3RQ7A

Polo-like kinase 1 polo box domain in complex with a c6h5(ch2)8-derivatized peptide inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
212
Chain Sequence
b'HLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGAPRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PLK1
publication title Serendipitous alkylation of a Plk1 ligand uncovers a new binding channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 63
structure length 212
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3rq7A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3rq7A01
3Q1IA 3RQ7A 2N19A 4H71A 2OGQA 4O9WA 3P37A 3BZIA 4X9VA 1Q4KA 4LKLA 4WHKA 3P2ZA 4E67A 3HIKA 4J7BB 4O6WA 5J19A 4DFWA 4YYPA 4WHLA 4HABA 4O56A 5DMVC 3C5LA 4RS6A 5DNJA 4HY2A 3FVHA 4E9DA 4HCOA 3P34A 4X9WA 4XB0A 4LKMA 5LHZA 1Q4OA 3P35A 4E9CA 4RCPA 3P2WA 4WHHA 3HIHA 5DMSA 4X9RA 3P36A 4H5XA 2OJXA 1UMWA
chains in the Genus database with same CATH superfamily
3HMJG 4H71A 3LM3A 4O9WA 3P37A 4X9VA 4WHKA 3P2ZA 4N9JA 4G7NA 4NK7A 3GYWA 5AJ9A 5DMVC 4E9DA 4HCOA 4N7VA 1Q4OA 3P35A 4H5XA 4CYSA 3RQ7A 2N19A 2OGQA 3GYVA 4N7ZA 3HIKA 1E2SP 4O6WA 4DFWA 1N2KA 4RS6A 2E50A 4HY2A 1N2LA 1P49A 4X9WA 1E2TA 4E9CA 4WHHA 5DAYA 1FSUA 3P36A 4CYRA 1HDHA 1F32A 3BZIA 4CXKA 3KDRA 4E67A 3LXQA 4J7BB 1F34B 5J19A 1AUKA 1E3CP 3FVHA 2IA9A 4RCPA 3FS3A 1A87A 5DMSA 3P2WA 4X9RA 2QZUA 2OJXA 3HFDA 2I9ZA 4FDJA 3Q1IA 2I9XA 2VKZG 1E33P 1Q4KA 4LKLA 1UMWA 4CXSA 3ED4A 4NKBA 4FDIA 4CXUA 4YYPA 4WHLA 4HABA 4O56A 3C5LA 5DNJA 3P34A 4XB0A 4LKMA 5LHZA 3HIHA 2UV8G 1E1ZP
chains in the Genus database with same CATH topology
3Q1IA 3RQ7A 2N19A 4H71A 2OGQA 4O9WA 3P37A 3BZIA 4X9VA 1Q4KA 4LKLA 4WHKA 3P2ZA 4E67A 3HIKA 4J7BB 4O6WA 5J19A 4DFWA 4YYPA 4WHLA 4HABA 4O56A 5DMVC 3C5LA 4RS6A 5DNJA 4HY2A 3FVHA 4E9DA 4HCOA 3P34A 4X9WA 4XB0A 4LKMA 5LHZA 1Q4OA 3P35A 4E9CA 4RCPA 3P2WA 4WHHA 3HIHA 5DMSA 4X9RA 3P36A 4H5XA 2OJXA 1UMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1I A;  3RQ7 A;  2N19 A;  4H71 A;  2OGQ A;  4O9W A;  3P37 A;  3BZI A;  4X9V A;  1Q4K A;  4LKL A;  4WHK A;  3P2Z A;  4E67 A;  3HIK A;  4J7B B;  4O6W A;  5J19 A;  4DFW A;  4YYP A;  4WHL A;  4HAB A;  4O56 A;  5DMV C;  3C5L A;  4RS6 A;  5DNJ A;  4HY2 A;  3FVH A;  4E9D A;  4HCO A;  3P34 A;  4X9W A;  4XB0 A;  4LKM A;  5LHZ A;  1Q4O A;  3P35 A;  4E9C A;  4RCP A;  3P2W A;  4WHH A;  3HIH A;  5DMS A;  4X9R A;  3P36 A;  4H5X A;  2OJX A;  1UMW A; 
#chains in the Genus database with same CATH topology
 3HMJ G;  4H71 A;  3LM3 A;  4O9W A;  3P37 A;  4X9V A;  4WHK A;  3P2Z A;  4N9J A;  4G7N A;  4NK7 A;  3GYW A;  5AJ9 A;  5DMV C;  4E9D A;  4HCO A;  4N7V A;  1Q4O A;  3P35 A;  4H5X A;  4CYS A;  3RQ7 A;  2N19 A;  2OGQ A;  3GYV A;  4N7Z A;  3HIK A;  1E2S P;  4O6W A;  4DFW A;  1N2K A;  4RS6 A;  2E50 A;  4HY2 A;  1N2L A;  1P49 A;  4X9W A;  1E2T A;  4E9C A;  4WHH A;  5DAY A;  1FSU A;  3P36 A;  4CYR A;  1HDH A;  1F32 A;  3BZI A;  4CXK A;  3KDR A;  4E67 A;  3LXQ A;  4J7B B;  1F34 B;  5J19 A;  1AUK A;  1E3C P;  3FVH A;  2IA9 A;  4RCP A;  3FS3 A;  1A87 A;  5DMS A;  3P2W A;  4X9R A;  2QZU A;  2OJX A;  3HFD A;  2I9Z A;  4FDJ A;  3Q1I A;  2I9X A;  2VKZ G;  1E33 P;  1Q4K A;  4LKL A;  1UMW A;  4CXS A;  3ED4 A;  4NKB A;  4FDI A;  4CXU A;  4YYP A;  4WHL A;  4HAB A;  4O56 A;  3C5L A;  5DNJ A;  3P34 A;  4XB0 A;  4LKM A;  5LHZ A;  3HIH A;  2UV8 G;  1E1Z P; 
#chains in the Genus database with same CATH homology
 3Q1I A;  3RQ7 A;  2N19 A;  4H71 A;  2OGQ A;  4O9W A;  3P37 A;  3BZI A;  4X9V A;  1Q4K A;  4LKL A;  4WHK A;  3P2Z A;  4E67 A;  3HIK A;  4J7B B;  4O6W A;  5J19 A;  4DFW A;  4YYP A;  4WHL A;  4HAB A;  4O56 A;  5DMV C;  3C5L A;  4RS6 A;  5DNJ A;  4HY2 A;  3FVH A;  4E9D A;  4HCO A;  3P34 A;  4X9W A;  4XB0 A;  4LKM A;  5LHZ A;  1Q4O A;  3P35 A;  4E9C A;  4RCP A;  3P2W A;  4WHH A;  3HIH A;  5DMS A;  4X9R A;  3P36 A;  4H5X A;  2OJX A;  1UMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...