1E2TA

Arylamine n-acetyltransferase (nat) from salmonella typhimurium
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
HMTSFLHAYFTRLHCQPLGVPTVEALRTLHLAHNCAIPFENLDVLLPREIQLDETALEEKLLYARRGGYCFELNGLFERALRDIGFNVRSLLGRVILSHPASLPPRTHRLLLVDVEDEQWIADVGFGGQTLTAPLRLQAEIAQQTPHGEYRLMQEGSTWILQFRHHEHWQSMYCFDLGVQQQSDHVMGNFWSAHWPQSHFRHHLLMCRHLPDGGKLTLTNFHFTRYHQGHAVEQVNVPDVPSLYQLLQQQFGLGVNDVKHGFTEAELAAVMAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arylamine N-Acetyltransferase Reveals a Catalytic Triad
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords N-HYDROXYARYLAMINE O-ACETYLTRANSFERASE
total genus 78
structure length 274
sequence length 274
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.118: N-hydroxyarylamine O-acetyltransferase.
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 1e2tA03
3.30.1120.150 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 1e2tA02
4B55A 4NV7A 4C5PA 4NV8A 2VFCA 1E2TA 3D9WA 1W4TA 1W5RA 4GUZA 4BGFA 1GX3A 1W6FA 3LTWA 2VFBA 2BSZA
chains in the Genus database with same CATH superfamily
4YH0A 4E9DA 1IJ8A 2QOMA 3RKGA 5B3MO 2AT8X 2OFMX 4LKPA 5DMSA 4CXUA 1ICNA 2QM9A 2JU8A 3TGBA 1S44A 1ALBA 2Q9SA 2WEXA 4IB9A 1VWEB 2AH7X 2C1QA 2Y32A 4I60A 2FKJA 3P36A 1UZ2X 2OVDA 5LKFA 1IFBA 1QFVA 2WSJA 3STKA 3WZPA 3FELA 3QKGA 4OEMA 2EU7X 1E3CP 3PQSA 3T6LA 1VWRB 4NW4A 1LIEA 5D45A 1SWNA 3ZW0A 2WUTA 4R0BA 4ZFXA 2VFCA 1X89A 2QZUA 1DF3A 3FENA 2RTGB 4AZPA 1VWGB 4HPBA 3AKNA 3JS1A 3WXQA 4A60A 3LXQA 4FBOA 1MVGA 3CQNA 4U46A 2RTEB 3RE6A 4WHKA 1GX8A 4EDEA 2CM9A 3HTYA 5K06A 4NNTA 4B55A 2Y3EA 1SXYA 4RCPA 5F2BA 1E2SP 3NQ9A 1YWBA 3VG6A 3CMPA 3ZW0B 5LJBA 4KCAA 4XMDA 3KFFA 1QY1A 1TOWA 2W2BA 1VWIB 5L8NA 5AJCA 2R74A 4ORUA 4FDIA 2JU3A 2CAMA 3Q6LA 4FBVA 1OBQA 1W6FA 3S5XA 3VHHA 1GT3A 1HXZA 4LZUA 3UEWA 5J19A 1T68X 1ZNKA 1U17A 3CKGA 2BS5A 3FR5A 4GKCA 3SLOA 4I3CA 2ZSCA 1L6MA 1OEEA 2KTDA 4NV7A 4BX7B 5HZQA 2LKKA 1BSQA 4HFOA 3FLLA 4Z6JA 3KDRA 1SWLA 4YCHA 1T0VA 3RY2A 2RQ0A 4ALBA 3CQRA 1PBOA 4IAXA 4ORXA 1DC9A 3STNA 4DNEA 5B11O 1SWOA 2OJXA 3NBXX 4KC8A 2IZJA 1DZKA 1VWBB 3OBLA 1EPBA 1ERXA 1ZNEA 4O3YA 3T2WA 4ALOA 4BX7A 2X34A 5B5GA 4AW8A 4NNSA 2FT9A 4OMWA 3HWDA 3KFHA 4L1NA 4YDAA 3WZOA 1I4UA 4KIIA 3FMZA 4TKJA 2RTPB 2ZAIA 2X8FA 1HMSA 4CPHB 5F6BA 1I78A 1E5PA 1GT1A 5H8TA 5DMVC 3FA7A 3GAQA 1HN2A 2WEWA 2MO5A 2YG2A 2LBVA 1RXHA 4GH7A 4AZQA 4O9WA 2OZQA 2Q2PA 4IMOA 1ACDA 1KQWA 1YP7A 3P34A 3T6FA 4ID2A 4I9SA 2F73A 1IFCA 2L5PA 2X8SA 3UEVA 5LJDA 2AT6X 2G8CO 3FA8A 4O56A 2A13A 4IBAA 3ZW1B 4J7BB 2JOZA 1EI5A 4TLJA 3BY0A 2HKDA 1RXKA 1HY2A 1MOYA 2G78A 1AVEA 4QZUA 3VGWA 4U8UO 2CM4A 5HCCC 3DSZA 4MVIA 2Z4IA 4MEEA 4XMGA 2GTLN 3G7XA 3WVMA 4JGLA 2A3FX 2RTCB 5KIDA 1STSB 1VWCB 2GC9A 4Z2VA 1E2TA 2XSTA 2WQAE 4GETA 1AVDA 4KT5A 1DZPA 1NQNA 4TJZA 5D47A 4H71A 2CBSA 3NP1A 2DJFA 4DCBA 3FVHA 2OY8A 4A8ZA 3CR6A 1N9YA 1SRGA 2CBRA 4CYSA 2C1SA 1LDQA 1U18A 1BEBA 1GGLA 4GNYA 4O4XA 1VWNB 3HOEA 3OD9A 3PEDA 4U9CA 3BRNA 1Y55X 5D4AA 1BRPA 1ZRYA 5CHKA 2DJGA 1KT6A 3B2KA 1LUQA 1SWSA 2AF5A 4G7NA 4E67A 1VYFA 3FR2A 4O3ZA 1ML7A 4I3DA 4YKMA 3O19A 4BX6A 1I06A 1A87A 2IZFB 4Y0QA 2E50A 3RSWA 2W2AA 1SWTA 1SWRA 3UEUA 1SWAA 1SWJA 1IIUA 3WJFA 4GK9A 4O9SA 4DQ4A 3P6DA 1KZXA 3RWXA 5HA1A 3HMJG 4N9JA 4XB0A 1VWPB 2NNEA 5LJCA 3DTQA 1CJ5A 2G7BA 2HZRA 1LKEA 2RTDB 3EBWA 2IZEB 1LF7A 4UU2A 4GGZA 1GT4A 3WOVA 1N0SA 3S26A 1JQPA 1CRBA 1ERBA 3EW1A 3PK2A 1MDCA 3NQKA 5HTDA 1N7YA 4LKMA 3P6GA 2MWHA 4IB6A 3RZYA 4FGIB 1OPAA 2X8TA 1Y52X 4INNA 3BU9A 5B27A 4ZR2A 5BYPA 1VWJB 3BX8A 3VU1A 4N7ZA 2Q4NA 3IA8A 3ZW1A 1WUBA 4ZH9A 4ZHDA 1FEMA 5IRAA 3BX7A 1SXXA 1T8VA 2F01A 2FKGA 2GTFX 1VWQB 5LJKA 3MBTA 1OEJA 1FJ1E 3O22A 4U8UM 1JJXA 2F09A 3FA6A 1O8VA 5B2AO 4Z2PA 2N19A 4WHHA 4OKAA 2NNQA 1SLDB 5HWZA 4OELA 1LIFA 1MX7A 4YBPA 2OFAA 3GYVA 2OVEA 1SY1A 2VKZG 2IZCB 2AVIA 4IB8A 4YCEA 4MIRA 2FWVA 1LCWA 2IZAA 4N7VA 4YVBA 3WZNA 3VG7A 4ORYA 1NP4A 1LDOA 4NLJA 3VHMA 2VDFA 2QO5A 2KTSA 1DZJA 4HY2A 2JMBA 3VG3A 2CZUA 1I04A 4EFGA 4KC7A 4GRJA 1ZNGA 1LIDA 3D95A 4CXKA 5HCDC 2FRSA 2JW1A 4BBOA 4YFRA 3S5VA 2AKQA 4BJ8A 5KHPA 4ZHCA 1AQBA 1RBPA 2RTAA 1XKIA 2IZDB 3RY1A 4CK4A 4ES7A 2C4IA 2FLJA 3WBGA 1BM5A 2RCTA 1FTPA 1LPJA 1WBIA 3C76X 4HPCA 4LKTA 4Z28A 4BQUA 4Y0RA 1A2DA 2RTOB 1AELA 3FYFA 1JJUA 1STRB 1SWBA 3NPOA 4WHIA 4IAWA 3U0DA 2LBAA 1GT5A 4WFUA 3P2WA 4YYPA 4EKVA 1DFVA 5HTEA 2HLVA 4IMNA 1SRFA 3BLGA 1NGLA 5DPQA 2GTLM 1LIBA 2OFBA 3KQ0A 4CPIA 3QQ2A 2WR6A 4QYPA 1LCZA 1YIVA 3F9DA 5H9AA 5H9KA 5AJBA 1BLRA 2FS6A 3D4RA 3D9WA 4CDDA 1SWFA 1NBXA 4WHLA 4N7CA 1KFFA 2HMBA 2BS6A 2RA6A 1W4TA 3ELXA 5JD2A 4EXZA 3P37A 1QWDA 3PPTA 1JYJA 1IKJA 1HMTA 1YP6A 1KT4A 2X45A 4XMFA 1R0UA 1SWCA 1VPRA 4AZOA 4QGWA 1YWAA 2G79A 2OL6O 3S60A 1SY2A 2ANSA 2IZLB 1AVGI 1RAVA 3ZW2A 1EUOA 4Z2OA 4OS0A 1HQPA 5CYBA 2NNDA 1E1ZP 4GUZA 4FDJA 2RTJA 1GX3A 3TGCA 1KL3A 2WWPA 4O3XB 4XMHA 3ZI8A 3Q34A 5IO5A 4YDBA 1N43A 3CBCA 4GGTA 5EEEA 3STMX 3HFDA 4ODDA 5LJGA 4AZRA 4GZVA 5FFHA 1TXLA 2KT4B 5HZ5A 4GNWA 4GJSA 2BHVA 2X46A 4RUUA 3SZJA 3APVA 1HBPA 5LJHA 3Q1IA 1FE3A 4K19A 1O1UA 3F8AA 3HWGA 1B8EA 1X8UA 3H3IA 4ZHGA 1FSUA 2RTIB 3HOLA 4WFVA 4PJ2A 1RSUB 1YWDA 3B2LA 1E06A 2OFRX 1VWAB 5JR8A 5HA0A 2OGQA 1HQQA 2G5LA 3VE1A 3D96A 4NV8A 4XMEA 3C78X 2UV8G 4NP1A 2RTHB 5HZ6A 1E02A 3KZAA 3SZIA 4BX5B 3CKFA 4O3WA 4ZJ0A 1CBSA 4Y59A 3RQ7A 3FDCA 3AKMA 3PH6A 4IABA 4QQ1A 3UEXA 3B2HA 2JGSA 3LTWA 3PQUA 1MEPA 3FS3A 2CZTA 3ELZA 3P6EA 4C5PA 4GDZA 2A8GA 2X56A 2P8GA 4U8UN 1JJJA 2BC3A 4YFPA 1FELA 4FQBB 1W5RA 2MJIA 1Q4KA 5LJEA 4XMCA 5EDBA 2MF6A 3SOTA 5B29A 1Q4OA 2I5ZO 1CBRA 4NK7A 3T2XA 4YMYA 1H91A 2BLGA 3NX2A 1SREA 1PM1X 1B56A 3BS2A 1EXSA 4E9CA 1DF8A 5DAYA 1SWGA 1HDHA 1OPBA 2MHDA 1DV9A 1SRHA 4HABA 1NQMA 4OS3A 3HIHA 4BVMA 2OF8A 1NC9A 3I0AA 1D2UA 5F58A 3RDSA 1CBQA 5HZ9A 3P35A 1X8PA 1KT3A 3TZSA 4NKBA 3BSZE 1N2KA 1UMWA 3E3CA 4O4SA 5K68A 2IZGB 2GTLO 2HNXA 4M6SA 1SRIA 3PH5A 1LCVA 2L9CA 3JSQA 4HPDA 1G74A 4GJVA 4YFQA 4M7MA 3RDMA 3VE2A 1D3SA 3PDFA 4EQAC 1KZWA 3FEPA 4AZMA 1HXLA 4Z27A 2RN4A 5EDCA 1VWOB 3HWFA 3RDQA 4O6WA 3B2JA 4CDEA 1G85A 3MG5A 4BCSA 2FR3A 5IO7A 3EBKA 1GXAA 5IXGA 1B4MA 1E00A 5AEOA 1EALA 1KL4A 2I5VO 2JU7A 3LHNA 3U9PC 1KL5A 4WBKA 2IZIA 2LB6A 5DG4A 4D6AA 2A5BA 2OVSA 2L67A 1K24A 2UYWA 2R56A 5CSEA 1EIIA 3I17A 3IFBA 2K23A 1GKAB 1MUPA 2KD2A 2RTQB 4BX5A 1SXWA 5C0NA 5HZ8A 4TNNA 4CDFA 1SWQA 5L8IA 5BVQA 1S7DA 4NYRA 4RUNA 3KFIA 4O49A 1N4JA 4HWMA 1OEKA 2DM5A 2AMMX 1P6PA 2OL7A 4N7DA 5D48A 2IA9A 1SXUA 3SLTA 1SLGB 1I05A 1GM6A 3ZWEA 2L68A 5LKEA 1SY0A 1IKEA 1SA8A 2IFBA 2IZBA 4L3RA 1STPA 1XCAA 1B0OA 3HK1A 1F34B 4OMXA 2IZKA 1AUKA 4FBRA 5DNJA 2XKLA 5IO6A 1JIWI 3F6ZB 2K62A 4TKHA 1A3YA 4CPHA 4D6BA 3AUMO 1TVQA 1OBPA 1VWDB 2POAA 2Z4HA 3NX1A 3SZHA 4TQ2A 1RXJA 4I95A 5LHZA 4JNJA 1Y9LA 4GU8A 5FQ8E 1ADLA 1HMRA 2RTFB 3TF6A 2RD7C 1GKAA 4DFWA 4QYNA 3RDXA 3EMMA 2ACPX 1BJ7A 1LFOA 3VG2A 2FS7A 2QO4A 2X4MA 1KT7A 3WJDA 1E33P 4QGVA 4NLIA 1JMXA 1UYOX 3FIDA 3ED4A 5HCEC 5HBSA 2PY1A 4JHQA 4MVEA 4ON1A 1BRQA 1SWUA 1SY3A 1X8NA 5BVSA 4BOEA 5K67A 4PSQA 3MVFA 2KW1A 2Y3FA 1GX9A 1OSPO 1PEEA 1EIOA 3P2ZA 5AQ6A 3C5LA 1CBIA 2X32A 1G5WA 1JZUA 1ZNLA 1NDJA 1SMPI 1KQXA 4ORRA 5KICA 2JN3A 4MISA 3OJYC 2AT0X 1JYDA 4GDAA 4IRWA 4A1HA 3O2YA 3VG4A 2QOSC 3RBYA 4X9WA 4YGZA 3L4RA 1MK5A 5F6ZA 2FGSA 4ZHHA 4QNIA 1S2PA 1PBYA 4DQ3A 2WPUA 3RDOA 4CXSA 2OY7A 1MX8A 4I6SA 4Y5DA 1X8OA 1JV4A 1N9MA 2A0AA 4ARHA 4CPFA 3VHIA 1EW3A 1VWMB 2ACOA 3FW5A 4QRLA 3CWKA 5FAZA 4BX6B 1KXOA 5H9LA 2Q39A 1QY0A 5FENA 1QQSA 5IRWA 1KGLA 3K3LA 2E4JA 3P02A 5AJ9A 4GGRA 1DZMA 2A2UA 2LA7A 3APWA 2RTMA 1N2LA 3PP6A 1SLFB 3FEKA 4BGFA 4X9RA 1K3BA 5D8JA 4IB7A 1ZNHA 5L8OA 5B5FA 3APXA 3RDUA 2MM3A 4TKBA 1SWPA 3WYPA 1SWDA 2QO6A 3KVNA 3VPJE 1YUPA 3EM0A 1X8QA 2RTNB 1SWKA 3NQ3A 3OE3A 4YGGA 4AYHA 2FHLA 3N91A 1O1VA 1FENA 4MVLA 3MM0A 5B10O 4HCOA 4COTA 2GJ5A 1MM9A 4GE1A 4ZCBA 3WYQA 3RE5A 4CPEA 3BU1A 5BVTA 3NADA 1YWCA 4LKLA 2LFOA 1TOUA 4H5XA 1A57A 4ML7B 1KOIA 2RCQA 3WZQA 5HAEA 1BWYA 2HYSA 1VYOA 1Y9TA 2NP1A 2OYBO 1SWHA 1QABE 1P49A 4A1YA 3P6HA 4KH8A 1F32A 4QAEA 2X55A 1QY2A 2RTLA 1Y0GA 1A18A 4QZTA 4EEJA 4ZGUA 5CE4A 3P6FA 4ZH6A 1EQDA 4NYQA 2FR2A 4Y0SA 3VG5A 3WJCA 4ORSA 4LQZA 3P6CA 3HWEA 4GD9A 4U3QA 3B2IA 1KT5A 4YBUA 3HPEA 3CBSA 3NR3A 3LM3A 2Q2MA 3ZQ3A 1BBPA 1SWEA 4ZHFA 5H9NA 3WJBA 5FQ6E 1QFTA 3WJEA 1I9HA 4CDCA 4JO6A 2OL8O 4MVKA 1TW4A 4HPAA 2QMIA 1NP1A 3APUA 3MX7A 5EPQA 3UAQA 4AZNA 1PMPA 1UREA 5EZ2A 3FIQA 2ZAGA 2UZ2A 2ASNX 2RTBB 1VWLB 3GE2A 1ZNDA 4YKOA 3ZUIA 1LNMA 2R73A 4RS6A 1PTSA 2OVAA 1G7NA 3SLJA 2W2FA 2WQ9A 4I3BA 5F1EA 4CV7A 4X9VA 1BSYA 1JBHA 1ICMA 1EPAA 2AT5X 2BT9A 4Y0PA 1VYGA 4ZGFA 3WJGA 3KFGA 5F7GA 2BSZA 3D97A 2A2GA 2RTKA 4ORWA 2FTBA 5FQ7E 3ZUOA 2ALLX 3TGAA 4CSBA 1LICA 1AB0A 1HBQA 2O62A 3ZZVA 3FR4A 1QG5A 1LELA 1VWKB 1OBUA 3P24A 3LV4A 4QGXA 2YMSA 1RLBE 2N93A 2AT3X 2PI3O 1JMZA 3AEHA 4O4UA 3GYWA 1SLEB 2I9XA 2GH7A 3EC5A 4CYRA 3HIKA 2OF9A 4I9RA 2RTRB 1BSOA 1IW2A 3BDRA 3JQOA 4YGHA 5IRUA 3X00A 3EW2A 4O4OA 1Y53X 5EEDA 2A5CA 1UYNX 1SRJA 3SAOA 1RSTB 2QCBA 3V8UA 5L3YA 1VWFB 2VFBA 3FA9A 3FW4A 2AL0X 2M4LA 2OY1O 2I9ZA 3T1DA 4LZVA 3C77X 1U0XA 4UU3A 3U03A 2HZQA 2IZHB 4OS8A 3PECA 1FDQA 3BZIA 2FHNX 1VWHB 2OY5O 1Z24A 1X71A 3EYCA
chains in the Genus database with same CATH topology
1PPPA 3BPMA 4CXUA 4BSQA 4G54A 3I3TA 2PADA 3IUTA 3V6EA 4OEMA 3P5WA 1E3CP 2P7UA 2ACTA 2CB5A 1KFUL 2FRQA 1PPOA 2VFCA 2QZUA 3V6CA 1Y4HA 3IOQA 2R9NA 2VHSA 2YJ9A 1M6DA 1GECE 1YK8A 4CZWA 3OVXA 3LXQA 2DC9A 3E1ZB 3OF8A 1BGOA 3M99A 3ERVA 4B55A 3MHHA 4CDDB 1E2SP 1ICFA 4YYVA 2XU1A 1BQIA 2FYEA 3QT4A 4FDIA 1W6FA 1YALA 1MS6A 3WXGA 1KFXL 3KKUA 1FH0A 4NV7A 3PBHA 3KDRA 4DMXA 2NQIA 1THEA 1GLOA 2DC8A 2IPPB 2JQGR 2E01A 1PIPA 2NQDB 3HHAA 3S3QA 5PADA 2G7YA 3KFQA 2E00A 3LXSA 3HD3A 4PP1A 1VJVA 2B1MA 5J94A 1NPZA 1AU0A 3P5VA 3N3GA 2F1GA 3QJ3A 1EWMA 1YVBA 1XKGA 2OZ2A 4WA6A 1U9WA 3N3KA 2IBIA 2R9MA 4N4ZA 2P0RA 1Y08A 1MDWA 1E2TA 1BY8A 3F5VA 1Q6KA 4CYSA 5F02A 1SNKA 1O0EA 1TU6A 3C9EA 1F2CA 5A24A 4QRXA 3QSDA 2WBFX 4G7NA 1AIMA 3OVZA 2E50A 1CPJA 2AIMA 5EF4A 4AXMA 2DJGB 3WXFA 4CDCB 4QBBA 4RY2A 5CVNB 4K7CA 4W5CA 1A6RA 2AUXA 3HMJG 3KW9A 4N9JA 3IHPA 1PPDA 2YJCA 1AYWA 2FQ9A 3K9MA 1JQPA 4HWYA 2GHUA 1PE6A 4YYWA 3F75A 2AYOA 3BPFA 4N7ZA 3H6SA 3K8UA 4FIPA 1AU3A 4X6IA 4I07A 4YYUA 3TNXA 3BC3A 2G8EA 1CB5A 3U8EA 3MHSA 4OELA 2E03A 1KHQA 9PAPA 3GYVA 2YJ8A 2VKZG 1CSBB 1QXPA 5FPWA 4N7VA 1IWDA 3BOWA 1HUCB 3OISA 4W5BA 2DZZA 1F2AA 2YJ2A 4CXKA 2DJFB 3CBJA 3MTNA 2ATOA 2Y5BA 4YVAA 1PCIA 2E02A 1ATKA 1STFE 3D9WA 1NLJA 1PBHA 1W4TA 5CVMA 5CHVA 3MORA 3PNRA 4AXLA 3ZUAA 1U9XA 4X6HA 2DC7A 3BWKA 3DF0A 1CJLA 1CS8A 1E1ZP 4GUZA 1ZIVA 4FDJA 1GX3A 5K16A 7PCKA 1S4VA 3HFDA 2F7DA 1F2BA 1QDQA 2B1NA 1FSUA 4N79A 4YYQA 5CVOB 3AI8A 2AYNA 1U5IA 3CH3X 2PBHA 4BPVA 2CIOA 4NV8A 2R9FA 2UV8G 1KHPA 3GCBA 2PREA 1U9VA 4MSXA 1KXRA 3LTWA 3FS3A 1QMYA 5JA7A 4C5PA 2OULA 4YYRA 4X6JA 1W5RA 2PNSA 1DEUA 4NK7A 1ZCMA 4FK5A 4I04A 4ZUXU 5DAYA 2R6NA 1HDHA 1MHWA 4QRVA 2DC6A 2XU4A 1CVZA 2FTDA 4Q8HA 4NKBA 2DCBA 1MEMA 1N2KA 1NB3A 1NQCA 2AS8A 1AYVA 4XUIA 2OP3A 3IMAA 3PDFA 1AYUA 2HXZA 1AECA 4XR7A 2DCCA 6PADA 1ME4A 2NQAA 4I05A 3IEJA 4CDEB 4PI3A 3K24A 4YV8A 5EGWA 1GCBA 4P6EA 3P5XA 3RVWA 2C0YA 2DCDA 3WXEA 3I06A 4MZOA 3IV2A 1AU4A 1PADA 1GMYA 2H7JA 1AUKA 1DF0A 2R9OA 1BP4A 3BCNA 4PADA 4KLBA 2ARYA 3HHIA 1CTEA 2JQFR 1EWOA 4Q8GA 1EWLA 1MIRA 2AUZA 2AVWA 2O6XA 1E33P 2VHFA 1X9YA 8PCHA 4BS5A 2NQGA 3ED4A 1POPA 1AU2A 2P86A 2BDZA 1CQDA 4N8WA 2FO5A 1TL9A 2G6DA 1ME3A 3H7DA 3USVA 4BQVA 1EWPA 3HWNA 1U9QX 3D6SA 3P5UA 4CXSA 2G8JA 3CH2X 3OF9A 2Y6EA 2FT2A 3H89A 1EF7A 2YJBA 2AU1A 4P6GA 4BS6A 1SP4B 2R9CA 1K3BB 1ITOA 5AJ9A 1N2LA 2XU3A 3RVXA 4BGFA 2DCAA 3H8BA 3N4CA 4W4UA 3KWBX 2XU5A 1QOLA 4QH6A 2HH5A 3KWZA 1CV8A 3H8CA 1P49A 2HD5A 5JH3A 3O0UA 5CHTA 2DZYA 3B79A 4PP2E 1F29A 4MZSA 3LM3A 4QRGA 3PW3A 3RVVA 3LFYA 4FJCA 1VSNA 2FRAA 3O1GA 1YT7A 1TLOA 2GFOA 1MEGA 2BSZA 3KX1A 4DMYA 1YK7A 3CBKA 1PXVA 2BDLA 1PPNA 3KSEA 3GYWA 4CDFB 4CYRA 1NL6A 1NB5A 2VFBA 2HHNA 4YYSA 2FUDA 3NHEA 3S3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B55 A;  4NV7 A;  4C5P A;  4NV8 A;  2VFC A;  1E2T A;  3D9W A;  1W4T A;  1W5R A;  4GUZ A;  4BGF A;  1GX3 A;  1W6F A;  3LTW A;  2VFB A;  2BSZ A; 
#chains in the Genus database with same CATH topology
 4YH0 A;  4E9D A;  1IJ8 A;  2QOM A;  3RKG A;  5B3M O;  2AT8 X;  2OFM X;  4LKP A;  5DMS A;  4CXU A;  1ICN A;  2QM9 A;  2JU8 A;  3TGB A;  1S44 A;  1ALB A;  2Q9S A;  2WEX A;  4IB9 A;  1VWE B;  2AH7 X;  2C1Q A;  2Y32 A;  4I60 A;  2FKJ A;  3P36 A;  1UZ2 X;  2OVD A;  5LKF A;  1IFB A;  1QFV A;  2WSJ A;  3STK A;  3WZP A;  3FEL A;  3QKG A;  4OEM A;  2EU7 X;  1E3C P;  3PQS A;  3T6L A;  1VWR B;  4NW4 A;  1LIE A;  5D45 A;  1SWN A;  3ZW0 A;  2WUT A;  4R0B A;  4ZFX A;  2VFC A;  1X89 A;  2QZU A;  1DF3 A;  3FEN A;  2RTG B;  4AZP A;  1VWG B;  4HPB A;  3AKN A;  3JS1 A;  3WXQ A;  4A60 A;  3LXQ A;  4FBO A;  1MVG A;  3CQN A;  4U46 A;  2RTE B;  3RE6 A;  4WHK A;  1GX8 A;  4EDE A;  2CM9 A;  3HTY A;  5K06 A;  4NNT A;  4B55 A;  2Y3E A;  1SXY A;  4RCP A;  5F2B A;  1E2S P;  3NQ9 A;  1YWB A;  3VG6 A;  3CMP A;  3ZW0 B;  5LJB A;  4KCA A;  4XMD A;  3KFF A;  1QY1 A;  1TOW A;  2W2B A;  1VWI B;  5L8N A;  5AJC A;  2R74 A;  4ORU A;  4FDI A;  2JU3 A;  2CAM A;  3Q6L A;  4FBV A;  1OBQ A;  1W6F A;  3S5X A;  3VHH A;  1GT3 A;  1HXZ A;  4LZU A;  3UEW A;  5J19 A;  1T68 X;  1ZNK A;  1U17 A;  3CKG A;  2BS5 A;  3FR5 A;  4GKC A;  3SLO A;  4I3C A;  2ZSC A;  1L6M A;  1OEE A;  2KTD A;  4NV7 A;  4BX7 B;  5HZQ A;  2LKK A;  1BSQ A;  4HFO A;  3FLL A;  4Z6J A;  3KDR A;  1SWL A;  4YCH A;  1T0V A;  3RY2 A;  2RQ0 A;  4ALB A;  3CQR A;  1PBO A;  4IAX A;  4ORX A;  1DC9 A;  3STN A;  4DNE A;  5B11 O;  1SWO A;  2OJX A;  3NBX X;  4KC8 A;  2IZJ A;  1DZK A;  1VWB B;  3OBL A;  1EPB A;  1ERX A;  1ZNE A;  4O3Y A;  3T2W A;  4ALO A;  4BX7 A;  2X34 A;  5B5G A;  4AW8 A;  4NNS A;  2FT9 A;  4OMW A;  3HWD A;  3KFH A;  4L1N A;  4YDA A;  3WZO A;  1I4U A;  4KII A;  3FMZ A;  4TKJ A;  2RTP B;  2ZAI A;  2X8F A;  1HMS A;  4CPH B;  5F6B A;  1I78 A;  1E5P A;  1GT1 A;  5H8T A;  5DMV C;  3FA7 A;  3GAQ A;  1HN2 A;  2WEW A;  2MO5 A;  2YG2 A;  2LBV A;  1RXH A;  4GH7 A;  4AZQ A;  4O9W A;  2OZQ A;  2Q2P A;  4IMO A;  1ACD A;  1KQW A;  1YP7 A;  3P34 A;  3T6F A;  4ID2 A;  4I9S A;  2F73 A;  1IFC A;  2L5P A;  2X8S A;  3UEV A;  5LJD A;  2AT6 X;  2G8C O;  3FA8 A;  4O56 A;  2A13 A;  4IBA A;  3ZW1 B;  4J7B B;  2JOZ A;  1EI5 A;  4TLJ A;  3BY0 A;  2HKD A;  1RXK A;  1HY2 A;  1MOY A;  2G78 A;  1AVE A;  4QZU A;  3VGW A;  4U8U O;  2CM4 A;  5HCC C;  3DSZ A;  4MVI A;  2Z4I A;  4MEE A;  4XMG A;  2GTL N;  3G7X A;  3WVM A;  4JGL A;  2A3F X;  2RTC B;  5KID A;  1STS B;  1VWC B;  2GC9 A;  4Z2V A;  1E2T A;  2XST A;  2WQA E;  4GET A;  1AVD A;  4KT5 A;  1DZP A;  1NQN A;  4TJZ A;  5D47 A;  4H71 A;  2CBS A;  3NP1 A;  2DJF A;  4DCB A;  3FVH A;  2OY8 A;  4A8Z A;  3CR6 A;  1N9Y A;  1SRG A;  2CBR A;  4CYS A;  2C1S A;  1LDQ A;  1U18 A;  1BEB A;  1GGL A;  4GNY A;  4O4X A;  1VWN B;  3HOE A;  3OD9 A;  3PED A;  4U9C A;  3BRN A;  1Y55 X;  5D4A A;  1BRP A;  1ZRY A;  5CHK A;  2DJG A;  1KT6 A;  3B2K A;  1LUQ A;  1SWS A;  2AF5 A;  4G7N A;  4E67 A;  1VYF A;  3FR2 A;  4O3Z A;  1ML7 A;  4I3D A;  4YKM A;  3O19 A;  4BX6 A;  1I06 A;  1A87 A;  2IZF B;  4Y0Q A;  2E50 A;  3RSW A;  2W2A A;  1SWT A;  1SWR A;  3UEU A;  1SWA A;  1SWJ A;  1IIU A;  3WJF A;  4GK9 A;  4O9S A;  4DQ4 A;  3P6D A;  1KZX A;  3RWX A;  5HA1 A;  3HMJ G;  4N9J A;  4XB0 A;  1VWP B;  2NNE A;  5LJC A;  3DTQ A;  1CJ5 A;  2G7B A;  2HZR A;  1LKE A;  2RTD B;  3EBW A;  2IZE B;  1LF7 A;  4UU2 A;  4GGZ A;  1GT4 A;  3WOV A;  1N0S A;  3S26 A;  1JQP A;  1CRB A;  1ERB A;  3EW1 A;  3PK2 A;  1MDC A;  3NQK A;  5HTD A;  1N7Y A;  4LKM A;  3P6G A;  2MWH A;  4IB6 A;  3RZY A;  4FGI B;  1OPA A;  2X8T A;  1Y52 X;  4INN A;  3BU9 A;  5B27 A;  4ZR2 A;  5BYP A;  1VWJ B;  3BX8 A;  3VU1 A;  4N7Z A;  2Q4N A;  3IA8 A;  3ZW1 A;  1WUB A;  4ZH9 A;  4ZHD A;  1FEM A;  5IRA A;  3BX7 A;  1SXX A;  1T8V A;  2F01 A;  2FKG A;  2GTF X;  1VWQ B;  5LJK A;  3MBT A;  1OEJ A;  1FJ1 E;  3O22 A;  4U8U M;  1JJX A;  2F09 A;  3FA6 A;  1O8V A;  5B2A O;  4Z2P A;  2N19 A;  4WHH A;  4OKA A;  2NNQ A;  1SLD B;  5HWZ A;  4OEL A;  1LIF A;  1MX7 A;  4YBP A;  2OFA A;  3GYV A;  2OVE A;  1SY1 A;  2VKZ G;  2IZC B;  2AVI A;  4IB8 A;  4YCE A;  4MIR A;  2FWV A;  1LCW A;  2IZA A;  4N7V A;  4YVB A;  3WZN A;  3VG7 A;  4ORY A;  1NP4 A;  1LDO A;  4NLJ A;  3VHM A;  2VDF A;  2QO5 A;  2KTS A;  1DZJ A;  4HY2 A;  2JMB A;  3VG3 A;  2CZU A;  1I04 A;  4EFG A;  4KC7 A;  4GRJ A;  1ZNG A;  1LID A;  3D95 A;  4CXK A;  5HCD C;  2FRS A;  2JW1 A;  4BBO A;  4YFR A;  3S5V A;  2AKQ A;  4BJ8 A;  5KHP A;  4ZHC A;  1AQB A;  1RBP A;  2RTA A;  1XKI A;  2IZD B;  3RY1 A;  4CK4 A;  4ES7 A;  2C4I A;  2FLJ A;  3WBG A;  1BM5 A;  2RCT A;  1FTP A;  1LPJ A;  1WBI A;  3C76 X;  4HPC A;  4LKT A;  4Z28 A;  4BQU A;  4Y0R A;  1A2D A;  2RTO B;  1AEL A;  3FYF A;  1JJU A;  1STR B;  1SWB A;  3NPO A;  4WHI A;  4IAW A;  3U0D A;  2LBA A;  1GT5 A;  4WFU A;  3P2W A;  4YYP A;  4EKV A;  1DFV A;  5HTE A;  2HLV A;  4IMN A;  1SRF A;  3BLG A;  1NGL A;  5DPQ A;  2GTL M;  1LIB A;  2OFB A;  3KQ0 A;  4CPI A;  3QQ2 A;  2WR6 A;  4QYP A;  1LCZ A;  1YIV A;  3F9D A;  5H9A A;  5H9K A;  5AJB A;  1BLR A;  2FS6 A;  3D4R A;  3D9W A;  4CDD A;  1SWF A;  1NBX A;  4WHL A;  4N7C A;  1KFF A;  2HMB A;  2BS6 A;  2RA6 A;  1W4T A;  3ELX A;  5JD2 A;  4EXZ A;  3P37 A;  1QWD A;  3PPT A;  1JYJ A;  1IKJ A;  1HMT A;  1YP6 A;  1KT4 A;  2X45 A;  4XMF A;  1R0U A;  1SWC A;  1VPR A;  4AZO A;  4QGW A;  1YWA A;  2G79 A;  2OL6 O;  3S60 A;  1SY2 A;  2ANS A;  2IZL B;  1AVG I;  1RAV A;  3ZW2 A;  1EUO A;  4Z2O A;  4OS0 A;  1HQP A;  5CYB A;  2NND A;  1E1Z P;  4GUZ A;  4FDJ A;  2RTJ A;  1GX3 A;  3TGC A;  1KL3 A;  2WWP A;  4O3X B;  4XMH A;  3ZI8 A;  3Q34 A;  5IO5 A;  4YDB A;  1N43 A;  3CBC A;  4GGT A;  5EEE A;  3STM X;  3HFD A;  4ODD A;  5LJG A;  4AZR A;  4GZV A;  5FFH A;  1TXL A;  2KT4 B;  5HZ5 A;  4GNW A;  4GJS A;  2BHV A;  2X46 A;  4RUU A;  3SZJ A;  3APV A;  1HBP A;  5LJH A;  3Q1I A;  1FE3 A;  4K19 A;  1O1U A;  3F8A A;  3HWG A;  1B8E A;  1X8U A;  3H3I A;  4ZHG A;  1FSU A;  2RTI B;  3HOL A;  4WFV A;  4PJ2 A;  1RSU B;  1YWD A;  3B2L A;  1E06 A;  2OFR X;  1VWA B;  5JR8 A;  5HA0 A;  2OGQ A;  1HQQ A;  2G5L A;  3VE1 A;  3D96 A;  4NV8 A;  4XME A;  3C78 X;  2UV8 G;  4NP1 A;  2RTH B;  5HZ6 A;  1E02 A;  3KZA A;  3SZI A;  4BX5 B;  3CKF A;  4O3W A;  4ZJ0 A;  1CBS A;  4Y59 A;  3RQ7 A;  3FDC A;  3AKM A;  3PH6 A;  4IAB A;  4QQ1 A;  3UEX A;  3B2H A;  2JGS A;  3LTW A;  3PQU A;  1MEP A;  3FS3 A;  2CZT A;  3ELZ A;  3P6E A;  4C5P A;  4GDZ A;  2A8G A;  2X56 A;  2P8G A;  4U8U N;  1JJJ A;  2BC3 A;  4YFP A;  1FEL A;  4FQB B;  1W5R A;  2MJI A;  1Q4K A;  5LJE A;  4XMC A;  5EDB A;  2MF6 A;  3SOT A;  5B29 A;  1Q4O A;  2I5Z O;  1CBR A;  4NK7 A;  3T2X A;  4YMY A;  1H91 A;  2BLG A;  3NX2 A;  1SRE A;  1PM1 X;  1B56 A;  3BS2 A;  1EXS A;  4E9C A;  1DF8 A;  5DAY A;  1SWG A;  1HDH A;  1OPB A;  2MHD A;  1DV9 A;  1SRH A;  4HAB A;  1NQM A;  4OS3 A;  3HIH A;  4BVM A;  2OF8 A;  1NC9 A;  3I0A A;  1D2U A;  5F58 A;  3RDS A;  1CBQ A;  5HZ9 A;  3P35 A;  1X8P A;  1KT3 A;  3TZS A;  4NKB A;  3BSZ E;  1N2K A;  1UMW A;  3E3C A;  4O4S A;  5K68 A;  2IZG B;  2GTL O;  2HNX A;  4M6S A;  1SRI A;  3PH5 A;  1LCV A;  2L9C A;  3JSQ A;  4HPD A;  1G74 A;  4GJV A;  4YFQ A;  4M7M A;  3RDM A;  3VE2 A;  1D3S A;  3PDF A;  4EQA C;  1KZW A;  3FEP A;  4AZM A;  1HXL A;  4Z27 A;  2RN4 A;  5EDC A;  1VWO B;  3HWF A;  3RDQ A;  4O6W A;  3B2J A;  4CDE A;  1G85 A;  3MG5 A;  4BCS A;  2FR3 A;  5IO7 A;  3EBK A;  1GXA A;  5IXG A;  1B4M A;  1E00 A;  5AEO A;  1EAL A;  1KL4 A;  2I5V O;  2JU7 A;  3LHN A;  3U9P C;  1KL5 A;  4WBK A;  2IZI A;  2LB6 A;  5DG4 A;  4D6A A;  2A5B A;  2OVS A;  2L67 A;  1K24 A;  2UYW A;  2R56 A;  5CSE A;  1EII A;  3I17 A;  3IFB A;  2K23 A;  1GKA B;  1MUP A;  2KD2 A;  2RTQ B;  4BX5 A;  1SXW A;  5C0N A;  5HZ8 A;  4TNN A;  4CDF A;  1SWQ A;  5L8I A;  5BVQ A;  1S7D A;  4NYR A;  4RUN A;  3KFI A;  4O49 A;  1N4J A;  4HWM A;  1OEK A;  2DM5 A;  2AMM X;  1P6P A;  2OL7 A;  4N7D A;  5D48 A;  2IA9 A;  1SXU A;  3SLT A;  1SLG B;  1I05 A;  1GM6 A;  3ZWE A;  2L68 A;  5LKE A;  1SY0 A;  1IKE A;  1SA8 A;  2IFB A;  2IZB A;  4L3R A;  1STP A;  1XCA A;  1B0O A;  3HK1 A;  1F34 B;  4OMX A;  2IZK A;  1AUK A;  4FBR A;  5DNJ A;  2XKL A;  5IO6 A;  1JIW I;  3F6Z B;  2K62 A;  4TKH A;  1A3Y A;  4CPH A;  4D6B A;  3AUM O;  1TVQ A;  1OBP A;  1VWD B;  2POA A;  2Z4H A;  3NX1 A;  3SZH A;  4TQ2 A;  1RXJ A;  4I95 A;  5LHZ A;  4JNJ A;  1Y9L A;  4GU8 A;  5FQ8 E;  1ADL A;  1HMR A;  2RTF B;  3TF6 A;  2RD7 C;  1GKA A;  4DFW A;  4QYN A;  3RDX A;  3EMM A;  2ACP X;  1BJ7 A;  1LFO A;  3VG2 A;  2FS7 A;  2QO4 A;  2X4M A;  1KT7 A;  3WJD A;  1E33 P;  4QGV A;  4NLI A;  1JMX A;  1UYO X;  3FID A;  3ED4 A;  5HCE C;  5HBS A;  2PY1 A;  4JHQ A;  4MVE A;  4ON1 A;  1BRQ A;  1SWU A;  1SY3 A;  1X8N A;  5BVS A;  4BOE A;  5K67 A;  4PSQ A;  3MVF A;  2KW1 A;  2Y3F A;  1GX9 A;  1OSP O;  1PEE A;  1EIO A;  3P2Z A;  5AQ6 A;  3C5L A;  1CBI A;  2X32 A;  1G5W A;  1JZU A;  1ZNL A;  1NDJ A;  1SMP I;  1KQX A;  4ORR A;  5KIC A;  2JN3 A;  4MIS A;  3OJY C;  2AT0 X;  1JYD A;  4GDA A;  4IRW A;  4A1H A;  3O2Y A;  3VG4 A;  2QOS C;  3RBY A;  4X9W A;  4YGZ A;  3L4R A;  1MK5 A;  5F6Z A;  2FGS A;  4ZHH A;  4QNI A;  1S2P A;  1PBY A;  4DQ3 A;  2WPU A;  3RDO A;  4CXS A;  2OY7 A;  1MX8 A;  4I6S A;  4Y5D A;  1X8O A;  1JV4 A;  1N9M A;  2A0A A;  4ARH A;  4CPF A;  3VHI A;  1EW3 A;  1VWM B;  2ACO A;  3FW5 A;  4QRL A;  3CWK A;  5FAZ A;  4BX6 B;  1KXO A;  5H9L A;  2Q39 A;  1QY0 A;  5FEN A;  1QQS A;  5IRW A;  1KGL A;  3K3L A;  2E4J A;  3P02 A;  5AJ9 A;  4GGR A;  1DZM A;  2A2U A;  2LA7 A;  3APW A;  2RTM A;  1N2L A;  3PP6 A;  1SLF B;  3FEK A;  4BGF A;  4X9R A;  1K3B A;  5D8J A;  4IB7 A;  1ZNH A;  5L8O A;  5B5F A;  3APX A;  3RDU A;  2MM3 A;  4TKB A;  1SWP A;  3WYP A;  1SWD A;  2QO6 A;  3KVN A;  3VPJ E;  1YUP A;  3EM0 A;  1X8Q A;  2RTN B;  1SWK A;  3NQ3 A;  3OE3 A;  4YGG A;  4AYH A;  2FHL A;  3N91 A;  1O1V A;  1FEN A;  4MVL A;  3MM0 A;  5B10 O;  4HCO A;  4COT A;  2GJ5 A;  1MM9 A;  4GE1 A;  4ZCB A;  3WYQ A;  3RE5 A;  4CPE A;  3BU1 A;  5BVT A;  3NAD A;  1YWC A;  4LKL A;  2LFO A;  1TOU A;  4H5X A;  1A57 A;  4ML7 B;  1KOI A;  2RCQ A;  3WZQ A;  5HAE A;  1BWY A;  2HYS A;  1VYO A;  1Y9T A;  2NP1 A;  2OYB O;  1SWH A;  1QAB E;  1P49 A;  4A1Y A;  3P6H A;  4KH8 A;  1F32 A;  4QAE A;  2X55 A;  1QY2 A;  2RTL A;  1Y0G A;  1A18 A;  4QZT A;  4EEJ A;  4ZGU A;  5CE4 A;  3P6F A;  4ZH6 A;  1EQD A;  4NYQ A;  2FR2 A;  4Y0S A;  3VG5 A;  3WJC A;  4ORS A;  4LQZ A;  3P6C A;  3HWE A;  4GD9 A;  4U3Q A;  3B2I A;  1KT5 A;  4YBU A;  3HPE A;  3CBS A;  3NR3 A;  3LM3 A;  2Q2M A;  3ZQ3 A;  1BBP A;  1SWE A;  4ZHF A;  5H9N A;  3WJB A;  5FQ6 E;  1QFT A;  3WJE A;  1I9H A;  4CDC A;  4JO6 A;  2OL8 O;  4MVK A;  1TW4 A;  4HPA A;  2QMI A;  1NP1 A;  3APU A;  3MX7 A;  5EPQ A;  3UAQ A;  4AZN A;  1PMP A;  1URE A;  5EZ2 A;  3FIQ A;  2ZAG A;  2UZ2 A;  2ASN X;  2RTB B;  1VWL B;  3GE2 A;  1ZND A;  4YKO A;  3ZUI A;  1LNM A;  2R73 A;  4RS6 A;  1PTS A;  2OVA A;  1G7N A;  3SLJ A;  2W2F A;  2WQ9 A;  4I3B A;  5F1E A;  4CV7 A;  4X9V A;  1BSY A;  1JBH A;  1ICM A;  1EPA A;  2AT5 X;  2BT9 A;  4Y0P A;  1VYG A;  4ZGF A;  3WJG A;  3KFG A;  5F7G A;  2BSZ A;  3D97 A;  2A2G A;  2RTK A;  4ORW A;  2FTB A;  5FQ7 E;  3ZUO A;  2ALL X;  3TGA A;  4CSB A;  1LIC A;  1AB0 A;  1HBQ A;  2O62 A;  3ZZV A;  3FR4 A;  1QG5 A;  1LEL A;  1VWK B;  1OBU A;  3P24 A;  3LV4 A;  4QGX A;  2YMS A;  1RLB E;  2N93 A;  2AT3 X;  2PI3 O;  1JMZ A;  3AEH A;  4O4U A;  3GYW A;  1SLE B;  2I9X A;  2GH7 A;  3EC5 A;  4CYR A;  3HIK A;  2OF9 A;  4I9R A;  2RTR B;  1BSO A;  1IW2 A;  3BDR A;  3JQO A;  4YGH A;  5IRU A;  3X00 A;  3EW2 A;  4O4O A;  1Y53 X;  5EED A;  2A5C A;  1UYN X;  1SRJ A;  3SAO A;  1RST B;  2QCB A;  3V8U A;  5L3Y A;  1VWF B;  2VFB A;  3FA9 A;  3FW4 A;  2AL0 X;  2M4L A;  2OY1 O;  2I9Z A;  3T1D A;  4LZV A;  3C77 X;  1U0X A;  4UU3 A;  3U03 A;  2HZQ A;  2IZH B;  4OS8 A;  3PEC A;  1FDQ A;  3BZI A;  2FHN X;  1VWH B;  2OY5 O;  1Z24 A;  1X71 A;  3EYC A; 
#chains in the Genus database with same CATH homology
 1PPP A;  3BPM A;  4CXU A;  4BSQ A;  4G54 A;  3I3T A;  2PAD A;  3IUT A;  3V6E A;  4OEM A;  3P5W A;  1E3C P;  2P7U A;  2ACT A;  2CB5 A;  1KFU L;  2FRQ A;  1PPO A;  2VFC A;  2QZU A;  3V6C A;  1Y4H A;  3IOQ A;  2R9N A;  2VHS A;  2YJ9 A;  1M6D A;  1GEC E;  1YK8 A;  4CZW A;  3OVX A;  3LXQ A;  2DC9 A;  3E1Z B;  3OF8 A;  1BGO A;  3M99 A;  3ERV A;  4B55 A;  3MHH A;  4CDD B;  1E2S P;  1ICF A;  4YYV A;  2XU1 A;  1BQI A;  2FYE A;  3QT4 A;  4FDI A;  1W6F A;  1YAL A;  1MS6 A;  3WXG A;  1KFX L;  3KKU A;  1FH0 A;  4NV7 A;  3PBH A;  3KDR A;  4DMX A;  2NQI A;  1THE A;  1GLO A;  2DC8 A;  2IPP B;  2JQG R;  2E01 A;  1PIP A;  2NQD B;  3HHA A;  3S3Q A;  5PAD A;  2G7Y A;  3KFQ A;  2E00 A;  3LXS A;  3HD3 A;  4PP1 A;  1VJV A;  2B1M A;  5J94 A;  1NPZ A;  1AU0 A;  3P5V A;  3N3G A;  2F1G A;  3QJ3 A;  1EWM A;  1YVB A;  1XKG A;  2OZ2 A;  4WA6 A;  1U9W A;  3N3K A;  2IBI A;  2R9M A;  4N4Z A;  2P0R A;  1Y08 A;  1MDW A;  1E2T A;  1BY8 A;  3F5V A;  1Q6K A;  4CYS A;  5F02 A;  1SNK A;  1O0E A;  1TU6 A;  3C9E A;  1F2C A;  5A24 A;  4QRX A;  3QSD A;  2WBF X;  4G7N A;  1AIM A;  3OVZ A;  2E50 A;  1CPJ A;  2AIM A;  5EF4 A;  4AXM A;  2DJG B;  3WXF A;  4CDC B;  4QBB A;  4RY2 A;  5CVN B;  4K7C A;  4W5C A;  1A6R A;  2AUX A;  3HMJ G;  3KW9 A;  4N9J A;  3IHP A;  1PPD A;  2YJC A;  1AYW A;  2FQ9 A;  3K9M A;  1JQP A;  4HWY A;  2GHU A;  1PE6 A;  4YYW A;  3F75 A;  2AYO A;  3BPF A;  4N7Z A;  3H6S A;  3K8U A;  4FIP A;  1AU3 A;  4X6I A;  4I07 A;  4YYU A;  3TNX A;  3BC3 A;  2G8E A;  1CB5 A;  3U8E A;  3MHS A;  4OEL A;  2E03 A;  1KHQ A;  9PAP A;  3GYV A;  2YJ8 A;  2VKZ G;  1CSB B;  1QXP A;  5FPW A;  4N7V A;  1IWD A;  3BOW A;  1HUC B;  3OIS A;  4W5B A;  2DZZ A;  1F2A A;  2YJ2 A;  4CXK A;  2DJF B;  3CBJ A;  3MTN A;  2ATO A;  2Y5B A;  4YVA A;  1PCI A;  2E02 A;  1ATK A;  1STF E;  3D9W A;  1NLJ A;  1PBH A;  1W4T A;  5CVM A;  5CHV A;  3MOR A;  3PNR A;  4AXL A;  3ZUA A;  1U9X A;  4X6H A;  2DC7 A;  3BWK A;  3DF0 A;  1CJL A;  1CS8 A;  1E1Z P;  4GUZ A;  1ZIV A;  4FDJ A;  1GX3 A;  5K16 A;  7PCK A;  1S4V A;  3HFD A;  2F7D A;  1F2B A;  1QDQ A;  2B1N A;  1FSU A;  4N79 A;  4YYQ A;  5CVO B;  3AI8 A;  2AYN A;  1U5I A;  3CH3 X;  2PBH A;  4BPV A;  2CIO A;  4NV8 A;  2R9F A;  2UV8 G;  1KHP A;  3GCB A;  2PRE A;  1U9V A;  4MSX A;  1KXR A;  3LTW A;  3FS3 A;  1QMY A;  5JA7 A;  4C5P A;  2OUL A;  4YYR A;  4X6J A;  1W5R A;  2PNS A;  1DEU A;  4NK7 A;  1ZCM A;  4FK5 A;  4I04 A;  4ZUX U;  5DAY A;  2R6N A;  1HDH A;  1MHW A;  4QRV A;  2DC6 A;  2XU4 A;  1CVZ A;  2FTD A;  4Q8H A;  4NKB A;  2DCB A;  1MEM A;  1N2K A;  1NB3 A;  1NQC A;  2AS8 A;  1AYV A;  4XUI A;  2OP3 A;  3IMA A;  3PDF A;  1AYU A;  2HXZ A;  1AEC A;  4XR7 A;  2DCC A;  6PAD A;  1ME4 A;  2NQA A;  4I05 A;  3IEJ A;  4CDE B;  4PI3 A;  3K24 A;  4YV8 A;  5EGW A;  1GCB A;  4P6E A;  3P5X A;  3RVW A;  2C0Y A;  2DCD A;  3WXE A;  3I06 A;  4MZO A;  3IV2 A;  1AU4 A;  1PAD A;  1GMY A;  2H7J A;  1AUK A;  1DF0 A;  2R9O A;  1BP4 A;  3BCN A;  4PAD A;  4KLB A;  2ARY A;  3HHI A;  1CTE A;  2JQF R;  1EWO A;  4Q8G A;  1EWL A;  1MIR A;  2AUZ A;  2AVW A;  2O6X A;  1E33 P;  2VHF A;  1X9Y A;  8PCH A;  4BS5 A;  2NQG A;  3ED4 A;  1POP A;  1AU2 A;  2P86 A;  2BDZ A;  1CQD A;  4N8W A;  2FO5 A;  1TL9 A;  2G6D A;  1ME3 A;  3H7D A;  3USV A;  4BQV A;  1EWP A;  3HWN A;  1U9Q X;  3D6S A;  3P5U A;  4CXS A;  2G8J A;  3CH2 X;  3OF9 A;  2Y6E A;  2FT2 A;  3H89 A;  1EF7 A;  2YJB A;  2AU1 A;  4P6G A;  4BS6 A;  1SP4 B;  2R9C A;  1K3B B;  1ITO A;  5AJ9 A;  1N2L A;  2XU3 A;  3RVX A;  4BGF A;  2DCA A;  3H8B A;  3N4C A;  4W4U A;  3KWB X;  2XU5 A;  1QOL A;  4QH6 A;  2HH5 A;  3KWZ A;  1CV8 A;  3H8C A;  1P49 A;  2HD5 A;  5JH3 A;  3O0U A;  5CHT A;  2DZY A;  3B79 A;  4PP2 E;  1F29 A;  4MZS A;  3LM3 A;  4QRG A;  3PW3 A;  3RVV A;  3LFY A;  4FJC A;  1VSN A;  2FRA A;  3O1G A;  1YT7 A;  1TLO A;  2GFO A;  1MEG A;  2BSZ A;  3KX1 A;  4DMY A;  1YK7 A;  3CBK A;  1PXV A;  2BDL A;  1PPN A;  3KSE A;  3GYW A;  4CDF B;  4CYR A;  1NL6 A;  1NB5 A;  2VFB A;  2HHN A;  4YYS A;  2FUD A;  3NHE A;  3S3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...