1E2TA

Arylamine n-acetyltransferase (nat) from salmonella typhimurium
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
b'HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPFENLDVLLPREIQLDETALEEKLLYARRGGYCFELNGLFERALRDIGFNVRSLLGRVILSHPASLPPRTHRLLLVDVEDEQWIADVGFGGQTLTAPLRLQAEIAQQTPHGEYRLMQEGSTWILQFRHHEHWQSMYCFDLGVQQQSDHVMGNFWSAHWPQSHFRHHLLMCRHLPDGGKLTLTNFHFTRYHQGHAVEQVNVPDVPSLYQLLQQQFGLGVNDVKHGFTEAELAAVMAAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-HYDROXYARYLAMINE O-ACETYLTRANSFERASE
publication title Structure of Arylamine N-Acetyltransferase Reveals a Catalytic Triad
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 78
structure length 274
sequence length 274
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.118: N-hydroxyarylamine O-acetyltransferase.
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 1e2tA03
3.30.1120.150 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1e2tA02
1W6FA 4NV8A 2VFCA 2VFBA 1GX3A 2BSZA 4NV7A 4B55A 4C5PA 3LTWA 1W5RA 1E2TA 4GUZA 3D9WA 1W4TA 4BGFA
chains in the Genus database with same CATH superfamily
4N7DA 3PQSA 3PQUA 2FLJA 1AUKA 1I04A 1JYDA 3FYFA 3P2WA 4TNNA 1RSTB 1BLRA 3WZOA 1I06A 1DZJA 4OMXA 3B2KA 1X71A 1VYOA 2X55A 3VG2A 2KD2A 5FQ6E 2A3FX 2HNXA 1KFFA 3NQKA 4DQ4A 2X8FA 3L4RA 4CK4A 2KT4B 3ELZA 1ZNLA 4UU2A 5DPQA 4I3BA 2X56A 2KW1A 4GE1A 1LF7A 4KH8A 4M7MA 2FHNX 5FFHA 4O9SA 4ML7B 1ICNA 3APUA 2A2GA 3VHIA 2VKZG 2IZIA 1YWAA 1GX8A 3ZW2A 4JGLA 4O4SA 4XMHA 3MX7A 4NP1A 1L6MA 3NPOA 4CPEA 2NNEA 2A8GA 1CBSA 4AZOA 2W2BA 4TKBA 5HTDA 4BX5A 5B10O 3CMPA 1PM1X 1RLBE 1X89A 4O3ZA 5F6BA 1X8OA 5D4AA 1S44A 1ZRYA 5LJDA 2JN3A 4Z2VA 1BEBA 5HWZA 5F58A 1OBQA 4BBOA 3F9DA 5IO6A 2WQ9A 2JMBA 1IKJA 1QWDA 4WBKA 2AVIA 3CKGA 2IZCB 3FA7A 3RY2A 5AEOA 4YVBA 5IXGA 1RSUB 2OVSA 2ZAIA 4YYPA 4KC8A 2DJGA 4NYRA 1I4UA 5H9AA 1CJ5A 2RTKA 5FENA 4NNTA 3RDMA 1T0VA 3CQRA 3EM0A 1DFVA 3KQ0A 4QNIA 4LKTA 2CZTA 3RDOA 1JV4A 4WHIA 2DJFA 3WJGA 4OEMA 3P35A 1N9YA 3RDQA 4A8ZA 4O56A 5KIDA 1A3YA 2UYWA 1VWPB 4IAWA 2G5LA 3RY1A 4FBOA 4MEEA 1HBQA 4QGVA 3NX1A 4XMGA 3CQNA 1SXWA 1ZNKA 1RXJA 1SWLA 3E3CA 2BSZA 4AZPA 3UEUA 1BSOA 3APVA 2OFRX 1HXZA 3FW4A 4I9SA 1ADLA 4ORWA 1LICA 2X45A 5EDCA 1EXSA 3NX2A 5HZ5A 1SWSA 3GYVA 1AQBA 3VE1A 1GT3A 1SRJA 5LJEA 4NYQA 1MK5A 5LJHA 4U8UM 3HMJG 4I60A 1LIBA 3VE2A 3WJDA 3P2ZA 3U9PC 5JR8A 2RQ0A 3UAQA 4CPHB 1SREA 3NP1A 3S5XA 3NADA 5HA1A 4Y0QA 4Z2OA 4CYSA 2IFBA 1NC9A 1X8UA 1N0SA 3SZHA 4OS0A 5HCDC 4GDZA 2Q9SA 4RUNA 3AUMO 5EEDA 1IFCA 1D2UA 1MOYA 4CPIA 4O3WA 1EPBA 1VWQB 1O1VA 2GTLO 3GE2A 2RTMA 4RCPA 4XB0A 4NKBA 5LHZA 2RTDB 5K06A 2MO5A 1VWMB 1MEPA 1SY0A 2WSJA 3VG5A 3OE3A 4HPAA 3VG3A 1HMTA 2C1QA 4ALOA 1SWDA 2L67A 2OF8A 1F34B 2RTFB 4ZGUA 4DCBA 4XMCA 1SWPA 4FDIA 2LB6A 1FENA 2AT3X 4BQUA 4RS6A 5H8TA 2RTCB 5KHPA 2X46A 2AT0X 3KVNA 1Y9LA 4M6SA 1ML7A 4EXZA 3VG6A 1BSQA 1RAVA 4EKVA 1KXOA 4X9WA 2QO5A 4YKMA 4BX5B 1N43A 4DNEA 1RBPA 3ZW0A 2OGQA 3C5LA 2VFBA 3Q1IA 1QY0A 3LXQA 2E4JA 4NK7A 4RUUA 1KT4A 1SWFA 2AT5X 2KTDA 2RD7C 2IZLB 2ACPX 1Q4OA 3BS2A 1JJUA 2Q2MA 4FQBB 4GK9A 1TOUA 4UU3A 4BX6A 4NW4A 2FS7A 3P6FA 1JJJA 1ZNGA 2IZDB 2BS5A 4IABA 2FKGA 3LM3A 3WJCA 2OVDA 1MVGA 3PP6A 5F1EA 1UYOX 2AH7X 2ASNX 4KT5A 1LCZA 2DM5A 2FR3A 3D96A 4Y0SA 2OFAA 1RXHA 2I9XA 2JU8A 1YP7A 3O19A 1LUQA 3FR2A 1VWCB 3WZNA 3EC5A 1A57A 1FELA 5BYPA 1EALA 2GTLN 1WUBA 3KFIA 3STKA 3CBCA 5D8JA 3AEHA 5LJBA 5B3MO 2F73A 3BDRA 1KQXA 3P24A 2CZUA 1YUPA 3FIDA 3HWDA 4MVEA 2HYSA 1W4TA 1EQDA 4YFPA 1Y52X 2RCTA 1HXLA 1SLFB 3WYQA 5LJCA 2UV8G 1Y9TA 5K68A 2RTHB 3IFBA 3WYPA 1SWKA 3I0AA 4YBUA 2MJIA 1I05A 4NNSA 3EW2A 3ZUOA 2FS6A 1VWDB 4ZHFA 3SOTA 1NP1A 1EPAA 1N7YA 2AF5A 1N2LA 4BX7A 1HMSA 1SWOA 2LBVA 2AT8X 1W6FA 4IB8A 4I95A 4N7ZA 1QG5A 2OY8A 5AJCA 4LQZA 3LTWA 1FTPA 1GX9A 5LJGA 1VWBB 1IW2A 1T8VA 3FVHA 3RKGA 2RA6A 1VWFB 1T68X 3Q34A 1SWBA 1XKIA 4LKLA 2MM3A 1YWBA 5L8IA 1NP4A 1FEMA 1KGLA 1VWIB 1EI5A 1GKAA 3UEXA 2GTFX 4GJSA 2BLGA 5AJ9A 3FW5A 2GJ5A 3UEWA 2OYBO 4GKCA 3SZIA 3FIQA 2WPUA 5D45A 1DF8A 5B5GA 1VYGA 1LNMA 3V8UA 1EIIA 2XSTA 4D6AA 1SWAA 1X8QA 1NBXA 3PH6A 1HQPA 3DTQA 1CBQA 3BX8A 1AVDA 4ALBA 3FR4A 1SRHA 4YCEA 4I3CA 1WBIA 1K24A 2L5PA 3O22A 4YFRA 2WUTA 3WZQA 3C76X 5LKEA 3HWGA 4MIRA 1EUOA 1KL3A 3P34A 1UYNX 3MVFA 3HTYA 4X9VA 3B2JA 1YIVA 4N9JA 1K3BA 2OF9A 2HZRA 1JQPA 3P37A 3B2IA 3WBGA 1VWEB 4U8UO 4O4UA 1SWNA 1HBPA 3HWFA 2CBRA 3RQ7A 1VYFA 3NR3A 2FKJA 3WJEA 1GGLA 1SWJA 5IRUA 4QAEA 1LCVA 4GH7A 1SWRA 1DF3A 4YGGA 4JNJA 2MHDA 4GUZA 2HLVA 4YCHA 2EU7X 1CBRA 2VDFA 1NQNA 4AZNA 2ANSA 1KT6A 1BM5A 1PBYA 2QCBA 4CDCA 1E1ZP 4ODDA 1G85A 5HCEC 1OEEA 2GC9A 2JGSA 4EQAC 2RTEB 1BJ7A 2AMMX 1QFVA 5LKFA 4INNA 4Y59A 2JW1A 4AYHA 5HBSA 4E9DA 3PDFA 4HFOA 3BU1A 1TW4A 5DMSA 1BBPA 4ZHCA 3EW1A 4D6BA 2JOZA 3RE6A 5C0NA 4CDEA 4COTA 2E50A 3VPJE 1X8PA 1IKEA 2N93A 4OELA 2ALLX 1A2DA 3P6HA 2BC3A 5EEEA 4ZCBA 5D48A 4BOEA 2L68A 5HZQA 2IZGB 2Q39A 3JQOA 4LZUA 2OVEA 4EEJA 3I17A 4IAXA 2K62A 5B11O 1G5WA 4N7CA 2YMSA 4L3RA 4Y5DA 2X8TA 1BRQA 4YBPA 4QZTA 2QM9A 4MISA 1A18A 1DZMA 1SLEB 1SLDB 3T2WA 2I5VO 2OFMX 4AW8A 4WFUA 1BRPA 4L1NA 4JO6A 1F32A 1KL5A 3WZPA 2Y3EA 3ZUIA 3SAOA 4HY2A 4IB6A 4C5PA 1SMPI 1OEKA 5B29A 2R73A 1DZPA 3NQ9A 2NP1A 1HQQA 1H91A 1Z24A 3T6FA 1JYJA 2CM4A 1U17A 3WXQA 1CRBA 4BJ8A 4GNWA 2CBSA 2LBAA 4ORUA 3MBTA 3PPTA 2PI3O 5FQ8E 3HFDA 2IZHB 1ACDA 1EW3A 2P8GA 4ZGFA 1MM9A 1HDHA 1GKAB 1VWHB 4TLJA 3VGWA 4GGTA 4Y0RA 4J7BB 5CE4A 2W2FA 1Q4KA 1UMWA 5HZ6A 1GM6A 5IO5A 5DG4A 1VWRB 3RWXA 3VHMA 1SWUA 3PK2A 1ERBA 4AZQA 3UEVA 2OFBA 3APWA 1P6PA 3ELXA 2RTBB 3LV4A 2W2AA 4CV7A 4CDFA 4CSBA 4GNYA 3QKGA 2RTOB 1HMRA 1GT4A 2RTLA 3RDUA 1FDQA 4X9RA 1OBPA 1E3CP 1Y0GA 3FR5A 4GRJA 4DFWA 1QY2A 4QRLA 1VWLB 2N19A 2LKKA 1R0UA 5HZ9A 4QZUA 3U03A 4LKMA 3ZZVA 1I78A 1OSPO 4OKAA 1E2SP 3RSWA 1N4JA 1LDOA 1SWQA 4IMOA 1IIUA 2QO6A 4N7VA 1CBIA 3NBXX 1SRFA 3TZSA 3U0DA 2OVAA 1MDCA 2CAMA 4ORRA 3TGBA 3O2YA 4U46A 3APXA 4BCSA 3C77X 3KZAA 1A87A 2BS6A 1YP6A 1ZNDA 1B8EA 3P36A 4ON1A 3LHNA 5F7GA 1SY3A 2FT9A 1OBUA 4HABA 2NNQA 4FGIB 1KZWA 1UREA 2I9ZA 2Q4NA 1W5RA 3JSQA 4B55A 4YMYA 3WJFA 4AZMA 4KC7A 2A13A 4ES7A 2X8SA 3GAQA 2X4MA 3DSZA 4O6WA 4GETA 1QQSA 4OMWA 1JMZA 3BU9A 1SXYA 4YFQA 3AKMA 3RBYA 5L3YA 2IZBA 2X32A 1GX3A 1NDJA 3B2LA 2GH7A 4TKJA 1SWGA 2OL7A 2UZ2A 2AT6X 5BVTA 1KT7A 3KFGA 1LCWA 2CM9A 1IFBA 3OD9A 1FJ1E 5CSEA 1MUPA 1D3SA 4XMEA 5IRAA 4AZRA 1ICMA 5K67A 4QYNA 4GZVA 4E9CA 4OS3A 3S5VA 3TF6A 4I6SA 1LELA 4I9RA 4YH0A 3QQ2A 2ACOA 5D47A 1STRB 2G8CO 4IRWA 1KOIA 2LFOA 3S26A 2FRSA 1Y55X 1SXXA 2WQAE 2RTJA 1GXAA 2IA9A 1E02A 5EPQA 1P49A 4ZJ0A 3HK1A 1OEJA 5LJKA 5AQ6A 4R0BA 5F6ZA 2L9CA 3HPEA 1JBHA 3T1DA 4O4XA 2RTPB 4MVIA 1KT5A 2RCQA 1AVGI 2Z4IA 1FSUA 2A2UA 1SRIA 3HIHA 4HWMA 1X8NA 1ALBA 2F01A 3RZYA 3WOVA 3H3IA 1BWYA 3FEPA 5J19A 4NV7A 3T2XA 3F6ZB 2Y32A 1OPBA 2QZUA 2G79A 3HWEA 1STSB 3ZW0B 1JJXA 4O49A 1YWCA 3P02A 4ORYA 4K19A 2K23A 4Z2PA 3VG4A 4IBAA 2RTGB 2C4IA 2MF6A 4ZHDA 2X34A 4XMFA 2C1SA 1JIWI 2ZAGA 5EZ2A 4MVLA 2FGSA 1JMXA 2KTSA 1E5PA 4BVMA 4WHKA 4BX6B 2QOSC 3FA8A 2IZKA 3N91A 1IJ8A 5L8OA 3FA6A 1STPA 4YDAA 1HN2A 1Y53X 3FEKA 1EIOA 4WFVA 1XCAA 2VFCA 2FR2A 2WR6A 1LPJA 1KQWA 1RXKA 3FA9A 5L8NA 3ZW1A 5DNJA 1VPRA 1VWJB 5DMVC 2A5CA 4IB9A 2LA7A 4GJVA 3VG7A 1NGLA 3BRNA 4Z28A 1S7DA 5EDBA 1FE3A 3KDRA 2HMBA 1SXUA 1E00A 4CYRA 4HPDA 2QMIA 1KL4A 5HAEA 1SRGA 2MWHA 5HCCC 4CXUA 1N2KA 2OY5O 1JZUA 2OJXA 4GGZA 3JS1A 4LKPA 1I9HA 2OL6O 2JU3A 3P6EA 2G78A 1AVEA 4I3DA 4IB7A 3VHHA 2RN4A 4TQ2A 2IZAA 1DV9A 3KFFA 4EFGA 1SWEA 1YWDA 2NNDA 4YGZA 1E06A 3X00A 1E2TA 5H9LA 4Y0PA 4BX7B 1G74A 3HOEA 3BZIA 5FAZA 3P6DA 1B56A 2G7BA 1LFOA 3F8AA 3SLTA 4GGRA 1LIEA 4CXSA 1VWKB 4A1YA 3TGCA 5B2AO 5HTEA 1ERXA 1OPAA 4QGWA 4OS8A 3AKNA 4ZFXA 4HPBA 4HPCA 3BSZE 5IRWA 3D97A 1VWGB 2R56A 1DC9A 1SWHA 3CR6A 1VWNB 5B5FA 3SLOA 4ORXA 4ZH6A 4NLJA 4GU8A 2JU7A 1PMPA 1LDQA 4U9CA 4U8UN 4HCOA 1AB0A 4FBRA 4QQ1A 1QFTA 1PTSA 1QY1A 2A5BA 3TGAA 2POAA 2A0AA 3RDXA 1S2PA 2BHVA 5HA0A 2BT9A 3EMMA 5FQ7E 1TVQA 4PSQA 2HKDA 4G7NA 3WVMA 5BVQA 1O8VA 4O9WA 4ZHGA 4A1HA 2XKLA 4KCAA 2QOMA 3B2HA 2AKQA 1KT3A 3EYCA 1BSYA 2F09A 4H71A 5CYBA 2IZJA 1N9MA 4QGXA 4O3XB 1VWOB 2IZFB 3HIKA 1B0OA 4TKHA 1SY1A 4PJ2A 1TOWA 4QYPA 4WHHA 3FMZA 5F2BA 2OY7A 2OL8O 3T6LA 4O4OA 3GYWA 4A60A 4ZHHA 5H9KA 3P6GA 1ZNHA 2O62A 5KICA 3RE5A 4IMNA 3SZJA 4FDJA 2Q2PA 1SWTA 1GT1A 2RTRB 4YGHA 2AL0X 5B27A 3IA8A 4XMDA 3PEDA 3MM0A 1O1UA 1PEEA 1DZKA 5CHKA 4ZR2A 3CBSA 2I5ZO 2Z4HA 2FWVA 3ZW1B 1NQMA 3PECA 4EDEA 5HZ8A 1MX8A 3D9WA 3ZQ3A 4CPFA 3P6CA 3CWKA 1LIFA 4LZVA 3STNA 1HY2A 5H9NA 3EBWA 5JD2A 3NQ3A 3BY0A 4FBVA 2QO4A 3PH5A 1KZXA 1U18A 4TJZA 3EBKA 3ZWEA 2GTLM 1VWAB 4ARHA 4DQ3A 1U0XA 2IZEB 4CDDA 3G7XA 3C78X 4ZH9A 2R74A 3BLGA 4KIIA 3FLLA 1QABE 2Y3FA 3WJBA 4E67A 2M4LA 1E33P 1ZNEA 3FS3A 3CKFA 3OBLA 3KFHA 3VU1A 1TXLA 4YKOA 3BX7A 3SLJA 4Z27A 1LKEA 5DAYA 2OY1O 3ZI8A 2FHLA 4ORSA 3RDSA 2WWPA 1SY2A 4Z6JA 2RTQB 2OZQA 2HZQA 4GD9A 3OJYC 3S60A 4NLIA 2RTAA 2PY1A 1PBOA 3FELA 4CXKA 2RTNB 4WHLA 4MVKA 4ID2A 4O3YA 4U3QA 1SLGB 4GDAA 1SWCA 2WEXA 3FDCA 3STMX 4BGFA 3MG5A 3K3LA 2RTIB 2YG2A 4JHQA 5AJBA 1GT5A 1SA8A 1G7NA 3Q6LA 2WEWA 1MX7A 3ED4A 1UZ2X 2ZSCA 4YDBA 2FTBA 5IO7A 4NV8A 1AELA 4CPHA 1LIDA 3FENA 4H5XA 1B4MA 3D4RA 5BVSA 3HOLA 3D95A
chains in the Genus database with same CATH topology
1ZIVA 3ERVA 1PPPA 1U9WA 4N8WA 1O0EA 1M6DA 2DJFB 4QH6A 2DCCA 3LM3A 3ZUAA 1ITOA 1AUKA 1KHPA 3MHSA 4I04A 3NHEA 2FTDA 3KSEA 3KDRA 3K8UA 1F2CA 3BPFA 2E02A 1CQDA 1VJVA 1X9YA 3H8BA 3K9MA 1EF7A 2FT2A 5JH3A 2BDLA 3BWKA 4FJCA 2AS8A 2G8EA 4CYRA 3RVVA 4CXUA 4BQVA 4WA6A 2B1MA 1N2KA 8PCHA 3BC3A 3BOWA 1BQIA 2E00A 4BS5A 3QT4A 3D6SA 2PBHA 2GFOA 7PCKA 4G54A 3E1ZB 1A6RA 2OZ2A 4W4UA 1E3CP 4PP2E 2FUDA 5CVOB 1PXVA 1K3BB 4FIPA 3MHHA 3IUTA 1W4TA 2CB5A 4PI3A 1E2TA 2VKZG 4QBBA 1AECA 2PADA 3KX1A 2UV8G 1NB5A 3PBHA 1E2SP 1DEUA 3N3GA 4CXSA 4YYSA 2XU3A 2E03A 2IPPB 3IMAA 3IOQA 2R9MA 4N7VA 3USVA 3P5VA 4RY2A 3RVWA 1N2LA 3N4CA 1TL9A 2AIMA 4Q8GA 1W6FA 4N7ZA 4DMYA 2FO5A 4DMXA 2R9FA 3LTWA 1ICFA 1CTEA 2PREA 1TLOA 1GCBA 2G6DA 4CDCB 2ARYA 3CH3X 1MHWA 2C0YA 3WXEA 3CBKA 1VSNA 3MORA 2YJBA 2NQGA 2FQ9A 4YYWA 4XUIA 4W5CA 1AIMA 1PCIA 3LFYA 1CJLA 1AU2A 1F29A 2DC8A 4CDDB 2G7YA 3KFQA 1XKGA 3V6CA 4G7NA 3KKUA 2DCDA 1PIPA 5CVNB 5K16A 2DZZA 2FRQA 1W5RA 4B55A 1MIRA 1DF0A 4MSXA 1ZCMA 5AJ9A 3S3QA 1PPDA 1MEGA 4OEMA 2DCAA 4QRVA 2HHNA 1YALA 4QRGA 2ATOA 3O1GA 1BGOA 1Y4HA 3HHIA 4MZSA 3PNRA 3IV2A 3I06A 5A24A 1MDWA 4YYUA 2AYOA 2YJCA 3TNXA 3O0UA 2FRAA 3OVZA 2NQAA 2AUXA 2VHSA 2AUZA 3P5WA 3F75A 3H89A 3K24A 3OVXA 4MZOA 3C9EA 3P5UA 1GX3A 1CB5A 1NPZA 1SP4B 3CBJA 1EWMA 3GYWA 2BSZA 3WXFA 4YYQA 1CV8A 5JA7A 3M99A 2AVWA 4W5BA 1IWDA 2P7UA 1U9VA 4N9JA 1AYUA 1NQCA 4X6HA 3QJ3A 5CHVA 4FDJA 2HD5A 1U9QX 2F7DA 1SNKA 3GYVA 2P86A 4ZUXU 1JQPA 2JQFR 1MS6A 4I07A 1NL6A 1U9XA 6PADA 2BDZA 3HMJG 1AU4A 1YT7A 1ME4A 1QOLA 2F1GA 2GHUA 3PW3A 1PADA 1BP4A 1AYVA 4PADA 3MTNA 9PAPA 1U5IA 3CH2X 3U8EA 3B79A 3HWNA 1MEMA 2R6NA 4AXMA 2DC9A 4FK5A 3KWBX 1AU3A 2OP3A 2YJ9A 4GUZA 4CYSA 3BPMA 4YV8A 2DZYA 4K7CA 2R9CA 3D9WA 3HHAA 2Y6EA 2ACTA 4QRXA 2DC6A 1QXPA 3H8CA 4X6IA 3LXSA 2B1NA 4YYVA 1E1ZP 1PPNA 2WBFX 1P49A 1PBHA 2FYEA 4P6GA 1CPJA 1EWOA 1KHQA 4N79A 4NKBA 4P6EA 2P0RA 2R9NA 5F02A 4CDEB 2XU5A 2XU4A 2IBIA 1CSBB 3PDFA 4CDFB 1EWPA 3P5XA 1CVZA 1YK8A 1FSUA 4YYRA 1E33P 2JQGR 1YK7A 3I3TA 3FS3A 2XU1A 4I05A 3OISA 5EGWA 1KFXL 2E50A 4FDIA 3KW9A 4NV7A 3F5VA 1KXRA 2DC7A 4OELA 3H6SA 1PPOA 1F2BA 1QDQA 1TU6A 1ME3A 3H7DA 2QZUA 2DCBA 5DAYA 3AI8A 3OF9A 3QSDA 2NQDB 5J94A 2AYNA 3BCNA 3DF0A 2O6XA 5CHTA 5EF4A 1KFUL 2E01A 2H7JA 1NLJA 1HUCB 3N3KA 4HWYA 1EWLA 2NQIA 3S3RA 4KLBA 1YVBA 5PADA 1GMYA 1STFE 1NB3A 1GLOA 1AU0A 4BS6A 4CXKA 1AYWA 1THEA 3WXGA 4AXLA 2VFBA 2YJ8A 2AU1A 4X6JA 1S4VA 4C5PA 2HH5A 3KWZA 4CZWA 3LXQA 1F2AA 3IHPA 1BY8A 2YJ2A 2VHFA 5FPWA 4BGFA 4NK7A 4N4ZA 5CVMA 4BSQA 3IEJA 4Q8HA 3HD3A 3ED4A 1FH0A 2Y5BA 4PP1A 1POPA 2CIOA 4XR7A 3GCBA 1QMYA 4BPVA 2PNSA 4NV8A 2OULA 2VFCA 2R9OA 2HXZA 2DJGB 2G8JA 3HFDA 4YVAA 3V6EA 1ATKA 1Q6KA 1CS8A 1Y08A 3RVXA 3OF8A 1PE6A 1GECE 1HDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6F A;  4NV8 A;  2VFC A;  2VFB A;  1GX3 A;  2BSZ A;  4NV7 A;  4B55 A;  4C5P A;  3LTW A;  1W5R A;  1E2T A;  4GUZ A;  3D9W A;  1W4T A;  4BGF A; 
#chains in the Genus database with same CATH topology
 4N7D A;  3PQS A;  3PQU A;  2FLJ A;  1AUK A;  1I04 A;  1JYD A;  3FYF A;  3P2W A;  4TNN A;  1RST B;  1BLR A;  3WZO A;  1I06 A;  1DZJ A;  4OMX A;  3B2K A;  1X71 A;  1VYO A;  2X55 A;  3VG2 A;  2KD2 A;  5FQ6 E;  2A3F X;  2HNX A;  1KFF A;  3NQK A;  4DQ4 A;  2X8F A;  3L4R A;  4CK4 A;  2KT4 B;  3ELZ A;  1ZNL A;  4UU2 A;  5DPQ A;  4I3B A;  2X56 A;  2KW1 A;  4GE1 A;  1LF7 A;  4KH8 A;  4M7M A;  2FHN X;  5FFH A;  4O9S A;  4ML7 B;  1ICN A;  3APU A;  2A2G A;  3VHI A;  2VKZ G;  2IZI A;  1YWA A;  1GX8 A;  3ZW2 A;  4JGL A;  4O4S A;  4XMH A;  3MX7 A;  4NP1 A;  1L6M A;  3NPO A;  4CPE A;  2NNE A;  2A8G A;  1CBS A;  4AZO A;  2W2B A;  4TKB A;  5HTD A;  4BX5 A;  5B10 O;  3CMP A;  1PM1 X;  1RLB E;  1X89 A;  4O3Z A;  5F6B A;  1X8O A;  5D4A A;  1S44 A;  1ZRY A;  5LJD A;  2JN3 A;  4Z2V A;  1BEB A;  5HWZ A;  5F58 A;  1OBQ A;  4BBO A;  3F9D A;  5IO6 A;  2WQ9 A;  2JMB A;  1IKJ A;  1QWD A;  4WBK A;  2AVI A;  3CKG A;  2IZC B;  3FA7 A;  3RY2 A;  5AEO A;  4YVB A;  5IXG A;  1RSU B;  2OVS A;  2ZAI A;  4YYP A;  4KC8 A;  2DJG A;  4NYR A;  1I4U A;  5H9A A;  1CJ5 A;  2RTK A;  5FEN A;  4NNT A;  3RDM A;  1T0V A;  3CQR A;  3EM0 A;  1DFV A;  3KQ0 A;  4QNI A;  4LKT A;  2CZT A;  3RDO A;  1JV4 A;  4WHI A;  2DJF A;  3WJG A;  4OEM A;  3P35 A;  1N9Y A;  3RDQ A;  4A8Z A;  4O56 A;  5KID A;  1A3Y A;  2UYW A;  1VWP B;  4IAW A;  2G5L A;  3RY1 A;  4FBO A;  4MEE A;  1HBQ A;  4QGV A;  3NX1 A;  4XMG A;  3CQN A;  1SXW A;  1ZNK A;  1RXJ A;  1SWL A;  3E3C A;  2BSZ A;  4AZP A;  3UEU A;  1BSO A;  3APV A;  2OFR X;  1HXZ A;  3FW4 A;  4I9S A;  1ADL A;  4ORW A;  1LIC A;  2X45 A;  5EDC A;  1EXS A;  3NX2 A;  5HZ5 A;  1SWS A;  3GYV A;  1AQB A;  3VE1 A;  1GT3 A;  1SRJ A;  5LJE A;  4NYQ A;  1MK5 A;  5LJH A;  4U8U M;  3HMJ G;  4I60 A;  1LIB A;  3VE2 A;  3WJD A;  3P2Z A;  3U9P C;  5JR8 A;  2RQ0 A;  3UAQ A;  4CPH B;  1SRE A;  3NP1 A;  3S5X A;  3NAD A;  5HA1 A;  4Y0Q A;  4Z2O A;  4CYS A;  2IFB A;  1NC9 A;  1X8U A;  1N0S A;  3SZH A;  4OS0 A;  5HCD C;  4GDZ A;  2Q9S A;  4RUN A;  3AUM O;  5EED A;  1IFC A;  1D2U A;  1MOY A;  4CPI A;  4O3W A;  1EPB A;  1VWQ B;  1O1V A;  2GTL O;  3GE2 A;  2RTM A;  4RCP A;  4XB0 A;  4NKB A;  5LHZ A;  2RTD B;  5K06 A;  2MO5 A;  1VWM B;  1MEP A;  1SY0 A;  2WSJ A;  3VG5 A;  3OE3 A;  4HPA A;  3VG3 A;  1HMT A;  2C1Q A;  4ALO A;  1SWD A;  2L67 A;  2OF8 A;  1F34 B;  2RTF B;  4ZGU A;  4DCB A;  4XMC A;  1SWP A;  4FDI A;  2LB6 A;  1FEN A;  2AT3 X;  4BQU A;  4RS6 A;  5H8T A;  2RTC B;  5KHP A;  2X46 A;  2AT0 X;  3KVN A;  1Y9L A;  4M6S A;  1ML7 A;  4EXZ A;  3VG6 A;  1BSQ A;  1RAV A;  4EKV A;  1KXO A;  4X9W A;  2QO5 A;  4YKM A;  4BX5 B;  1N43 A;  4DNE A;  1RBP A;  3ZW0 A;  2OGQ A;  3C5L A;  2VFB A;  3Q1I A;  1QY0 A;  3LXQ A;  2E4J A;  4NK7 A;  4RUU A;  1KT4 A;  1SWF A;  2AT5 X;  2KTD A;  2RD7 C;  2IZL B;  2ACP X;  1Q4O A;  3BS2 A;  1JJU A;  2Q2M A;  4FQB B;  4GK9 A;  1TOU A;  4UU3 A;  4BX6 A;  4NW4 A;  2FS7 A;  3P6F A;  1JJJ A;  1ZNG A;  2IZD B;  2BS5 A;  4IAB A;  2FKG A;  3LM3 A;  3WJC A;  2OVD A;  1MVG A;  3PP6 A;  5F1E A;  1UYO X;  2AH7 X;  2ASN X;  4KT5 A;  1LCZ A;  2DM5 A;  2FR3 A;  3D96 A;  4Y0S A;  2OFA A;  1RXH A;  2I9X A;  2JU8 A;  1YP7 A;  3O19 A;  1LUQ A;  3FR2 A;  1VWC B;  3WZN A;  3EC5 A;  1A57 A;  1FEL A;  5BYP A;  1EAL A;  2GTL N;  1WUB A;  3KFI A;  3STK A;  3CBC A;  5D8J A;  3AEH A;  5LJB A;  5B3M O;  2F73 A;  3BDR A;  1KQX A;  3P24 A;  2CZU A;  1YUP A;  3FID A;  3HWD A;  4MVE A;  2HYS A;  1W4T A;  1EQD A;  4YFP A;  1Y52 X;  2RCT A;  1HXL A;  1SLF B;  3WYQ A;  5LJC A;  2UV8 G;  1Y9T A;  5K68 A;  2RTH B;  3IFB A;  3WYP A;  1SWK A;  3I0A A;  4YBU A;  2MJI A;  1I05 A;  4NNS A;  3EW2 A;  3ZUO A;  2FS6 A;  1VWD B;  4ZHF A;  3SOT A;  1NP1 A;  1EPA A;  1N7Y A;  2AF5 A;  1N2L A;  4BX7 A;  1HMS A;  1SWO A;  2LBV A;  2AT8 X;  1W6F A;  4IB8 A;  4I95 A;  4N7Z A;  1QG5 A;  2OY8 A;  5AJC A;  4LQZ A;  3LTW A;  1FTP A;  1GX9 A;  5LJG A;  1VWB B;  1IW2 A;  1T8V A;  3FVH A;  3RKG A;  2RA6 A;  1VWF B;  1T68 X;  3Q34 A;  1SWB A;  1XKI A;  4LKL A;  2MM3 A;  1YWB A;  5L8I A;  1NP4 A;  1FEM A;  1KGL A;  1VWI B;  1EI5 A;  1GKA A;  3UEX A;  2GTF X;  4GJS A;  2BLG A;  5AJ9 A;  3FW5 A;  2GJ5 A;  3UEW A;  2OYB O;  4GKC A;  3SZI A;  3FIQ A;  2WPU A;  5D45 A;  1DF8 A;  5B5G A;  1VYG A;  1LNM A;  3V8U A;  1EII A;  2XST A;  4D6A A;  1SWA A;  1X8Q A;  1NBX A;  3PH6 A;  1HQP A;  3DTQ A;  1CBQ A;  3BX8 A;  1AVD A;  4ALB A;  3FR4 A;  1SRH A;  4YCE A;  4I3C A;  1WBI A;  1K24 A;  2L5P A;  3O22 A;  4YFR A;  2WUT A;  3WZQ A;  3C76 X;  5LKE A;  3HWG A;  4MIR A;  1EUO A;  1KL3 A;  3P34 A;  1UYN X;  3MVF A;  3HTY A;  4X9V A;  3B2J A;  1YIV A;  4N9J A;  1K3B A;  2OF9 A;  2HZR A;  1JQP A;  3P37 A;  3B2I A;  3WBG A;  1VWE B;  4U8U O;  4O4U A;  1SWN A;  1HBP A;  3HWF A;  2CBR A;  3RQ7 A;  1VYF A;  3NR3 A;  2FKJ A;  3WJE A;  1GGL A;  1SWJ A;  5IRU A;  4QAE A;  1LCV A;  4GH7 A;  1SWR A;  1DF3 A;  4YGG A;  4JNJ A;  2MHD A;  4GUZ A;  2HLV A;  4YCH A;  2EU7 X;  1CBR A;  2VDF A;  1NQN A;  4AZN A;  2ANS A;  1KT6 A;  1BM5 A;  1PBY A;  2QCB A;  4CDC A;  1E1Z P;  4ODD A;  1G85 A;  5HCE C;  1OEE A;  2GC9 A;  2JGS A;  4EQA C;  2RTE B;  1BJ7 A;  2AMM X;  1QFV A;  5LKF A;  4INN A;  4Y59 A;  2JW1 A;  4AYH A;  5HBS A;  4E9D A;  3PDF A;  4HFO A;  3BU1 A;  1TW4 A;  5DMS A;  1BBP A;  4ZHC A;  3EW1 A;  4D6B A;  2JOZ A;  3RE6 A;  5C0N A;  4CDE A;  4COT A;  2E50 A;  3VPJ E;  1X8P A;  1IKE A;  2N93 A;  4OEL A;  2ALL X;  1A2D A;  3P6H A;  2BC3 A;  5EEE A;  4ZCB A;  5D48 A;  4BOE A;  2L68 A;  5HZQ A;  2IZG B;  2Q39 A;  3JQO A;  4LZU A;  2OVE A;  4EEJ A;  3I17 A;  4IAX A;  2K62 A;  5B11 O;  1G5W A;  4N7C A;  2YMS A;  4L3R A;  4Y5D A;  2X8T A;  1BRQ A;  4YBP A;  4QZT A;  2QM9 A;  4MIS A;  1A18 A;  1DZM A;  1SLE B;  1SLD B;  3T2W A;  2I5V O;  2OFM X;  4AW8 A;  4WFU A;  1BRP A;  4L1N A;  4JO6 A;  1F32 A;  1KL5 A;  3WZP A;  2Y3E A;  3ZUI A;  3SAO A;  4HY2 A;  4IB6 A;  4C5P A;  1SMP I;  1OEK A;  5B29 A;  2R73 A;  1DZP A;  3NQ9 A;  2NP1 A;  1HQQ A;  1H91 A;  1Z24 A;  3T6F A;  1JYJ A;  2CM4 A;  1U17 A;  3WXQ A;  1CRB A;  4BJ8 A;  4GNW A;  2CBS A;  2LBA A;  4ORU A;  3MBT A;  3PPT A;  2PI3 O;  5FQ8 E;  3HFD A;  2IZH B;  1ACD A;  1EW3 A;  2P8G A;  4ZGF A;  1MM9 A;  1HDH A;  1GKA B;  1VWH B;  4TLJ A;  3VGW A;  4GGT A;  4Y0R A;  4J7B B;  5CE4 A;  2W2F A;  1Q4K A;  1UMW A;  5HZ6 A;  1GM6 A;  5IO5 A;  5DG4 A;  1VWR B;  3RWX A;  3VHM A;  1SWU A;  3PK2 A;  1ERB A;  4AZQ A;  3UEV A;  2OFB A;  3APW A;  1P6P A;  3ELX A;  2RTB B;  3LV4 A;  2W2A A;  4CV7 A;  4CDF A;  4CSB A;  4GNY A;  3QKG A;  2RTO B;  1HMR A;  1GT4 A;  2RTL A;  3RDU A;  1FDQ A;  4X9R A;  1OBP A;  1E3C P;  1Y0G A;  3FR5 A;  4GRJ A;  4DFW A;  1QY2 A;  4QRL A;  1VWL B;  2N19 A;  2LKK A;  1R0U A;  5HZ9 A;  4QZU A;  3U03 A;  4LKM A;  3ZZV A;  1I78 A;  1OSP O;  4OKA A;  1E2S P;  3RSW A;  1N4J A;  1LDO A;  1SWQ A;  4IMO A;  1IIU A;  2QO6 A;  4N7V A;  1CBI A;  3NBX X;  1SRF A;  3TZS A;  3U0D A;  2OVA A;  1MDC A;  2CAM A;  4ORR A;  3TGB A;  3O2Y A;  4U46 A;  3APX A;  4BCS A;  3C77 X;  3KZA A;  1A87 A;  2BS6 A;  1YP6 A;  1ZND A;  1B8E A;  3P36 A;  4ON1 A;  3LHN A;  5F7G A;  1SY3 A;  2FT9 A;  1OBU A;  4HAB A;  2NNQ A;  4FGI B;  1KZW A;  1URE A;  2I9Z A;  2Q4N A;  1W5R A;  3JSQ A;  4B55 A;  4YMY A;  3WJF A;  4AZM A;  4KC7 A;  2A13 A;  4ES7 A;  2X8S A;  3GAQ A;  2X4M A;  3DSZ A;  4O6W A;  4GET A;  1QQS A;  4OMW A;  1JMZ A;  3BU9 A;  1SXY A;  4YFQ A;  3AKM A;  3RBY A;  5L3Y A;  2IZB A;  2X32 A;  1GX3 A;  1NDJ A;  3B2L A;  2GH7 A;  4TKJ A;  1SWG A;  2OL7 A;  2UZ2 A;  2AT6 X;  5BVT A;  1KT7 A;  3KFG A;  1LCW A;  2CM9 A;  1IFB A;  3OD9 A;  1FJ1 E;  5CSE A;  1MUP A;  1D3S A;  4XME A;  5IRA A;  4AZR A;  1ICM A;  5K67 A;  4QYN A;  4GZV A;  4E9C A;  4OS3 A;  3S5V A;  3TF6 A;  4I6S A;  1LEL A;  4I9R A;  4YH0 A;  3QQ2 A;  2ACO A;  5D47 A;  1STR B;  2G8C O;  4IRW A;  1KOI A;  2LFO A;  3S26 A;  2FRS A;  1Y55 X;  1SXX A;  2WQA E;  2RTJ A;  1GXA A;  2IA9 A;  1E02 A;  5EPQ A;  1P49 A;  4ZJ0 A;  3HK1 A;  1OEJ A;  5LJK A;  5AQ6 A;  4R0B A;  5F6Z A;  2L9C A;  3HPE A;  1JBH A;  3T1D A;  4O4X A;  2RTP B;  4MVI A;  1KT5 A;  2RCQ A;  1AVG I;  2Z4I A;  1FSU A;  2A2U A;  1SRI A;  3HIH A;  4HWM A;  1X8N A;  1ALB A;  2F01 A;  3RZY A;  3WOV A;  3H3I A;  1BWY A;  3FEP A;  5J19 A;  4NV7 A;  3T2X A;  3F6Z B;  2Y32 A;  1OPB A;  2QZU A;  2G79 A;  3HWE A;  1STS B;  3ZW0 B;  1JJX A;  4O49 A;  1YWC A;  3P02 A;  4ORY A;  4K19 A;  2K23 A;  4Z2P A;  3VG4 A;  4IBA A;  2RTG B;  2C4I A;  2MF6 A;  4ZHD A;  2X34 A;  4XMF A;  2C1S A;  1JIW I;  2ZAG A;  5EZ2 A;  4MVL A;  2FGS A;  1JMX A;  2KTS A;  1E5P A;  4BVM A;  4WHK A;  4BX6 B;  2QOS C;  3FA8 A;  2IZK A;  3N91 A;  1IJ8 A;  5L8O A;  3FA6 A;  1STP A;  4YDA A;  1HN2 A;  1Y53 X;  3FEK A;  1EIO A;  4WFV A;  1XCA A;  2VFC A;  2FR2 A;  2WR6 A;  1LPJ A;  1KQW A;  1RXK A;  3FA9 A;  5L8N A;  3ZW1 A;  5DNJ A;  1VPR A;  1VWJ B;  5DMV C;  2A5C A;  4IB9 A;  2LA7 A;  4GJV A;  3VG7 A;  1NGL A;  3BRN A;  4Z28 A;  1S7D A;  5EDB A;  1FE3 A;  3KDR A;  2HMB A;  1SXU A;  1E00 A;  4CYR A;  4HPD A;  2QMI A;  1KL4 A;  5HAE A;  1SRG A;  2MWH A;  5HCC C;  4CXU A;  1N2K A;  2OY5 O;  1JZU A;  2OJX A;  4GGZ A;  3JS1 A;  4LKP A;  1I9H A;  2OL6 O;  2JU3 A;  3P6E A;  2G78 A;  1AVE A;  4I3D A;  4IB7 A;  3VHH A;  2RN4 A;  4TQ2 A;  2IZA A;  1DV9 A;  3KFF A;  4EFG A;  1SWE A;  1YWD A;  2NND A;  4YGZ A;  1E06 A;  3X00 A;  1E2T A;  5H9L A;  4Y0P A;  4BX7 B;  1G74 A;  3HOE A;  3BZI A;  5FAZ A;  3P6D A;  1B56 A;  2G7B A;  1LFO A;  3F8A A;  3SLT A;  4GGR A;  1LIE A;  4CXS A;  1VWK B;  4A1Y A;  3TGC A;  5B2A O;  5HTE A;  1ERX A;  1OPA A;  4QGW A;  4OS8 A;  3AKN A;  4ZFX A;  4HPB A;  4HPC A;  3BSZ E;  5IRW A;  3D97 A;  1VWG B;  2R56 A;  1DC9 A;  1SWH A;  3CR6 A;  1VWN B;  5B5F A;  3SLO A;  4ORX A;  4ZH6 A;  4NLJ A;  4GU8 A;  2JU7 A;  1PMP A;  1LDQ A;  4U9C A;  4U8U N;  4HCO A;  1AB0 A;  4FBR A;  4QQ1 A;  1QFT A;  1PTS A;  1QY1 A;  2A5B A;  3TGA A;  2POA A;  2A0A A;  3RDX A;  1S2P A;  2BHV A;  5HA0 A;  2BT9 A;  3EMM A;  5FQ7 E;  1TVQ A;  4PSQ A;  2HKD A;  4G7N A;  3WVM A;  5BVQ A;  1O8V A;  4O9W A;  4ZHG A;  4A1H A;  2XKL A;  4KCA A;  2QOM A;  3B2H A;  2AKQ A;  1KT3 A;  3EYC A;  1BSY A;  2F09 A;  4H71 A;  5CYB A;  2IZJ A;  1N9M A;  4QGX A;  4O3X B;  1VWO B;  2IZF B;  3HIK A;  1B0O A;  4TKH A;  1SY1 A;  4PJ2 A;  1TOW A;  4QYP A;  4WHH A;  3FMZ A;  5F2B A;  2OY7 A;  2OL8 O;  3T6L A;  4O4O A;  3GYW A;  4A60 A;  4ZHH A;  5H9K A;  3P6G A;  1ZNH A;  2O62 A;  5KIC A;  3RE5 A;  4IMN A;  3SZJ A;  4FDJ A;  2Q2P A;  1SWT A;  1GT1 A;  2RTR B;  4YGH A;  2AL0 X;  5B27 A;  3IA8 A;  4XMD A;  3PED A;  3MM0 A;  1O1U A;  1PEE A;  1DZK A;  5CHK A;  4ZR2 A;  3CBS A;  2I5Z O;  2Z4H A;  2FWV A;  3ZW1 B;  1NQM A;  3PEC A;  4EDE A;  5HZ8 A;  1MX8 A;  3D9W A;  3ZQ3 A;  4CPF A;  3P6C A;  3CWK A;  1LIF A;  4LZV A;  3STN A;  1HY2 A;  5H9N A;  3EBW A;  5JD2 A;  3NQ3 A;  3BY0 A;  4FBV A;  2QO4 A;  3PH5 A;  1KZX A;  1U18 A;  4TJZ A;  3EBK A;  3ZWE A;  2GTL M;  1VWA B;  4ARH A;  4DQ3 A;  1U0X A;  2IZE B;  4CDD A;  3G7X A;  3C78 X;  4ZH9 A;  2R74 A;  3BLG A;  4KII A;  3FLL A;  1QAB E;  2Y3F A;  3WJB A;  4E67 A;  2M4L A;  1E33 P;  1ZNE A;  3FS3 A;  3CKF A;  3OBL A;  3KFH A;  3VU1 A;  1TXL A;  4YKO A;  3BX7 A;  3SLJ A;  4Z27 A;  1LKE A;  5DAY A;  2OY1 O;  3ZI8 A;  2FHL A;  4ORS A;  3RDS A;  2WWP A;  1SY2 A;  4Z6J A;  2RTQ B;  2OZQ A;  2HZQ A;  4GD9 A;  3OJY C;  3S60 A;  4NLI A;  2RTA A;  2PY1 A;  1PBO A;  3FEL A;  4CXK A;  2RTN B;  4WHL A;  4MVK A;  4ID2 A;  4O3Y A;  4U3Q A;  1SLG B;  4GDA A;  1SWC A;  2WEX A;  3FDC A;  3STM X;  4BGF A;  3MG5 A;  3K3L A;  2RTI B;  2YG2 A;  4JHQ A;  5AJB A;  1GT5 A;  1SA8 A;  1G7N A;  3Q6L A;  2WEW A;  1MX7 A;  3ED4 A;  1UZ2 X;  2ZSC A;  4YDB A;  2FTB A;  5IO7 A;  4NV8 A;  1AEL A;  4CPH A;  1LID A;  3FEN A;  4H5X A;  1B4M A;  3D4R A;  5BVS A;  3HOL A;  3D95 A; 
#chains in the Genus database with same CATH homology
 1ZIV A;  3ERV A;  1PPP A;  1U9W A;  4N8W A;  1O0E A;  1M6D A;  2DJF B;  4QH6 A;  2DCC A;  3LM3 A;  3ZUA A;  1ITO A;  1AUK A;  1KHP A;  3MHS A;  4I04 A;  3NHE A;  2FTD A;  3KSE A;  3KDR A;  3K8U A;  1F2C A;  3BPF A;  2E02 A;  1CQD A;  1VJV A;  1X9Y A;  3H8B A;  3K9M A;  1EF7 A;  2FT2 A;  5JH3 A;  2BDL A;  3BWK A;  4FJC A;  2AS8 A;  2G8E A;  4CYR A;  3RVV A;  4CXU A;  4BQV A;  4WA6 A;  2B1M A;  1N2K A;  8PCH A;  3BC3 A;  3BOW A;  1BQI A;  2E00 A;  4BS5 A;  3QT4 A;  3D6S A;  2PBH A;  2GFO A;  7PCK A;  4G54 A;  3E1Z B;  1A6R A;  2OZ2 A;  4W4U A;  1E3C P;  4PP2 E;  2FUD A;  5CVO B;  1PXV A;  1K3B B;  4FIP A;  3MHH A;  3IUT A;  1W4T A;  2CB5 A;  4PI3 A;  1E2T A;  2VKZ G;  4QBB A;  1AEC A;  2PAD A;  3KX1 A;  2UV8 G;  1NB5 A;  3PBH A;  1E2S P;  1DEU A;  3N3G A;  4CXS A;  4YYS A;  2XU3 A;  2E03 A;  2IPP B;  3IMA A;  3IOQ A;  2R9M A;  4N7V A;  3USV A;  3P5V A;  4RY2 A;  3RVW A;  1N2L A;  3N4C A;  1TL9 A;  2AIM A;  4Q8G A;  1W6F A;  4N7Z A;  4DMY A;  2FO5 A;  4DMX A;  2R9F A;  3LTW A;  1ICF A;  1CTE A;  2PRE A;  1TLO A;  1GCB A;  2G6D A;  4CDC B;  2ARY A;  3CH3 X;  1MHW A;  2C0Y A;  3WXE A;  3CBK A;  1VSN A;  3MOR A;  2YJB A;  2NQG A;  2FQ9 A;  4YYW A;  4XUI A;  4W5C A;  1AIM A;  1PCI A;  3LFY A;  1CJL A;  1AU2 A;  1F29 A;  2DC8 A;  4CDD B;  2G7Y A;  3KFQ A;  1XKG A;  3V6C A;  4G7N A;  3KKU A;  2DCD A;  1PIP A;  5CVN B;  5K16 A;  2DZZ A;  2FRQ A;  1W5R A;  4B55 A;  1MIR A;  1DF0 A;  4MSX A;  1ZCM A;  5AJ9 A;  3S3Q A;  1PPD A;  1MEG A;  4OEM A;  2DCA A;  4QRV A;  2HHN A;  1YAL A;  4QRG A;  2ATO A;  3O1G A;  1BGO A;  1Y4H A;  3HHI A;  4MZS A;  3PNR A;  3IV2 A;  3I06 A;  5A24 A;  1MDW A;  4YYU A;  2AYO A;  2YJC A;  3TNX A;  3O0U A;  2FRA A;  3OVZ A;  2NQA A;  2AUX A;  2VHS A;  2AUZ A;  3P5W A;  3F75 A;  3H89 A;  3K24 A;  3OVX A;  4MZO A;  3C9E A;  3P5U A;  1GX3 A;  1CB5 A;  1NPZ A;  1SP4 B;  3CBJ A;  1EWM A;  3GYW A;  2BSZ A;  3WXF A;  4YYQ A;  1CV8 A;  5JA7 A;  3M99 A;  2AVW A;  4W5B A;  1IWD A;  2P7U A;  1U9V A;  4N9J A;  1AYU A;  1NQC A;  4X6H A;  3QJ3 A;  5CHV A;  4FDJ A;  2HD5 A;  1U9Q X;  2F7D A;  1SNK A;  3GYV A;  2P86 A;  4ZUX U;  1JQP A;  2JQF R;  1MS6 A;  4I07 A;  1NL6 A;  1U9X A;  6PAD A;  2BDZ A;  3HMJ G;  1AU4 A;  1YT7 A;  1ME4 A;  1QOL A;  2F1G A;  2GHU A;  3PW3 A;  1PAD A;  1BP4 A;  1AYV A;  4PAD A;  3MTN A;  9PAP A;  1U5I A;  3CH2 X;  3U8E A;  3B79 A;  3HWN A;  1MEM A;  2R6N A;  4AXM A;  2DC9 A;  4FK5 A;  3KWB X;  1AU3 A;  2OP3 A;  2YJ9 A;  4GUZ A;  4CYS A;  3BPM A;  4YV8 A;  2DZY A;  4K7C A;  2R9C A;  3D9W A;  3HHA A;  2Y6E A;  2ACT A;  4QRX A;  2DC6 A;  1QXP A;  3H8C A;  4X6I A;  3LXS A;  2B1N A;  4YYV A;  1E1Z P;  1PPN A;  2WBF X;  1P49 A;  1PBH A;  2FYE A;  4P6G A;  1CPJ A;  1EWO A;  1KHQ A;  4N79 A;  4NKB A;  4P6E A;  2P0R A;  2R9N A;  5F02 A;  4CDE B;  2XU5 A;  2XU4 A;  2IBI A;  1CSB B;  3PDF A;  4CDF B;  1EWP A;  3P5X A;  1CVZ A;  1YK8 A;  1FSU A;  4YYR A;  1E33 P;  2JQG R;  1YK7 A;  3I3T A;  3FS3 A;  2XU1 A;  4I05 A;  3OIS A;  5EGW A;  1KFX L;  2E50 A;  4FDI A;  3KW9 A;  4NV7 A;  3F5V A;  1KXR A;  2DC7 A;  4OEL A;  3H6S A;  1PPO A;  1F2B A;  1QDQ A;  1TU6 A;  1ME3 A;  3H7D A;  2QZU A;  2DCB A;  5DAY A;  3AI8 A;  3OF9 A;  3QSD A;  2NQD B;  5J94 A;  2AYN A;  3BCN A;  3DF0 A;  2O6X A;  5CHT A;  5EF4 A;  1KFU L;  2E01 A;  2H7J A;  1NLJ A;  1HUC B;  3N3K A;  4HWY A;  1EWL A;  2NQI A;  3S3R A;  4KLB A;  1YVB A;  5PAD A;  1GMY A;  1STF E;  1NB3 A;  1GLO A;  1AU0 A;  4BS6 A;  4CXK A;  1AYW A;  1THE A;  3WXG A;  4AXL A;  2VFB A;  2YJ8 A;  2AU1 A;  4X6J A;  1S4V A;  4C5P A;  2HH5 A;  3KWZ A;  4CZW A;  3LXQ A;  1F2A A;  3IHP A;  1BY8 A;  2YJ2 A;  2VHF A;  5FPW A;  4BGF A;  4NK7 A;  4N4Z A;  5CVM A;  4BSQ A;  3IEJ A;  4Q8H A;  3HD3 A;  3ED4 A;  1FH0 A;  2Y5B A;  4PP1 A;  1POP A;  2CIO A;  4XR7 A;  3GCB A;  1QMY A;  4BPV A;  2PNS A;  4NV8 A;  2OUL A;  2VFC A;  2R9O A;  2HXZ A;  2DJG B;  2G8J A;  3HFD A;  4YVA A;  3V6E A;  1ATK A;  1Q6K A;  1CS8 A;  1Y08 A;  3RVX A;  3OF8 A;  1PE6 A;  1GEC E;  1HDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...