;  1LEL A;  4ZFX A;  4M7M A;  2AMM X;  3SLJ A;  2BLG A;  1P6P A;  4CPF A;  2WEX A;  1NGL A;  3O22 A;  4CDE A;  1W5R A;  4CDD A;  3FA8 A;  4ZGF A;  4WHI A;  5LJC A;  1DF8 A;  1LCZ A;  2MO5 A;  1EQD A;  4GK9 A;  2UZ2 A;  1FEN A;  4OMW A;  4WHH A;  2RTI B;  2Q2M A;  1OPB A;  1KQX A;  1HMR A;  3WOV A;  4YGH A;  4HPB A;  3P6F A;  2QOS C;  5IO7 A;  5FFH A;  1UMW A;  1ML7 A;  3P6G A;  2HYS A;  2RTB B;  2KW1 A;  3WZQ A;  5F58 A;  4KII A;  2LFO A;  1RST B;  4ZHC A;  3Q34 A;  3HOL A;  1PBY A;  5IRA A;  2IZA A;  4IAX A;  3U9P C;  5AEO A;  3T2W A;  2FTB A;  1E1Z P;  2WQ9 A;  1KT5 A;  2AF5 A;  3VG5 A;  4O9S A;  2MM3 A;  1UZ2 X;  3WJG A;  2OGQ A;  2FRS A;  4ZH6 A;  1SRF A;  1X8Q A;  2WEW A;  1VWG B;  2QO5 A;  2RTE B;  4Z27 A;  2R56 A;  3HWE A;  2Z4I A;  3APW A;  1GT1 A;  1KT3 A;  1TW4 A;  2G7B A;  4GNY A;  1ERB A;  5K68 A;  3RBY A;  1XCA A;  1U17 A;  1A2D A;  4CPH B;  2OY1 O;  2FHN X;  5AJC A;  1ICM A;  3U0D A;  4CK4 A;  1BSO A;  3WZP A;  2HMB A;  1EPA A;  1NBX A;  3OJY C;  2C1S A;  2R74 A;  3FID A;  1JQP A;  2RA6 A;  5FAZ A;  4MVE A;  4FBV A;  3P2W A;  2OL6 O;  4ORX A;  1VYF A;  4XMC A;  2IZL B;  1BEB A;  4ZHG A;  1QG5 A;  4YBP A;  2OFB A;  3T6F A;  5HA1 A;  1TXL A;  2GC9 A;  1D2U A;  1EPB A;  1Q4O A;  1TVQ A;  1VYO A;  3WVM A;  3PH6 A;  4J7B B;  4BCS A;  1N2L A;  1SWK A;  4RUN A;  1BM5 A;  1E00 A;  2W2B A;  3RZY A;  2CZT A;  1SLE B;  4OMX A;  1PEE A;  1NP4 A;  4A60 A;  1MX8 A;  3MX7 A;  4AZR A;  4HCO A;  4NK7 A;  2KT4 B;  1VWD B;  3CWK A;  2IZE B;  4ORW A;  5BVS A;  2RTL A;  2I9Z A;  3WJF A;  1VWE B;  4TKH A;  1Z24 A;  3UAQ A;  3HWG A;  1AEL A;  4QQ1 A;  3F9D A;  4WHL A;  3PDF A;  1BJ7 A;  4BX7 B;  2QMI A;  2GTL M;  3GAQ A;  3B2J A;  4LKL A;  3WXQ A;  3VGW A;  1SWE A;  3RDS A;  3CKF A;  1IJ8 A;  3C5L A;  4AYH A;  4I3C A;  1CBQ A;  3BX8 A;  1SA8 A;  3B2L A;  4X9R A;  1Y55 X;  1QY2 A;  1F34 B;  2BS6 A;  1SRE A;  1YWA A;  1LIE A;  4IBA A;  3HWD A;  4EFG A;  1YUP A;  1CRB A;  4Z2V A;  4NV8 A;  1UYN X;  3GE2 A;  4DFW A;  1YP7 A;  1KT6 A;  4LZU A;  1SLD B;  2KTD A;  4EDE A;  2X4M A;  1X8U A;  1JYD A;  4CXS A;  2IZG B;  1LIF A;  4CPI A;  1YP6 A;  1HQQ A;  4U46 A;  2FWV A;  2Z4H A;  4RCP A;  1DZP A;  1BRP A;  4GGR A;  1LUQ A;  1SWG A;  4R0B A;  1Y0G A;  4G7N A;  2CZU A;  4MVK A;  4GNW A;  1K24 A;  1QAB E;  3NP1 A;  1A18 A;  2K23 A;  2JU8 A;  1N9Y A;  4ZCB A;  4KCA A;  4C5P A;  1B56 A;  5DAY A;  1KL5 A;  5B10 O;  2VFB A;  4N7Z A;  4BX6 B;  5F6Z A;  4DQ4 A;  5DNJ A;  2X32 A;  5LJK A;  3NQK A;  1Y9T A;  5HTD A;  2ZAG A;  4GU8 A;  4XME A;  4A1H A;  4QGX A;  4E9D A;  5HZQ A;  4OS3 A;  1R0U A;  1SWP A;  5IXG A;  5AJB A;  2RTR B;  3VG6 A;  2L67 A;  1CJ5 A;  4YDB A;  1HBP A;  4O56 A;  3X00 A;  1N0S A;  1MVG A;  1VWC B;  1KZX A;  2RTD B;  1KT4 A;  3AEH A;  4HAB A;  1SWT A;  1TOU A;  3FEK A;  1AUK A;  2WUT A;  4AZP A;  3TZS A;  4FBO A;  2VFC A;  3APV A;  5HZ6 A;  4AZM A;  2RCT A;  2NND A;  1LID A;  3FEP A;  1YWC A;  4QYP A;  3APX A;  5HZ5 A;  1PMP A;  1VYG A;  5J19 A;  4U8U M;  2Y32 A;  3JSQ A;  2BHV A;  3NQ3 A;  3GYV A;  1I06 A;  1JJU A;  4GDZ A;  4XB0 A;  1BSQ A;  1CBI A;  3K3L A;  4O3X B;  4TLJ A;  1GT4 A;  1ALB A;  1E33 P;  3STM X;  3LHN A;  3WYQ A;  4RUU A;  4ZH9 A;  4LQZ A;  1SRI A;  4YFR A;  1EAL A;  4OEL A;  2AT8 X;  4CDF A;  4OEM A;  1OBP A;  3EM0 A;  5EED A;  4MEE A;  1LIC A;  2RTH B;  4NP1 A;  4NYR A;  2K62 A;  4GGZ A;  3RY1 A;  1KT7 A;  3NX1 A;  1GXA A;  1FEM A;  3KDR A;  1KL4 A;  2X8S A;  2RD7 C;  3BRN A;  1VWP B;  5FQ6 E;  2Q9S A;  4LKM A;  3IA8 A;  2ACP X;  2ANS A;  2WPU A;  4WBK A;  1GX9 A;  2I5Z O;  3T1D A;  4ZHF A;  1EUO A;  1I78 A;  4QRL A;  2HNX A;  2BT9 A;  4ZR2 A;  4JGL A;  4BBO A;  5DMS A;  4DNE A;  4IMO A;  2N93 A;  3BU1 A;  1S7D A;  1E06 A;  1AVE A;  2WWP A;  4NYQ A;  1X89 A;  2YG2 A;  4GE1 A;  3D95 A;  2OVE A;  2IA9 A;  1RXJ A;  4A1Y A;  4LKP A;  2L5P A;  3WJC A;  1H91 A;  3RDX A;  1ZNG A;  4Z6J A;  4Y0S A;  5B11 O;  4PSQ A;  3ZW1 B;  5LKE A;  3EC5 A;  2OZQ A;  2BS5 A;  2RN4 A;  2A2G A;  3BZI A;  3RQ7 A;  1PBO A;  1N2K A;  4ID2 A;  1HBQ A;  4XMG A;  2IZJ A;  1EII A;  2A13 A;  3VHH A;  4KH8 A;  5LJD A;  4QYN A;  3BS2 A;  2HZR A;  1MDC A;  5DPQ A;  3S5X A;  2ZAI A;  2I9X A;  1W4T A;  3WYP A;  2F01 A;  1O8V A;  2ACO A;  4BGF A;  2LA7 A;  1QY0 A;  4ODD A;  4BOE A;  2FS7 A;  2DM5 A;  1U0X A;  3ZW2 A;  4WFU A;  5CHK A;  1EXS A;  2OJX A;  2JOZ A;  1FJ1 E;  1FTP A;  2LBV A;  4O3Y A;  2M4L A;  3L4R A;  4WFV A;  3FEN A;  1X8N A;  1SWH A;  1IKE A;  3WZO A;  4IMN A;  2POA A;  4B55 A;  3HIK A;  1E5P A;  2QO4 A;  1KZW A;  1SWN A;  2G78 A;  4H71 A;  1IW2 A;  5H9A A;  1MM9 A;  4I6S A;  2IZF B;  5DG4 A;  4L3R A;  1ZNL A;  2L9C A;  3VU1 A;  2HKD A;  3PK2 A;  4OS8 A;  2MHD A;  3RKG A;  1VWB B;  1IFC A;  5HAE A;  3HK1 A;  3IFB A;  4XMD A;  3SZH A;  1SMP I;  2R73 A;  4DQ3 A;  3CMP A;  2PY1 A;  1STS B;  2IFB A;  5HTE A;  1P49 A;  3TGB A;  1MUP A;  4COT A;  1NQN A;  3T6L A;  4ON1 A;  4NV7 A;  4I9S A;  4CV7 A;  3SLT A;  3BY0 A;  4X9W A;  1SWO A;  4BX5 A;  5AQ6 A;  5CYB A;  4I95 A;  5K67 A;  2XST A;  5LJE A;  3OBL A;  4BJ8 A;  1GX3 A;  2YMS A;  4EQA C;  5LHZ A;  1VWN B;  3UEX A;  4NLJ A;  1DZM A;  2O62 A;  5JD2 A;  2WSJ A;  2HLV A;  3RDQ A;  1WUB A;  3ZWE A;  5F2B A;  4KC8 A;  1DFV A;  2AL0 X;  3UEV A;  1SY1 A;  3HIH A;  3WJB A;  5EEE A;  1Y52 X;  3TGC A;  4TNN A;  4O49 A;  4UU2 A;  3MM0 A;  1HN2 A;  5LJG A;  2OF8 A;  1A87 A;  3AKM A;  2QCB A;  3FA6 A;  1JMZ A;  4ZJ0 A;  5CSE A;  1VWQ B;  3D4R A;  1HQP A;  1SRJ A;  5B27 A;  3ZUO A;  1GT3 A;  4YCE A;  4MVL A;  1YIV A;  1MX7 A;  3EBW A;  2F73 A;  3P37 A;  1D3S A;  3RE6 A;  4CYS A;  4YFP A;  2AT0 X;  5HBS A;  5EDB A;  3P6E A;  1VWI B;  2VDF A;  5LKF A;  2N19 A;  1HXZ A;  2OFR X;  4ALB A;  2FT9 A;  2OVD A;  3KFF A;  1HXL A;  4CXK A;  3D9W A;  3P2Z A;  4DCB A;  1SY0 A;  3P24 A;  4ZHH A;  3S60 A;  1BWY A;  2A5C A;  4INN A;  1B4M A;  4I3D A;  1PM1 X;  3RE5 A;  1IIU A;  4TQ2 A;  4ES7 A;  1L6M A;  2KTS A;  5HWZ A;  4OS0 A;  2GJ5 A;  5KID A;  2FHL A;  1IFB A;  3H3I A;  4MVI A;  3CQN A;  1XKI A;  1SWJ A;  1DZK A;  2RTM A;  4Y0P A;  4FDJ A;  1QWD A;  4YMY A;  4X9V A;  1QFV A;  4YH0 A;  1OEK A;  2DJG A;  5IO6 A;  5BVQ A;  1FDQ A;  3MG5 A;  5B5F A;  4QGV A;  2JMB A;  3AUM O;  2GTL O;  4YCH A;  3FR2 A;  3Q6L A;  4N7D A;  1K3B A;  2G79 A;  3KQ0 A;  2Y3F A;  4ORU A;  4HPC A;  4GJS A;  1JJX A;  3CQR A;  4CXU A;  1I9H A;  4YYP A;  3BDR A;  2Q4N A;  3FR5 A;  3D97 A;  1U18 A;  4M6S A;  1AB0 A;  4I9R A;  3MVF A;  3KFH A;  5DMV C;  3OE3 A;  4K19 A;  2NNQ A;  1QFT A;  1ZNH A;  3VG3 A;  1HY2 A;  4YGZ A;  1E2S P;  3FLL A;  3CBS A;  4PJ2 A;  3G7X A;  1SWQ A;  4JHQ A;  4YFQ A;  2I5V O;  3PH5 A;  5H8T A;  4CPH A;  5IRW A;  1E02 A;  4ORY A;  5BVT A;  1QQS A;  2OY7 A;  1SWL A;  3FIQ A;  5F1E A;  5H9K A;  1SWD A;  3NPO A;  4IAW A;  1JJJ A;  1ZNE A;  1DV9 A;  1KOI A;  2JW1 A;  4OKA A;  4YGG A;  4EXZ A;  5KHP A;  2RCQ A;  2RTF B;  4Z28 A;  1SXY A;  3VE1 A;  2CBS A;  3B2K A;  1SXX A;  2GH7 A;  2CBR A;  5IO5 A;  3PP6 A;  1SY2 A;  3MBT A;  2RTO B;  2X45 A;  1EW3 A;  4IRW A;  3FW5 A;  3FDC A;  4IB8 A;  4CSB A;  2X55 A;  2OY8 A;  4FQB B;  5C0N A;  3P6H A;  2A5B A;  4GET A;  2PI3 O;  2ZSC A;  1MOY A;  3RDM A;  3GYW A;  2RTP B;  1GKA B;  2RTK A;  4GDA A;  3VG2 A;  4NW4 A;  3KFI A;  1SLG B;  3SOT A;  5JR8 A;  1KL3 A;  1OEJ A;  4H5X A;  5LJH A;  2X46 A;  5AJ9 A;  2AH7 X;  2P8G A;  1WBI A;  4N9J A;  5EZ2 A;  2RQ0 A;  2E4J A;  1VWO B;  3EMM A;  4IB9 A;  3F8A A;  3FA7 A;  1X8P A;  5D4A A;  1I05 A;  1SXU A;  3EW1 A;  4Y0R A;  4YVB A;  1EI5 A;  4Y59 A;  2RTJ A;  3PPT A;  1Y53 X;  3AKN A;  5D8J A;  3NR3 A;  2JU7 A;  1DF3 A;  2Q39 A;  5HZ8 A;  3JS1 A;  4U8U O;  1S44 A;  1PTS A;  3C77 X;  1T0V A;  1KQW A;  4Z2P A;  4U3Q A;  2RTC B;  3I17 A;  4Y5D A;  4BX7 A;  1N9M A;  1GM6 A;  4U9C A;  3BLG A;  4NNS A;  1O1V A;  2OL7 A;  5EPQ A;  5D45 A;  1OPA A;  1JV4 A;  3NQ9 A;  2OYB O;  5F6B A;  4ORR A;  3PEC A;  1OBU A;  3CKG A;  4IB7 A;  2C4I A;  3VHM A;  3RY2 A;  2IZB A;  5FQ8 E;  2OVS A;  4GH7 A;  1SWC A;  2HZQ A;  1VWJ B;  4JNJ A;  1VWM B;  1N7Y A;  4AZN A;  4AZQ A;  5L3Y A;  3HMJ G;  2AT5 X;  4E67 A;  1MK5 A;  1NDJ A;  2C1Q A;  1SWR A;  5BYP A;  4FBR A;  1Q4K A;  4HY2 A;  3DTQ A;  2Y3E A;  5HA0 A;  4YBU A;  4I60 A;  4O4X A;  5F7G A;  3WZN A;  2L68 A;  2RTN B;  1UYO X;  4QZT A;  4ZGU A;  2XKL A;  3UEW A;  2QZU A;  1VWF B;  1STP A;  3LXQ A;  2FR2 A;  4BX6 A;  3HWF A;  4I3B A;  1KGL A;  2A3F X;  2E50 A;  5FQ7 E;  3P36 A;  4CYR A;  1T8V A;  2QOM A;  3VHI A;  3SAO A;  3CR6 A;  1LPJ A;  1HDH A;  1AVD A;  1RXK A;  1RXH A;  2LKK A;  1STR B;  1X71 A;  2UYW A;  3HPE A;  2G5L A;  3APU A;  1SY3 A;  1ADL A;  4NKB A;  5KIC A;  1LNM A;  4AW8 A;  1FSU A;  3STK A;  1SRG A;  4N7V A;  4O4S A;  5L8N A;  1ICN A;  4XMH A;  2IZD B;  4L1N A;  2QM9 A;  2BSZ A;  3P34 A;  5HZ9 A;  4HFO A;  2AT3 X;  4KC7 A;  2ASN X;  3LV4 A;  1GGL A;  2FS6 A;  3PED A;  2NP1 A;  3EBK A;  4IAB A;  1KFF A;  4GD9 A;  4FDI A;  4D6A A;  2RTG B;  5B5G A;  4ML7 B;  2A2U A;  3STN A;  5CE4 A;  2A8G A;  2MJI A;  5FEN A;  1LKE A;  2NNE A;  3OD9 A;  3WJD A;  1CBS A;  2CM4 A;  1E2T A;  4GJV A;  3ZQ3 A;  3ELZ A;  2BC3 A;  4O9W A;  4TKJ A;  2VKZ G;  3FEL A;  2DJF A;  4QNI A;  1AQB A;  4LZV A;  2LB6 A;  1O1U A;  3Q1I A;  1NQM A;  2X34 A;  3WJE A;  1RBP A;  2EU7 X;  3VE2 A;  4NLI A;  3I0A A;  1FEL A;  1GKA A;  3UEU A;  3KFG A;  5IRU A;  4O4U A;  3ZW0 B;  3LTW A;  4TJZ A;  4IB6 A;  4AZO A;  2GTF X;  4BVM A;  3BX7 A;  1GT5 A;  1SWF A;  2G8C O;  3FR4 A;  3QKG A;  1RSU B;  1W6F A;  1B0O A;  2MWH A;  2A0A A;  1ZNK A;  1LCW A;  1KXO A;  1HMT A;  4A8Z A;  1SLF B;  1BSY A;  4KT5 A;  1VWR B;  1G7N A;  1LIB A;  1OBQ A;  4FGI B;  5B29 A;  2JN3 A;  3B2H A;  1JZU A;  1B8E A;  4TKB A;  4BQU A;  1A57 A;  3D96 A;  3TF6 A;  1I4U A;  2OVA A;  5HCC C;  3ZW1 A;  1JBH A;  2OY5 O;  1ZND A;  2WQA E;  3BU9 A;  3RSW A;  3NAD A;  3LM3 A;  3KVN A;  2GTL N;  2CAM A;  3E3C A;  4QZU A;  3ELX A;  1E3C P;  1BRQ A;  3EYC A;  4YDA A;  1SWU A;  3P35 A;  4O3Z A;  3RDU A;  1FE3 A;  1LDQ A;  3VPJ E;  1LDO A;  1JIW I;  1VWL B;  3FS3 A;  4UU3 A;  4ORS A;  3ZZV A;  1S2P A;  2JGS A;  4YKM A;  2KD2 A;  2QO6 A;  2FKG A;  4HWM A;  2W2F A;  1IKJ A;  3PQU A;  3T2X A;  4D6B A;  4N7C A;  1A3Y A;  3B2I A;  1F32 A;  4QAE A;  5H9L A;  5B2A O;  2Q2P A;  4QGW A;  3O19 A;  4YKO A;  4O4O A;  3FA9 A;  4NNT A;  1URE A;  4XMF A;  2RTQ B;  3F6Z B;  3S26 A;  4O6W A;  1LCV A;  5LJB A;  3N91 A;  2WR6 A;  3VG7 A;  4WHK A;  5D47 A;  3JQO A;  2AVI A;  5H9N A;  4RS6 A;  4E9C A;  2LBA A;  1SWB A;  2ALL X;  2UV8 G;  3HFD A;  5HCE C;  2F09 A;  3C76 X;  3QQ2 A;  3FVH A;  4MIS A;  5D48 A;  1RLB E;  3U03 A;  4EEJ A;  1SWS A;  4ZHD A;  2MF6 A;  4CDC A;  1BLR A;  4GKC A;  1VPR A;  2CM9 A;  1MEP A;  4CPE A;  2IZC B;  3TGA A;  1GX8 A;  4BX5 B;  4GZV A;  1JYJ A;  4JO6 A;  1CBR A;  1ERX A;  3DSZ A;  3FYF A;  3SZJ A;  2OFM X;  4GUZ A;  1G74 A;  1NC9 A;  3WBG A;  2OF9 A;  1ZRY A;  1VWH B;  3P6D A;  4EKV A;  3HTY A;  3PQS A;  3RDO A;  3V8U A;  3KZA A;  1DZJ A;  3ZUI A;  1VWA B;  1BBP A;  2OL8 O;  1X8O A;  5B3M O;  4ARH A;  4ALO A;  1LFO A;  1OEE A;  3SLO A;  4U8U N;  5K06 A;  3P6C A;  1QY1 A;  1Y9L A;  1JMX A;  2AKQ A;  1T68 X;  2IZH B;  5HCD C;  3RWX A;  3O2Y A;  1G5W A;  4LKT A;  3CBC A; 
#chains in the Genus database with same CATH homology
 5CVM A;  4PP1 A;  4Q8H A;  4QRX A;  1QMY A;  1GMY A;  2E50 A;  2NQI A;  1XKG A;  1DEU A;  3U8E A;  4CYR A;  1EF7 A;  4YYQ A;  1EWL A;  3ED4 A;  1F2B A;  1HDH A;  1GLO A;  4QRV A;  1CJL A;  4MSX A;  2CIO A;  1MHW A;  1QDQ A;  1BY8 A;  2BDL A;  2PBH A;  4MZS A;  1ICF A;  2E02 A;  2ACT A;  4CYS A;  4NKB A;  3ERV A;  3BOW A;  3LFY A;  1CB5 A;  1U9V A;  3S3R A;  1AU2 A;  8PCH A;  1YT7 A;  3KSE A;  3O0U A;  1AUK A;  3C9E A;  1PPP A;  2VFC A;  3KW9 A;  4PP2 E;  2OUL A;  1FSU A;  3BPF A;  2AIM A;  3N3K A;  2IBI A;  2PRE A;  1GEC E;  3AI8 A;  5JA7 A;  2YJB A;  2DC6 A;  3IHP A;  4N7V A;  4DMX A;  5EGW A;  2R9O A;  3CH3 X;  2DZY A;  1Q6K A;  3NHE A;  4CXK A;  2BSZ A;  1BP4 A;  2AYN A;  2AU1 A;  3D9W A;  1NB5 A;  2DC7 A;  3M99 A;  5CHT A;  3HWN A;  5PAD A;  3E1Z B;  3PNR A;  4AXL A;  2G8E A;  2R9C A;  3USV A;  4I07 A;  2P86 A;  1IWD A;  2Y5B A;  4PI3 A;  5FPW A;  2BDZ A;  4W5C A;  1X9Y A;  2H7J A;  1NL6 A;  2E00 A;  1AIM A;  3GYV A;  4FDI A;  2DCA A;  1W5R A;  2DCD A;  3B79 A;  3BCN A;  1BQI A;  1GCB A;  1PCI A;  2AUZ A;  1MDW A;  2F1G A;  2C0Y A;  2FT2 A;  3MOR A;  4P6E A;  2HH5 A;  1Y4H A;  2AYO A;  4BS5 A;  3H8C A;  1E33 P;  3P5X A;  4FJC A;  4XUI A;  1EWP A;  4HWY A;  4PAD A;  3CBK A;  2GHU A;  2FRA A;  3KWB X;  2VHF A;  3OVX A;  1E2T A;  1PAD A;  4CDF B;  2DJF B;  3CH2 X;  1AEC A;  1AU3 A;  3K8U A;  4OEL A;  2VKZ G;  1CVZ A;  4OEM A;  4W4U A;  1HUC B;  7PCK A;  2AVW A;  3WXE A;  2AUX A;  4FDJ A;  1ME3 A;  4YYS A;  2HD5 A;  6PAD A;  3N4C A;  1E1Z P;  4QH6 A;  3KDR A;  3MHS A;  2ATO A;  1PE6 A;  4N79 A;  1M6D A;  1K3B B;  3MTN A;  3BWK A;  1YK8 A;  1YVB A;  2PAD A;  1VSN A;  3LTW A;  4G54 A;  2VHS A;  2DZZ A;  4N4Z A;  2OP3 A;  4CXU A;  1PPN A;  1EWM A;  3IV2 A;  3K9M A;  3V6C A;  2XU1 A;  5F02 A;  3KKU A;  1PPD A;  2G6D A;  1W6F A;  2YJ9 A;  4RY2 A;  1NLJ A;  2YJ2 A;  1CS8 A;  2FUD A;  3MHH A;  4AXM A;  1AYU A;  4QRG A;  1E2S P;  1AU4 A;  3IOQ A;  3OVZ A;  2FO5 A;  5A24 A;  1KFX L;  1ITO A;  3QSD A;  2XU5 A;  4XR7 A;  1F2C A;  2R9F A;  2IPP B;  2CB5 A;  3OF9 A;  4I05 A;  4WA6 A;  2G7Y A;  1YAL A;  4ZUX U;  2DC9 A;  1KFU L;  4YVA A;  1CTE A;  1PPO A;  1AYW A;  4CDE B;  1NQC A;  3HHA A;  2P7U A;  4CDD B;  1N2K A;  1U9X A;  3I06 A;  3LM3 A;  3S3Q A;  3P5U A;  1SNK A;  1AU0 A;  1ME4 A;  5CHV A;  1JQP A;  3HHI A;  1DF0 A;  4BSQ A;  1F29 A;  3D6S A;  3KWZ A;  9PAP A;  1ATK A;  1E3C P;  1W4T A;  1TU6 A;  3ZUA A;  2FQ9 A;  1BGO A;  4BGF A;  2WBF X;  3K24 A;  2B1N A;  2OZ2 A;  2NQG A;  4FK5 A;  1CPJ A;  1Y08 A;  3FS3 A;  4N8W A;  4YV8 A;  1MEG A;  1VJV A;  1QXP A;  3LXS A;  5JH3 A;  2DJG B;  1KHQ A;  1N2L A;  4YYV A;  3GYW A;  2HHN A;  1POP A;  1ZCM A;  1MEM A;  1S4V A;  1FH0 A;  3RVX A;  1NB3 A;  1MIR A;  3GCB A;  4FIP A;  4B55 A;  2DC8 A;  4K7C A;  4CZW A;  5AJ9 A;  1CSB B;  2FTD A;  4N9J A;  4NK7 A;  3N3G A;  2E01 A;  3I3T A;  3IUT A;  3IMA A;  4I04 A;  2YJ8 A;  4MZO A;  2PNS A;  3H89 A;  1SP4 B;  2NQD B;  3P5W A;  3CBJ A;  3WXF A;  4BQV A;  1TLO A;  3F75 A;  2ARY A;  4W5B A;  3H6S A;  2UV8 G;  2F7D A;  2R9N A;  3HFD A;  1QOL A;  1KHP A;  4X6H A;  1PBH A;  4Q8G A;  2YJC A;  3PDF A;  5CVO B;  3TNX A;  3F5V A;  4CDC B;  3H8B A;  3BPM A;  1CQD A;  3QT4 A;  4YYW A;  3QJ3 A;  2AS8 A;  4BPV A;  1THE A;  1P49 A;  3H7D A;  2O6X A;  4NV7 A;  2XU4 A;  2G8J A;  3HD3 A;  2GFO A;  3PBH A;  1ZIV A;  4P6G A;  5K16 A;  3WXG A;  3V6E A;  4YYR A;  3OF8 A;  1NPZ A;  2P0R A;  4NV8 A;  4GUZ A;  5J94 A;  1GX3 A;  1PXV A;  2R6N A;  3BC3 A;  1TL9 A;  2FYE A;  1A6R A;  3O1G A;  2Y6E A;  1U5I A;  1CV8 A;  2JQF R;  3IEJ A;  1STF E;  1U9W A;  2B1M A;  4QBB A;  4CXS A;  3KFQ A;  4YYU A;  2FRQ A;  4X6I A;  1F2A A;  3P5V A;  3HMJ G;  1MS6 A;  5CVN B;  2NQA A;  1AYV A;  1YK7 A;  1U9Q X;  3DF0 A;  2XU3 A;  4DMY A;  4G7N A;  3OIS A;  2E03 A;  1KXR A;  4KLB A;  2JQG R;  1O0E A;  4X6J A;  3RVV A;  4BS6 A;  2R9M A;  2DCC A;  5EF4 A;  3KX1 A;  4C5P A;  2HXZ A;  1PIP A;  2QZU A;  5DAY A;  3PW3 A;  2VFB A;  4N7Z A;  2DCB A;  1EWO A;  3RVW A;  3LXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...