1E2TA

Arylamine n-acetyltransferase (nat) from salmonella typhimurium
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPFENLDVLLPREIQLDETALEEKLLYARRGGYCFELNGLFERALRDIGFNVRSLLGRVILSHPASLPPRTHRLLLVDVEDEQWIADVGFGGQTLTAPLRLQAEIAQQTPHGEYRLMQEGSTWILQFRHHEHWQSMYCFDLGVQQQSDHVMGNFWSAHWPQSHFRHHLLMCRHLPDGGKLTLTNFHFTRYHQGHAVEQVNVPDVPSLYQLLQQQFGLGVNDVKHGFTEAELAAVMAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-HYDROXYARYLAMINE O-ACETYLTRANSFERASE
publication title Structure of Arylamine N-Acetyltransferase Reveals a Catalytic Triad
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 78
structure length 274
sequence length 274
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.118: N-hydroxyarylamine O-acetyltransferase.
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 1e2tA03
3.30.1120.150 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1e2tA02
4NV8A 2VFCA 1GX3A 1E2TA 3LTWA 2BSZA 1W4TA 4GUZA 2VFBA 4B55A 1W6FA 4NV7A 4BGFA 3D9WA 4C5PA 1W5RA
chains in the Genus database with same CATH superfamily
2MJIA 3NX2A 1BSQA 1PBYA 4GU8A 1GT5A 1NC9A 5H8TA 5H9AA 4O4UA 1KL3A 1SY3A 4ORUA 3V8UA 4MISA 3NQ9A 2CM4A 4MVKA 2C4IA 5D45A 4CV7A 2DJFA 1DF8A 3CKFA 4HY2A 2BSZA 1FEMA 4NNTA 1OSPO 1RXKA 3UEVA 4ZR2A 3D9WA 5HCCC 5IXGA 3VG2A 2A5BA 3RQ7A 4CK4A 4CPHB 2QO5A 2C1SA 4IB8A 3OD9A 4KIIA 2LFOA 1SXXA 4AZPA 2OFMX 1SLDB 2VDFA 1TXLA 3RDMA 1N43A 2OFBA 3L4RA 2QMIA 1ZNHA 1W6FA 4OEMA 1XCAA 3B2HA 2W2FA 4CDCA 5HTDA 1RSUB 2WQAE 1ICNA 5F58A 4GETA 1YUPA 4IB9A 3WOVA 1D2UA 2AF5A 4LKTA 2X56A 1B56A 1U0XA 2Z4IA 3APWA 4Z6JA 5K68A 1X8QA 2QZUA 3HTYA 2MO5A 3SAOA 3JQOA 3EYCA 2I5VO 3CMPA 4BX5A 2MHDA 5F6ZA 1BEBA 3ZW1B 1QQSA 4BVMA 2Y3FA 3BX8A 3P34A 1S2PA 1LCVA 1XKIA 1A18A 1STSB 4GUZA 2MM3A 1RAVA 4ZHHA 1IFBA 1SWQA 4N7CA 4DNEA 1KXOA 2MWHA 4R0BA 2HKDA 2IA9A 1OPAA 1Q4OA 2PY1A 3SLJA 2GH7A 2K23A 2CM9A 3B2LA 3FLLA 3VHMA 4D6BA 5DNJA 1SRFA 3EM0A 3HOLA 2ASNX 1JMZA 2R73A 4ORRA 5FENA 1Y9LA 2A5CA 1GKAB 1LKEA 3GYVA 4YH0A 5D47A 1ACDA 2IZEB 1HQQA 1LDQA 4RCPA 4RUUA 5FFHA 3FA6A 1OEKA 2ACPX 4GH7A 1LDOA 1RXJA 4HFOA 3FIDA 3TGAA 2JU3A 4BJ8A 3ZUOA 4ORYA 2HMBA 1CBIA 3S5XA 1SWPA 2OVAA 1B0OA 1FTPA 4G7NA 2DJGA 1YWDA 2OJXA 4WHLA 2FT9A 1DC9A 4E9CA 5LJGA 2OVEA 4MEEA 1IIUA 4BX7A 4YYPA 4K19A 3EW2A 3HWFA 1QG5A 4CDFA 4YCEA 4CXSA 4ZHCA 5LKFA 1LIFA 5B11O 1E00A 2RTBB 3FMZA 4BQUA 4OMWA 4YFPA 3ELZA 2RTJA 3NBXX 4IRWA 2QO4A 4GNYA 2W2AA 3O19A 3ZWEA 5DMVC 4BX6A 4YFRA 1HY2A 4NYRA 1CRBA 1KT3A 3WJEA 2ZAGA 3MBTA 5DAYA 1MEPA 3PK2A 4PSQA 2I9ZA 3T2XA 5B5GA 5AJCA 4U8UO 4BOEA 3RY1A 3T6FA 1BWYA 5IRUA 3HWEA 1GM6A 1D3SA 4TJZA 1F32A 3FEPA 3VHHA 5L3YA 2CAMA 1IKEA 4LQZA 3H3IA 2L68A 1SRJA 4FBRA 4ML7B 4ZFXA 4ZGFA 2NNDA 1ALBA 3B2KA 2UV8G 1OEJA 5J19A 5K06A 3VG7A 4I3BA 1JMXA 2WPUA 1DV9A 4XMDA 5HZQA 1T0VA 2OF8A 4O4XA 3T1DA 4ORWA 1I4UA 1VWQB 1RBPA 4GDAA 1SY2A 4JHQA 3VGWA 2Q2PA 2L5PA 4GNWA 3D95A 1KT5A 3PECA 3RSWA 3LM3A 4YGGA 3P35A 2RCTA 4KC7A 1KZWA 4U46A 2F09A 5DPQA 3BDRA 4U8UM 4MVEA 3TF6A 2RTDB 3WJGA 1VWFB 2VKZG 3U0DA 2AT6X 1SWLA 1JV4A 5EDBA 3Q1IA 1KGLA 1QWDA 3DTQA 4IAWA 4OMXA 5LJKA 4BCSA 3HWDA 2OY7A 1AB0A 1NGLA 2A0AA 5C0NA 1BM5A 1CBQA 1VPRA 4YVBA 2AT0X 2LA7A 4AZRA 4CXUA 1ZRYA 1N4JA 3BY0A 3GYWA 5LJCA 1BBPA 4YBPA 1LIDA 5IRWA 2QOMA 3KFIA 4ORXA 4XMEA 4EEJA 3FR2A 2AVIA 4AZQA 4Z27A 4ZJ0A 4L3RA 4U3QA 3WZQA 3ZW0A 5BVQA 4CDDA 3AEHA 4CPIA 4NNSA 1PTSA 1PMPA 2YMSA 1K3BA 1SWHA 2A8GA 1OBPA 2A2GA 4UU2A 2CBSA 4Y0QA 4A8ZA 1ML7A 3P6DA 3RE5A 2NNQA 4EQAC 3FS3A 4IMNA 4C5PA 4IBAA 3F8AA 1O1UA 4X9RA 3CBSA 4LKPA 3NX1A 1VWIB 3B2JA 1X8NA 1B8EA 4QYNA 2IZDB 2WQ9A 5HZ8A 2RTIB 3P6GA 1YP6A 2JOZA 4AZOA 4HCOA 4LZUA 1A3YA 4MVLA 2FWVA 5IO5A 1MVGA 2RTMA 2X8FA 1SWBA 2O62A 3WBGA 5H9KA 4J7BB 1AVGI 1LUQA 1MK5A 5B29A 3P36A 3MG5A 2JW1A 2G8CO 2RQ0A 1VWKB 4DQ3A 1OBUA 1YWCA 4WBKA 3P6HA 4ES7A 4FGIB 2F73A 1X89A 4OS0A 1CBSA 3RZYA 4H5XA 4HPBA 4ID2A 4FDIA 2BS5A 1HN2A 4I60A 2RTNB 4EKVA 4ZH6A 2IZGB 4IMOA 2IZJA 3APUA 1I06A 3P2WA 2FR2A 1E3CP 2RTEB 5HBSA 2QM9A 1N7YA 1GT1A 1I04A 1N2LA 4QAEA 3T6LA 4BX5B 1WBIA 1B4MA 3RBYA 4QZUA 1SRHA 3RE6A 1TVQA 3MM0A 1O8VA 4HPDA 2RTFB 2P8GA 3SZHA 3SLOA 2X34A 1JIWI 3APXA 2ACOA 3C78X 1VYOA 3FW5A 1YWBA 3SLTA 4FBOA 3LXQA 1NP1A 4KC8A 2FS7A 3FR4A 3MVFA 1GXAA 4N7VA 1AVEA 3CBCA 3WZPA 3UEXA 3BZIA 2X45A 1JYJA 4N7ZA 2HNXA 1VWAB 1EPAA 3HFDA 1SXWA 1GT4A 1SWOA 1U18A 4NLIA 3NP1A 2X55A 4O3XB 4ALBA 3LHNA 1G85A 3N91A 2IZCB 4A60A 2AL0X 2AH7X 5HAEA 2KD2A 2ZSCA 3CQNA 1ZNGA 4TKBA 1MOYA 2Y3EA 1E06A 1VWEB 4YDAA 2Q39A 4U8UN 4H71A 3Q6LA 4YKMA 4Z2PA 4Z2OA 2GTFX 3EBKA 5LJEA 3FELA 2RTAA 3AKMA 3RY2A 3TGCA 4AZMA 3BLGA 2JGSA 1VWPB 2OY1O 3PH5A 1LIBA 4CPFA 3FA7A 1NBXA 1SXUA 4ORSA 4NLJA 1YP7A 4KCAA 4RS6A 4O3WA 2NNEA 1R0UA 1IW2A 5EDCA 4CPEA 3BU1A 4BX7B 1LCZA 1BLRA 2HYSA 4O3YA 2X4MA 5AQ6A 3VHIA 1SWEA 2W2BA 1BJ7A 2UYWA 2FHLA 4GGZA 5K67A 5LJDA 1KT7A 1E1ZP 3FYFA 1UYOX 3PQUA 1EXSA 3HK1A 1NQMA 2OL6O 5BYPA 5LJBA 1O1VA 4TKHA 1QY1A 2N93A 3NQKA 2BT9A 4XMCA 3APVA 2K62A 1TOUA 4GE1A 3SZIA 1AQBA 1H91A 5EEEA 5FQ6E 4BX6B 1MM9A 4QGWA 4Z28A 1VWMB 3P6CA 3ELXA 2RTHB 2ALLX 4ODDA 2WSJA 5FQ7E 5CSEA 1E2TA 2HZQA 4XMGA 4FBVA 3K3LA 2Q2MA 1MX8A 1JJJA 1W5RA 4I95A 2CZTA 3RDXA 3VG6A 4WHKA 4A1YA 2GTLO 3VPJE 4OKAA 5HWZA 1E02A 1LCWA 4WFVA 4YFQA 2VFCA 1VYFA 1VWNB 1UREA 4CYRA 5FQ8E 4O9SA 1EI5A 1A2DA 5B3MO 4GD9A 1CJ5A 1WUBA 1OEEA 2A13A 1FE3A 1X8UA 3AUMO 4HWMA 4TLJA 2E4JA 1SY0A 5JD2A 4A1HA 3STNA 1LNMA 3UEWA 4MIRA 3KDRA 2JU7A 3NR3A 4UU3A 4E67A 3VE1A 1ZNDA 1YWAA 4RUNA 1FSUA 1SLFB 3S26A 1DZPA 1F34B 3D4RA 4NKBA 5JR8A 2JN3A 2X32A 1K24A 1JQPA 5LJHA 4GK9A 2AT5X 3FENA 2FS6A 2FGSA 1SWUA 2WUTA 1TW4A 1HBQA 3C77X 3PEDA 2RTPB 1SWKA 2X8SA 4GZVA 2GTLM 3RWXA 1HMRA 1GX8A 5HTEA 3LTWA 3JS1A 4Y0PA 3WZOA 3I17A 5IRAA 2FKJA 4O49A 4BGFA 4QGXA 1LPJA 4NYQA 1MX7A 4JNJA 1N0SA 1EIIA 1SWDA 4XMFA 1CBRA 2C1QA 3WJBA 4CXKA 1JZUA 1UMWA 1PBOA 4NK7A 5B10O 3BS2A 1EIOA 4Z2VA 4GGRA 5EPQA 4I3CA 3ZW0B 3GAQA 4NP1A 4TNNA 1U17A 5LKEA 2OY8A 2OZQA 1SWFA 1QFTA 5KHPA 1HMSA 3ED4A 1VWGB 3KZAA 2DM5A 4CSBA 4I6SA 2OF9A 1QY0A 5D8JA 4AW8A 1ZNLA 3KFGA 1STRB 1NDJA 3G7XA 3QKGA 1SLGB 5HA1A 1GGLA 5L8NA 4HPCA 1X8PA 2OFRX 2OVSA 2ANSA 2KT4B 2RD7C 2RTLA 1JJUA 2LB6A 1OBQA 3PP6A 3KFHA 4WFUA 5CHKA 3C5LA 4XB0A 1IKJA 3ZI8A 5HCDC 3HOEA 4MVIA 5DMSA 4ZGUA 4X9WA 1LICA 3BRNA 3S5VA 4Y5DA 3CR6A 4HPAA 3VU1A 2IZLB 2CBRA 1SWSA 2AT8X 4KH8A 1W4TA 3ZUIA 3DSZA 1HQPA 3PQSA 1X8OA 4EDEA 4U9CA 4I9RA 2EU7X 1NP4A 4M7MA 4YGHA 3OBLA 3Q34A 3UAQA 1PEEA 4QGVA 2OL8O 4BBOA 2OFAA 2AMMX 4GJVA 3BX7A 1SXYA 2R56A 2OYBO 1E33P 1BSOA 4D6AA 2RTOB 5KIDA 2RN4A 4ZH9A 5F7GA 1ERXA 1TOWA 2FLJA 1Y55X 3RDSA 5H9LA 2KTDA 3WJFA 3ZZVA 3RDOA 2E50A 1VWCB 2RTRB 1SREA 1FENA 4DCBA 1GX9A 4TKJA 2FRSA 4QZTA 2X46A 4IB6A 1VWBB 1N9MA 3BU9A 1N9YA 1GT3A 2LKKA 3VG3A 1HDHA 1KFFA 4ALOA 2YG2A 5HZ6A 5AJBA 1ZNKA 4WHHA 3WXQA 4QNIA 4TQ2A 1DZKA 4L1NA 3QQ2A 1AUKA 5EEDA 5EZ2A 3EMMA 4NW4A 4DQ4A 4GRJA 2R74A 3F6ZB 3AKNA 4CPHA 4QRLA 4YGZA 3OE3A 2OGQA 1E2SP 3PH6A 2PI3O 5B27A 1EUOA 3OJYC 1X71A 4HABA 3P6EA 5D48A 1AELA 3HIKA 4QQ1A 1BSYA 4GGTA 5B5FA 4ZHDA 4OS8A 1Q4KA 3TZSA 1STPA 4ZHFA 2G78A 2IZFB 4X9VA 2KTSA 4N9JA 2A3FX 2BLGA 5D4AA 4O4OA 5HA0A 3T2WA 2WWPA 3RDQA 1KL4A 2Z4HA 1VWJB 1N2KA 1IFCA 2LBAA 2GTLN 2G5LA 5HZ9A 2G79A 2IZIA 3S60A 1T8VA 1LIEA 1JJXA 3TGBA 2POAA 1JBHA 4CYSA 1LELA 3FR5A 1VWDB 4FDJA 4O4SA 1EW3A 1EPBA 1RLBE 2RA6A 3P2ZA 5HCEC 2QO6A 3ZW1A 1ZNEA 4AZNA 4WHIA 1ERBA 2ZAIA 5IO6A 1SWRA 2QCBA 4INNA 3U9PC 1SWTA 2LBVA 1BRPA 2OL7A 1HMTA 3O22A 3EW1A 1Y53X 3FA9A 2IFBA 1SWCA 1A57A 3FDCA 3GE2A 1SLEB 1T68X 1LFOA 2FR3A 3NPOA 1PM1X 5BVTA 3ZW2A 4OELA 2M4LA 2L67A 3NADA 3C76X 5AEOA 4YCHA 1QY2A 1VWHB 3HPEA 2VFBA 1HBPA 4NV7A 2X8TA 3HIHA 1S44A 4AYHA 1G74A 4ZCBA 4XMHA 1Y0GA 2Y32A 3KFFA 4GJSA 3VG5A 4LZVA 1KOIA 1GKAA 1SRIA 1FELA 4DFWA 2AT3X 2XSTA 3IA8A 4E9DA 2RCQA 1LF7A 1KT4A 2N19A 5F2BA 1I78A 2RTCB 1GX3A 1MUPA 2FKGA 3B2IA 2AKQA 4O3ZA 3I0AA 1G5WA 2BS6A 3WJDA 3HMJG 4YKOA 4Y59A 1HXLA 4ZHGA 1DZJA 1SWGA 4OS3A 2BC3A 4EXZA 1OPBA 2NP1A 1SRGA 4PJ2A 4IB7A 1SWAA 4N7DA 4B55A 1EALA 1Y9TA 4NV8A 4ON1A 1P49A 1IJ8A 4ARHA 5LHZA 1AVDA 1JYDA 4YDBA 1FJ1E 4CDEA 2F01A 1G7NA 2G7BA 4Y0RA 4LKLA 5CYBA 3SZJA 3P02A 3VE2A 4O56A 1HXZA 1Z24A 4O6WA 1I9HA 5IO7A 1VWLB 2IZAA 1VWOB 1P6PA 1SWNA 3EBWA 3O2YA 5L8OA 1NQNA 3WZNA 3VG4A 2HLVA 2BHVA 3LV4A 5FAZA 5DG4A 5B2AO 1E5PA 1QFVA 3RKGA 1KL5A 3WVMA 5F1EA 3UEUA 1Y52X 2JMBA 3FA8A 2JU8A 3CWKA 4GDZA 2IZBA 1DF3A 2Q9SA 3WYQA 1YIVA 2IZKA 2WEWA 3FIQA 2IZHB 4QYPA 1ICMA 3X00A 1RSTB 4IABA 4YBUA 3CKGA 1QABE 1DZMA 4O9WA 5CE4A 2RTKA 1S7DA 1VWRB 1KZXA 1A87A 1SWJA 1SA8A 3WYPA 3FVHA 2RTGB 4JO6A 3BSZE 4LKMA 4KT5A 3IFBA 2CZUA 5H9NA 3P24A 2QOSC 3D96A 5BVSA 3SOTA 1I05A 2GJ5A 3HWGA 2L9CA 1SY1A 1L6MA 2WEXA 4Y0SA 3FEKA 3MX7A 1KQXA 4COTA 1KQWA 2MF6A 2HZRA 1RXHA 2Q4NA 3PPTA 1SMPI 1KT6A 3CQRA 3NQ3A 2OY5O 2OVDA 3E3CA 3D97A 1VYGA 3STMX 5F6BA 4EFGA 2KW1A 1BRQA 4YMYA 2FTBA 3WJCA 1ADLA 3FW4A 1UYNX 2WR6A 3P37A 2XKLA 5AJ9A 2I5ZO 2I9XA 4M6SA 2UZ2A 4IAXA 4I9SA 1FDQA 2FHNX 3JSQA 1UZ2X 1MDCA 2A2UA 4FQBB 5HZ5A 3U03A 1DFVA 3PDFA 4I3DA 3ZQ3A 5KICA 3F9DA 5L8IA 3EC5A 2GC9A 1EQDA 4GKCA 3STKA 3KQ0A 3RDUA 3KVNA 3P6FA 4JGLA 2RTQB
chains in the Genus database with same CATH topology
4BSQA 2ATOA 2PBHA 2DC6A 2B1MA 3LM3A 5J94A 3MHHA 2AUZA 3C9EA 2AU1A 1N2KA 2PADA 1E2TA 3O1GA 1PBHA 1CJLA 1BY8A 1U9XA 1NL6A 3H89A 4YYRA 4BS6A 3IV2A 2VKZG 2FRQA 2BSZA 2PNSA 4CYSA 4YYSA 3IMAA 3MORA 1W5RA 4YYQA 1PIPA 4FDJA 4P6EA 5CVNB 4YVAA 1SNKA 3BWKA 3D9WA 4N8WA 2FTDA 2HD5A 2VFCA 3KFQA 1KHPA 4YV8A 2F7DA 3S3QA 2CIOA 4CYRA 1CV8A 3BPMA 3DF0A 1AU4A 1CTEA 4CXUA 1CVZA 1TLOA 1VJVA 2NQGA 1BQIA 3GYWA 3K24A 5JH3A 3MTNA 3KWBX 2G8JA 2DCDA 3LFYA 1F2AA 1MEMA 3PBHA 2O6XA 2FT2A 1AIMA 3KDRA 1W6FA 4CDFB 4OEMA 4OELA 1DF0A 1FSUA 3I3TA 3P5UA 3P5WA 1AYVA 3OVXA 1MDWA 5CVOB 2NQIA 1DEUA 1CB5A 2VHSA 3BOWA 2VFBA 4NKBA 4NV7A 2YJ9A 1QOLA 1JQPA 2NQAA 4N79A 2JQGR 2CB5A 2OULA 3CBJA 3IEJA 2HHNA 4FJCA 4PI3A 1PXVA 1CS8A 3FS3A 1AU3A 4I05A 4C5PA 2AVWA 1GLOA 3IOQA 3RVWA 2QZUA 1A6RA 3K9MA 1GECE 3IUTA 3H8BA 1YT7A 2P7UA 1BP4A 2ARYA 3K8UA 1AYWA 1KXRA 4PADA 3F75A 4RY2A 2DC9A 2E03A 2E02A 3LTWA 1ATKA 1PPOA 2R9CA 2XU1A 3HHIA 2BDLA 2P0RA 4FIPA 2IPPB 2R9OA 1GX3A 2G8EA 1EWMA 2XU3A 1YK8A 3S3RA 4BGFA 3V6CA 3HMJG 1FH0A 3P5VA 2YJ2A 3H7DA 3N3KA 1CPJA 2PREA 4N4ZA 4PP1A 1KHQA 3M99A 4I04A 4MSXA 4CXKA 4WA6A 4W5BA 4XUIA 4I07A 4NK7A 3KX1A 2AIMA 4GUZA 4B55A 4NV8A 1EWOA 2AS8A 2DZYA 1P49A 3RVVA 3B79A 2ACTA 2HXZA 4CDDB 3BC3A 2VHFA 1YALA 1ZCMA 4CDCB 4MZOA 5CHVA 4FDIA 1F2CA 1U9QX 1TU6A 1K3BB 3ED4A 5PADA 3WXEA 2DZZA 2E01A 1POPA 3V6EA 3ERVA 1ZIVA 1SP4B 3QJ3A 4X6HA 3PW3A 1KFUL 4DMXA 4QRGA 1THEA 1CQDA 2R9FA 1E3CP 3KSEA 3IHPA 2GHUA 1XKGA 2NQDB 4DMYA 1N2LA 2FRAA 3GYVA 4BQVA 3HD3A 2DCBA 3BPFA 2DC7A 1PADA 5EGWA 1O0EA 1MEGA 1NB3A 3QT4A 4AXLA 4W5CA 2C0YA 3LXSA 4QH6A 2FYEA 3E1ZB 2YJBA 3QSDA 1PPPA 1U9VA 2DJFB 3F5VA 1PPNA 2OZ2A 3PNRA 2H7JA 3MHSA 1AYUA 1NB5A 9PAPA 3O0UA 1QDQA 3NHEA 3OF8A 5A24A 3LXQA 2HH5A 3CBKA 4X6JA 3CH2X 2GFOA 4G7NA 2Y6EA 4XR7A 3BCNA 1BGOA 2AUXA 2G7YA 5K16A 4N7VA 3OISA 1QXPA 1W4TA 2G6DA 4CDEB 1IWDA 1M6DA 4K7CA 2FO5A 2P86A 2BDZA 2F1GA 4CXSA 2OP3A 4N7ZA 1ME3A 4MZSA 4X6IA 3HFDA 1Q6KA 1F2BA 1GCBA 3P5XA 3GCBA 1AU0A 3I06A 5FPWA 4CZWA 4YYUA 1YK7A 4G54A 1U5IA 1MHWA 3CH3X 1E33P 2AYNA 3WXGA 4AXMA 1Y4HA 4PP2E 4BS5A 3OVZA 3HWNA 1ITOA 2R9NA 1NLJA 1GMYA 2Y5BA 3OF9A 4FK5A 6PADA 1MS6A 5CHTA 1Y08A 4YYVA 3H6SA 2WBFX 8PCHA 2YJCA 2IBIA 1YVBA 2E50A 2JQFR 3KW9A 4Q8GA 5DAYA 3KWZA 4P6GA 5CVMA 1X9YA 4ZUXU 1U9WA 2B1NA 1HUCB 1PCIA 2DJGB 1CSBB 1EWLA 3N4CA 1HDHA 1QMYA 4HWYA 1VSNA 2DCAA 4QRXA 5AJ9A 1EWPA 3KKUA 3TNXA 1NQCA 3RVXA 7PCKA 3ZUAA 4W4UA 4Q8HA 1AUKA 1ICFA 1MIRA 2YJ8A 3D6SA 2DC8A 4QRVA 1NPZA 2XU4A 1AU2A 2AYOA 3H8CA 3WXFA 3AI8A 3USVA 1PE6A 2E00A 1E2SP 2FUDA 5EF4A 1ME4A 1E1ZP 4YYWA 3PDFA 2UV8G 3U8EA 1STFE 4QBBA 5F02A 3N3GA 1S4VA 2XU5A 2R6NA 1AECA 1F29A 2DCCA 5JA7A 1EF7A 4KLBA 2R9MA 4BPVA 1PPDA 4N9JA 3HHAA 1KFXL 2FQ9A 1TL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NV8 A;  2VFC A;  1GX3 A;  1E2T A;  3LTW A;  2BSZ A;  1W4T A;  4GUZ A;  2VFB A;  4B55 A;  1W6F A;  4NV7 A;  4BGF A;  3D9W A;  4C5P A;  1W5R A; 
#chains in the Genus database with same CATH topology
 2MJI A;  3NX2 A;  1BSQ A;  1PBY A;  4GU8 A;  1GT5 A;  1NC9 A;  5H8T A;  5H9A A;  4O4U A;  1KL3 A;  1SY3 A;  4ORU A;  3V8U A;  4MIS A;  3NQ9 A;  2CM4 A;  4MVK A;  2C4I A;  5D45 A;  4CV7 A;  2DJF A;  1DF8 A;  3CKF A;  4HY2 A;  2BSZ A;  1FEM A;  4NNT A;  1OSP O;  1RXK A;  3UEV A;  4ZR2 A;  3D9W A;  5HCC C;  5IXG A;  3VG2 A;  2A5B A;  3RQ7 A;  4CK4 A;  4CPH B;  2QO5 A;  2C1S A;  4IB8 A;  3OD9 A;  4KII A;  2LFO A;  1SXX A;  4AZP A;  2OFM X;  1SLD B;  2VDF A;  1TXL A;  3RDM A;  1N43 A;  2OFB A;  3L4R A;  2QMI A;  1ZNH A;  1W6F A;  4OEM A;  1XCA A;  3B2H A;  2W2F A;  4CDC A;  5HTD A;  1RSU B;  2WQA E;  1ICN A;  5F58 A;  4GET A;  1YUP A;  4IB9 A;  3WOV A;  1D2U A;  2AF5 A;  4LKT A;  2X56 A;  1B56 A;  1U0X A;  2Z4I A;  3APW A;  4Z6J A;  5K68 A;  1X8Q A;  2QZU A;  3HTY A;  2MO5 A;  3SAO A;  3JQO A;  3EYC A;  2I5V O;  3CMP A;  4BX5 A;  2MHD A;  5F6Z A;  1BEB A;  3ZW1 B;  1QQS A;  4BVM A;  2Y3F A;  3BX8 A;  3P34 A;  1S2P A;  1LCV A;  1XKI A;  1A18 A;  1STS B;  4GUZ A;  2MM3 A;  1RAV A;  4ZHH A;  1IFB A;  1SWQ A;  4N7C A;  4DNE A;  1KXO A;  2MWH A;  4R0B A;  2HKD A;  2IA9 A;  1OPA A;  1Q4O A;  2PY1 A;  3SLJ A;  2GH7 A;  2K23 A;  2CM9 A;  3B2L A;  3FLL A;  3VHM A;  4D6B A;  5DNJ A;  1SRF A;  3EM0 A;  3HOL A;  2ASN X;  1JMZ A;  2R73 A;  4ORR A;  5FEN A;  1Y9L A;  2A5C A;  1GKA B;  1LKE A;  3GYV A;  4YH0 A;  5D47 A;  1ACD A;  2IZE B;  1HQQ A;  1LDQ A;  4RCP A;  4RUU A;  5FFH A;  3FA6 A;  1OEK A;  2ACP X;  4GH7 A;  1LDO A;  1RXJ A;  4HFO A;  3FID A;  3TGA A;  2JU3 A;  4BJ8 A;  3ZUO A;  4ORY A;  2HMB A;  1CBI A;  3S5X A;  1SWP A;  2OVA A;  1B0O A;  1FTP A;  4G7N A;  2DJG A;  1YWD A;  2OJX A;  4WHL A;  2FT9 A;  1DC9 A;  4E9C A;  5LJG A;  2OVE A;  4MEE A;  1IIU A;  4BX7 A;  4YYP A;  4K19 A;  3EW2 A;  3HWF A;  1QG5 A;  4CDF A;  4YCE A;  4CXS A;  4ZHC A;  5LKF A;  1LIF A;  5B11 O;  1E00 A;  2RTB B;  3FMZ A;  4BQU A;  4OMW A;  4YFP A;  3ELZ A;  2RTJ A;  3NBX X;  4IRW A;  2QO4 A;  4GNY A;  2W2A A;  3O19 A;  3ZWE A;  5DMV C;  4BX6 A;  4YFR A;  1HY2 A;  4NYR A;  1CRB A;  1KT3 A;  3WJE A;  2ZAG A;  3MBT A;  5DAY A;  1MEP A;  3PK2 A;  4PSQ A;  2I9Z A;  3T2X A;  5B5G A;  5AJC A;  4U8U O;  4BOE A;  3RY1 A;  3T6F A;  1BWY A;  5IRU A;  3HWE A;  1GM6 A;  1D3S A;  4TJZ A;  1F32 A;  3FEP A;  3VHH A;  5L3Y A;  2CAM A;  1IKE A;  4LQZ A;  3H3I A;  2L68 A;  1SRJ A;  4FBR A;  4ML7 B;  4ZFX A;  4ZGF A;  2NND A;  1ALB A;  3B2K A;  2UV8 G;  1OEJ A;  5J19 A;  5K06 A;  3VG7 A;  4I3B A;  1JMX A;  2WPU A;  1DV9 A;  4XMD A;  5HZQ A;  1T0V A;  2OF8 A;  4O4X A;  3T1D A;  4ORW A;  1I4U A;  1VWQ B;  1RBP A;  4GDA A;  1SY2 A;  4JHQ A;  3VGW A;  2Q2P A;  2L5P A;  4GNW A;  3D95 A;  1KT5 A;  3PEC A;  3RSW A;  3LM3 A;  4YGG A;  3P35 A;  2RCT A;  4KC7 A;  1KZW A;  4U46 A;  2F09 A;  5DPQ A;  3BDR A;  4U8U M;  4MVE A;  3TF6 A;  2RTD B;  3WJG A;  1VWF B;  2VKZ G;  3U0D A;  2AT6 X;  1SWL A;  1JV4 A;  5EDB A;  3Q1I A;  1KGL A;  1QWD A;  3DTQ A;  4IAW A;  4OMX A;  5LJK A;  4BCS A;  3HWD A;  2OY7 A;  1AB0 A;  1NGL A;  2A0A A;  5C0N A;  1BM5 A;  1CBQ A;  1VPR A;  4YVB A;  2AT0 X;  2LA7 A;  4AZR A;  4CXU A;  1ZRY A;  1N4J A;  3BY0 A;  3GYW A;  5LJC A;  1BBP A;  4YBP A;  1LID A;  5IRW A;  2QOM A;  3KFI A;  4ORX A;  4XME A;  4EEJ A;  3FR2 A;  2AVI A;  4AZQ A;  4Z27 A;  4ZJ0 A;  4L3R A;  4U3Q A;  3WZQ A;  3ZW0 A;  5BVQ A;  4CDD A;  3AEH A;  4CPI A;  4NNS A;  1PTS A;  1PMP A;  2YMS A;  1K3B A;  1SWH A;  2A8G A;  1OBP A;  2A2G A;  4UU2 A;  2CBS A;  4Y0Q A;  4A8Z A;  1ML7 A;  3P6D A;  3RE5 A;  2NNQ A;  4EQA C;  3FS3 A;  4IMN A;  4C5P A;  4IBA A;  3F8A A;  1O1U A;  4X9R A;  3CBS A;  4LKP A;  3NX1 A;  1VWI B;  3B2J A;  1X8N A;  1B8E A;  4QYN A;  2IZD B;  2WQ9 A;  5HZ8 A;  2RTI B;  3P6G A;  1YP6 A;  2JOZ A;  4AZO A;  4HCO A;  4LZU A;  1A3Y A;  4MVL A;  2FWV A;  5IO5 A;  1MVG A;  2RTM A;  2X8F A;  1SWB A;  2O62 A;  3WBG A;  5H9K A;  4J7B B;  1AVG I;  1LUQ A;  1MK5 A;  5B29 A;  3P36 A;  3MG5 A;  2JW1 A;  2G8C O;  2RQ0 A;  1VWK B;  4DQ3 A;  1OBU A;  1YWC A;  4WBK A;  3P6H A;  4ES7 A;  4FGI B;  2F73 A;  1X89 A;  4OS0 A;  1CBS A;  3RZY A;  4H5X A;  4HPB A;  4ID2 A;  4FDI A;  2BS5 A;  1HN2 A;  4I60 A;  2RTN B;  4EKV A;  4ZH6 A;  2IZG B;  4IMO A;  2IZJ A;  3APU A;  1I06 A;  3P2W A;  2FR2 A;  1E3C P;  2RTE B;  5HBS A;  2QM9 A;  1N7Y A;  1GT1 A;  1I04 A;  1N2L A;  4QAE A;  3T6L A;  4BX5 B;  1WBI A;  1B4M A;  3RBY A;  4QZU A;  1SRH A;  3RE6 A;  1TVQ A;  3MM0 A;  1O8V A;  4HPD A;  2RTF B;  2P8G A;  3SZH A;  3SLO A;  2X34 A;  1JIW I;  3APX A;  2ACO A;  3C78 X;  1VYO A;  3FW5 A;  1YWB A;  3SLT A;  4FBO A;  3LXQ A;  1NP1 A;  4KC8 A;  2FS7 A;  3FR4 A;  3MVF A;  1GXA A;  4N7V A;  1AVE A;  3CBC A;  3WZP A;  3UEX A;  3BZI A;  2X45 A;  1JYJ A;  4N7Z A;  2HNX A;  1VWA B;  1EPA A;  3HFD A;  1SXW A;  1GT4 A;  1SWO A;  1U18 A;  4NLI A;  3NP1 A;  2X55 A;  4O3X B;  4ALB A;  3LHN A;  1G85 A;  3N91 A;  2IZC B;  4A60 A;  2AL0 X;  2AH7 X;  5HAE A;  2KD2 A;  2ZSC A;  3CQN A;  1ZNG A;  4TKB A;  1MOY A;  2Y3E A;  1E06 A;  1VWE B;  4YDA A;  2Q39 A;  4U8U N;  4H71 A;  3Q6L A;  4YKM A;  4Z2P A;  4Z2O A;  2GTF X;  3EBK A;  5LJE A;  3FEL A;  2RTA A;  3AKM A;  3RY2 A;  3TGC A;  4AZM A;  3BLG A;  2JGS A;  1VWP B;  2OY1 O;  3PH5 A;  1LIB A;  4CPF A;  3FA7 A;  1NBX A;  1SXU A;  4ORS A;  4NLJ A;  1YP7 A;  4KCA A;  4RS6 A;  4O3W A;  2NNE A;  1R0U A;  1IW2 A;  5EDC A;  4CPE A;  3BU1 A;  4BX7 B;  1LCZ A;  1BLR A;  2HYS A;  4O3Y A;  2X4M A;  5AQ6 A;  3VHI A;  1SWE A;  2W2B A;  1BJ7 A;  2UYW A;  2FHL A;  4GGZ A;  5K67 A;  5LJD A;  1KT7 A;  1E1Z P;  3FYF A;  1UYO X;  3PQU A;  1EXS A;  3HK1 A;  1NQM A;  2OL6 O;  5BYP A;  5LJB A;  1O1V A;  4TKH A;  1QY1 A;  2N93 A;  3NQK A;  2BT9 A;  4XMC A;  3APV A;  2K62 A;  1TOU A;  4GE1 A;  3SZI A;  1AQB A;  1H91 A;  5EEE A;  5FQ6 E;  4BX6 B;  1MM9 A;  4QGW A;  4Z28 A;  1VWM B;  3P6C A;  3ELX A;  2RTH B;  2ALL X;  4ODD A;  2WSJ A;  5FQ7 E;  5CSE A;  1E2T A;  2HZQ A;  4XMG A;  4FBV A;  3K3L A;  2Q2M A;  1MX8 A;  1JJJ A;  1W5R A;  4I95 A;  2CZT A;  3RDX A;  3VG6 A;  4WHK A;  4A1Y A;  2GTL O;  3VPJ E;  4OKA A;  5HWZ A;  1E02 A;  1LCW A;  4WFV A;  4YFQ A;  2VFC A;  1VYF A;  1VWN B;  1URE A;  4CYR A;  5FQ8 E;  4O9S A;  1EI5 A;  1A2D A;  5B3M O;  4GD9 A;  1CJ5 A;  1WUB A;  1OEE A;  2A13 A;  1FE3 A;  1X8U A;  3AUM O;  4HWM A;  4TLJ A;  2E4J A;  1SY0 A;  5JD2 A;  4A1H A;  3STN A;  1LNM A;  3UEW A;  4MIR A;  3KDR A;  2JU7 A;  3NR3 A;  4UU3 A;  4E67 A;  3VE1 A;  1ZND A;  1YWA A;  4RUN A;  1FSU A;  1SLF B;  3S26 A;  1DZP A;  1F34 B;  3D4R A;  4NKB A;  5JR8 A;  2JN3 A;  2X32 A;  1K24 A;  1JQP A;  5LJH A;  4GK9 A;  2AT5 X;  3FEN A;  2FS6 A;  2FGS A;  1SWU A;  2WUT A;  1TW4 A;  1HBQ A;  3C77 X;  3PED A;  2RTP B;  1SWK A;  2X8S A;  4GZV A;  2GTL M;  3RWX A;  1HMR A;  1GX8 A;  5HTE A;  3LTW A;  3JS1 A;  4Y0P A;  3WZO A;  3I17 A;  5IRA A;  2FKJ A;  4O49 A;  4BGF A;  4QGX A;  1LPJ A;  4NYQ A;  1MX7 A;  4JNJ A;  1N0S A;  1EII A;  1SWD A;  4XMF A;  1CBR A;  2C1Q A;  3WJB A;  4CXK A;  1JZU A;  1UMW A;  1PBO A;  4NK7 A;  5B10 O;  3BS2 A;  1EIO A;  4Z2V A;  4GGR A;  5EPQ A;  4I3C A;  3ZW0 B;  3GAQ A;  4NP1 A;  4TNN A;  1U17 A;  5LKE A;  2OY8 A;  2OZQ A;  1SWF A;  1QFT A;  5KHP A;  1HMS A;  3ED4 A;  1VWG B;  3KZA A;  2DM5 A;  4CSB A;  4I6S A;  2OF9 A;  1QY0 A;  5D8J A;  4AW8 A;  1ZNL A;  3KFG A;  1STR B;  1NDJ A;  3G7X A;  3QKG A;  1SLG B;  5HA1 A;  1GGL A;  5L8N A;  4HPC A;  1X8P A;  2OFR X;  2OVS A;  2ANS A;  2KT4 B;  2RD7 C;  2RTL A;  1JJU A;  2LB6 A;  1OBQ A;  3PP6 A;  3KFH A;  4WFU A;  5CHK A;  3C5L A;  4XB0 A;  1IKJ A;  3ZI8 A;  5HCD C;  3HOE A;  4MVI A;  5DMS A;  4ZGU A;  4X9W A;  1LIC A;  3BRN A;  3S5V A;  4Y5D A;  3CR6 A;  4HPA A;  3VU1 A;  2IZL B;  2CBR A;  1SWS A;  2AT8 X;  4KH8 A;  1W4T A;  3ZUI A;  3DSZ A;  1HQP A;  3PQS A;  1X8O A;  4EDE A;  4U9C A;  4I9R A;  2EU7 X;  1NP4 A;  4M7M A;  4YGH A;  3OBL A;  3Q34 A;  3UAQ A;  1PEE A;  4QGV A;  2OL8 O;  4BBO A;  2OFA A;  2AMM X;  4GJV A;  3BX7 A;  1SXY A;  2R56 A;  2OYB O;  1E33 P;  1BSO A;  4D6A A;  2RTO B;  5KID A;  2RN4 A;  4ZH9 A;  5F7G A;  1ERX A;  1TOW A;  2FLJ A;  1Y55 X;  3RDS A;  5H9L A;  2KTD A;  3WJF A;  3ZZV A;  3RDO A;  2E50 A;  1VWC B;  2RTR B;  1SRE A;  1FEN A;  4DCB A;  1GX9 A;  4TKJ A;  2FRS A;  4QZT A;  2X46 A;  4IB6 A;  1VWB B;  1N9M A;  3BU9 A;  1N9Y A;  1GT3 A;  2LKK A;  3VG3 A;  1HDH A;  1KFF A;  4ALO A;  2YG2 A;  5HZ6 A;  5AJB A;  1ZNK A;  4WHH A;  3WXQ A;  4QNI A;  4TQ2 A;  1DZK A;  4L1N A;  3QQ2 A;  1AUK A;  5EED A;  5EZ2 A;  3EMM A;  4NW4 A;  4DQ4 A;  4GRJ A;  2R74 A;  3F6Z B;  3AKN A;  4CPH A;  4QRL A;  4YGZ A;  3OE3 A;  2OGQ A;  1E2S P;  3PH6 A;  2PI3 O;  5B27 A;  1EUO A;  3OJY C;  1X71 A;  4HAB A;  3P6E A;  5D48 A;  1AEL A;  3HIK A;  4QQ1 A;  1BSY A;  4GGT A;  5B5F A;  4ZHD A;  4OS8 A;  1Q4K A;  3TZS A;  1STP A;  4ZHF A;  2G78 A;  2IZF B;  4X9V A;  2KTS A;  4N9J A;  2A3F X;  2BLG A;  5D4A A;  4O4O A;  5HA0 A;  3T2W A;  2WWP A;  3RDQ A;  1KL4 A;  2Z4H A;  1VWJ B;  1N2K A;  1IFC A;  2LBA A;  2GTL N;  2G5L A;  5HZ9 A;  2G79 A;  2IZI A;  3S60 A;  1T8V A;  1LIE A;  1JJX A;  3TGB A;  2POA A;  1JBH A;  4CYS A;  1LEL A;  3FR5 A;  1VWD B;  4FDJ A;  4O4S A;  1EW3 A;  1EPB A;  1RLB E;  2RA6 A;  3P2Z A;  5HCE C;  2QO6 A;  3ZW1 A;  1ZNE A;  4AZN A;  4WHI A;  1ERB A;  2ZAI A;  5IO6 A;  1SWR A;  2QCB A;  4INN A;  3U9P C;  1SWT A;  2LBV A;  1BRP A;  2OL7 A;  1HMT A;  3O22 A;  3EW1 A;  1Y53 X;  3FA9 A;  2IFB A;  1SWC A;  1A57 A;  3FDC A;  3GE2 A;  1SLE B;  1T68 X;  1LFO A;  2FR3 A;  3NPO A;  1PM1 X;  5BVT A;  3ZW2 A;  4OEL A;  2M4L A;  2L67 A;  3NAD A;  3C76 X;  5AEO A;  4YCH A;  1QY2 A;  1VWH B;  3HPE A;  2VFB A;  1HBP A;  4NV7 A;  2X8T A;  3HIH A;  1S44 A;  4AYH A;  1G74 A;  4ZCB A;  4XMH A;  1Y0G A;  2Y32 A;  3KFF A;  4GJS A;  3VG5 A;  4LZV A;  1KOI A;  1GKA A;  1SRI A;  1FEL A;  4DFW A;  2AT3 X;  2XST A;  3IA8 A;  4E9D A;  2RCQ A;  1LF7 A;  1KT4 A;  2N19 A;  5F2B A;  1I78 A;  2RTC B;  1GX3 A;  1MUP A;  2FKG A;  3B2I A;  2AKQ A;  4O3Z A;  3I0A A;  1G5W A;  2BS6 A;  3WJD A;  3HMJ G;  4YKO A;  4Y59 A;  1HXL A;  4ZHG A;  1DZJ A;  1SWG A;  4OS3 A;  2BC3 A;  4EXZ A;  1OPB A;  2NP1 A;  1SRG A;  4PJ2 A;  4IB7 A;  1SWA A;  4N7D A;  4B55 A;  1EAL A;  1Y9T A;  4NV8 A;  4ON1 A;  1P49 A;  1IJ8 A;  4ARH A;  5LHZ A;  1AVD A;  1JYD A;  4YDB A;  1FJ1 E;  4CDE A;  2F01 A;  1G7N A;  2G7B A;  4Y0R A;  4LKL A;  5CYB A;  3SZJ A;  3P02 A;  3VE2 A;  4O56 A;  1HXZ A;  1Z24 A;  4O6W A;  1I9H A;  5IO7 A;  1VWL B;  2IZA A;  1VWO B;  1P6P A;  1SWN A;  3EBW A;  3O2Y A;  5L8O A;  1NQN A;  3WZN A;  3VG4 A;  2HLV A;  2BHV A;  3LV4 A;  5FAZ A;  5DG4 A;  5B2A O;  1E5P A;  1QFV A;  3RKG A;  1KL5 A;  3WVM A;  5F1E A;  3UEU A;  1Y52 X;  2JMB A;  3FA8 A;  2JU8 A;  3CWK A;  4GDZ A;  2IZB A;  1DF3 A;  2Q9S A;  3WYQ A;  1YIV A;  2IZK A;  2WEW A;  3FIQ A;  2IZH B;  4QYP A;  1ICM A;  3X00 A;  1RST B;  4IAB A;  4YBU A;  3CKG A;  1QAB E;  1DZM A;  4O9W A;  5CE4 A;  2RTK A;  1S7D A;  1VWR B;  1KZX A;  1A87 A;  1SWJ A;  1SA8 A;  3WYP A;  3FVH A;  2RTG B;  4JO6 A;  3BSZ E;  4LKM A;  4KT5 A;  3IFB A;  2CZU A;  5H9N A;  3P24 A;  2QOS C;  3D96 A;  5BVS A;  3SOT A;  1I05 A;  2GJ5 A;  3HWG A;  2L9C A;  1SY1 A;  1L6M A;  2WEX A;  4Y0S A;  3FEK A;  3MX7 A;  1KQX A;  4COT A;  1KQW A;  2MF6 A;  2HZR A;  1RXH A;  2Q4N A;  3PPT A;  1SMP I;  1KT6 A;  3CQR A;  3NQ3 A;  2OY5 O;  2OVD A;  3E3C A;  3D97 A;  1VYG A;  3STM X;  5F6B A;  4EFG A;  2KW1 A;  1BRQ A;  4YMY A;  2FTB A;  3WJC A;  1ADL A;  3FW4 A;  1UYN X;  2WR6 A;  3P37 A;  2XKL A;  5AJ9 A;  2I5Z O;  2I9X A;  4M6S A;  2UZ2 A;  4IAX A;  4I9S A;  1FDQ A;  2FHN X;  3JSQ A;  1UZ2 X;  1MDC A;  2A2U A;  4FQB B;  5HZ5 A;  3U03 A;  1DFV A;  3PDF A;  4I3D A;  3ZQ3 A;  5KIC A;  3F9D A;  5L8I A;  3EC5 A;  2GC9 A;  1EQD A;  4GKC A;  3STK A;  3KQ0 A;  3RDU A;  3KVN A;  3P6F A;  4JGL A;  2RTQ B; 
#chains in the Genus database with same CATH homology
 4BSQ A;  2ATO A;  2PBH A;  2DC6 A;  2B1M A;  3LM3 A;  5J94 A;  3MHH A;  2AUZ A;  3C9E A;  2AU1 A;  1N2K A;  2PAD A;  1E2T A;  3O1G A;  1PBH A;  1CJL A;  1BY8 A;  1U9X A;  1NL6 A;  3H89 A;  4YYR A;  4BS6 A;  3IV2 A;  2VKZ G;  2FRQ A;  2BSZ A;  2PNS A;  4CYS A;  4YYS A;  3IMA A;  3MOR A;  1W5R A;  4YYQ A;  1PIP A;  4FDJ A;  4P6E A;  5CVN B;  4YVA A;  1SNK A;  3BWK A;  3D9W A;  4N8W A;  2FTD A;  2HD5 A;  2VFC A;  3KFQ A;  1KHP A;  4YV8 A;  2F7D A;  3S3Q A;  2CIO A;  4CYR A;  1CV8 A;  3BPM A;  3DF0 A;  1AU4 A;  1CTE A;  4CXU A;  1CVZ A;  1TLO A;  1VJV A;  2NQG A;  1BQI A;  3GYW A;  3K24 A;  5JH3 A;  3MTN A;  3KWB X;  2G8J A;  2DCD A;  3LFY A;  1F2A A;  1MEM A;  3PBH A;  2O6X A;  2FT2 A;  1AIM A;  3KDR A;  1W6F A;  4CDF B;  4OEM A;  4OEL A;  1DF0 A;  1FSU A;  3I3T A;  3P5U A;  3P5W A;  1AYV A;  3OVX A;  1MDW A;  5CVO B;  2NQI A;  1DEU A;  1CB5 A;  2VHS A;  3BOW A;  2VFB A;  4NKB A;  4NV7 A;  2YJ9 A;  1QOL A;  1JQP A;  2NQA A;  4N79 A;  2JQG R;  2CB5 A;  2OUL A;  3CBJ A;  3IEJ A;  2HHN A;  4FJC A;  4PI3 A;  1PXV A;  1CS8 A;  3FS3 A;  1AU3 A;  4I05 A;  4C5P A;  2AVW A;  1GLO A;  3IOQ A;  3RVW A;  2QZU A;  1A6R A;  3K9M A;  1GEC E;  3IUT A;  3H8B A;  1YT7 A;  2P7U A;  1BP4 A;  2ARY A;  3K8U A;  1AYW A;  1KXR A;  4PAD A;  3F75 A;  4RY2 A;  2DC9 A;  2E03 A;  2E02 A;  3LTW A;  1ATK A;  1PPO A;  2R9C A;  2XU1 A;  3HHI A;  2BDL A;  2P0R A;  4FIP A;  2IPP B;  2R9O A;  1GX3 A;  2G8E A;  1EWM A;  2XU3 A;  1YK8 A;  3S3R A;  4BGF A;  3V6C A;  3HMJ G;  1FH0 A;  3P5V A;  2YJ2 A;  3H7D A;  3N3K A;  1CPJ A;  2PRE A;  4N4Z A;  4PP1 A;  1KHQ A;  3M99 A;  4I04 A;  4MSX A;  4CXK A;  4WA6 A;  4W5B A;  4XUI A;  4I07 A;  4NK7 A;  3KX1 A;  2AIM A;  4GUZ A;  4B55 A;  4NV8 A;  1EWO A;  2AS8 A;  2DZY A;  1P49 A;  3RVV A;  3B79 A;  2ACT A;  2HXZ A;  4CDD B;  3BC3 A;  2VHF A;  1YAL A;  1ZCM A;  4CDC B;  4MZO A;  5CHV A;  4FDI A;  1F2C A;  1U9Q X;  1TU6 A;  1K3B B;  3ED4 A;  5PAD A;  3WXE A;  2DZZ A;  2E01 A;  1POP A;  3V6E A;  3ERV A;  1ZIV A;  1SP4 B;  3QJ3 A;  4X6H A;  3PW3 A;  1KFU L;  4DMX A;  4QRG A;  1THE A;  1CQD A;  2R9F A;  1E3C P;  3KSE A;  3IHP A;  2GHU A;  1XKG A;  2NQD B;  4DMY A;  1N2L A;  2FRA A;  3GYV A;  4BQV A;  3HD3 A;  2DCB A;  3BPF A;  2DC7 A;  1PAD A;  5EGW A;  1O0E A;  1MEG A;  1NB3 A;  3QT4 A;  4AXL A;  4W5C A;  2C0Y A;  3LXS A;  4QH6 A;  2FYE A;  3E1Z B;  2YJB A;  3QSD A;  1PPP A;  1U9V A;  2DJF B;  3F5V A;  1PPN A;  2OZ2 A;  3PNR A;  2H7J A;  3MHS A;  1AYU A;  1NB5 A;  9PAP A;  3O0U A;  1QDQ A;  3NHE A;  3OF8 A;  5A24 A;  3LXQ A;  2HH5 A;  3CBK A;  4X6J A;  3CH2 X;  2GFO A;  4G7N A;  2Y6E A;  4XR7 A;  3BCN A;  1BGO A;  2AUX A;  2G7Y A;  5K16 A;  4N7V A;  3OIS A;  1QXP A;  1W4T A;  2G6D A;  4CDE B;  1IWD A;  1M6D A;  4K7C A;  2FO5 A;  2P86 A;  2BDZ A;  2F1G A;  4CXS A;  2OP3 A;  4N7Z A;  1ME3 A;  4MZS A;  4X6I A;  3HFD A;  1Q6K A;  1F2B A;  1GCB A;  3P5X A;  3GCB A;  1AU0 A;  3I06 A;  5FPW A;  4CZW A;  4YYU A;  1YK7 A;  4G54 A;  1U5I A;  1MHW A;  3CH3 X;  1E33 P;  2AYN A;  3WXG A;  4AXM A;  1Y4H A;  4PP2 E;  4BS5 A;  3OVZ A;  3HWN A;  1ITO A;  2R9N A;  1NLJ A;  1GMY A;  2Y5B A;  3OF9 A;  4FK5 A;  6PAD A;  1MS6 A;  5CHT A;  1Y08 A;  4YYV A;  3H6S A;  2WBF X;  8PCH A;  2YJC A;  2IBI A;  1YVB A;  2E50 A;  2JQF R;  3KW9 A;  4Q8G A;  5DAY A;  3KWZ A;  4P6G A;  5CVM A;  1X9Y A;  4ZUX U;  1U9W A;  2B1N A;  1HUC B;  1PCI A;  2DJG B;  1CSB B;  1EWL A;  3N4C A;  1HDH A;  1QMY A;  4HWY A;  1VSN A;  2DCA A;  4QRX A;  5AJ9 A;  1EWP A;  3KKU A;  3TNX A;  1NQC A;  3RVX A;  7PCK A;  3ZUA A;  4W4U A;  4Q8H A;  1AUK A;  1ICF A;  1MIR A;  2YJ8 A;  3D6S A;  2DC8 A;  4QRV A;  1NPZ A;  2XU4 A;  1AU2 A;  2AYO A;  3H8C A;  3WXF A;  3AI8 A;  3USV A;  1PE6 A;  2E00 A;  1E2S P;  2FUD A;  5EF4 A;  1ME4 A;  1E1Z P;  4YYW A;  3PDF A;  2UV8 G;  3U8E A;  1STF E;  4QBB A;  5F02 A;  3N3G A;  1S4V A;  2XU5 A;  2R6N A;  1AEC A;  1F29 A;  2DCC A;  5JA7 A;  1EF7 A;  4KLB A;  2R9M A;  4BPV A;  1PPD A;  4N9J A;  3HHA A;  1KFX L;  2FQ9 A;  1TL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...