3RQ7A

Polo-like kinase 1 polo box domain in complex with a c6h5(ch2)8-derivatized peptide inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
212
Chain Sequence
HLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGAPRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous alkylation of a Plk1 ligand uncovers a new binding channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
total genus 63
structure length 212
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3rq7A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3rq7A01
4X9WA 3P2ZA 2N19A 4HCOA 4E9DA 5DNJA 1Q4OA 3HIHA 4LKMA 3BZIA 3RQ7A 1UMWA 3HIKA 4HY2A 4WHHA 5DMSA 4X9VA 4H5XA 4O9WA 4WHLA 1Q4KA 4RS6A 4E9CA 3Q1IA 4XB0A 2OGQA 5LHZA 4O6WA 3P34A 4X9RA 4YYPA 4O56A 5DMVC 3FVHA 4WHKA 5J19A 4RCPA 4DFWA 3P36A 4E67A 4H71A 3P35A 3P37A 2OJXA 4LKLA 3P2WA 3C5LA 4J7BB 4HABA
chains in the Genus database with same CATH superfamily
4X9WA 4E9DA 3HIHA 3GYWA 3RQ7A 4HY2A 1A87A 4NK7A 4H5XA 1N2LA 1FSUA 4O9WA 4WHLA 1Q4KA 4RS6A 4XB0A 5LHZA 1F32A 4WHKA 4RCPA 3P36A 3FS3A 4NKBA 1F34B 3P37A 2OJXA 3LM3A 4HABA 3P2ZA 1Q4OA 4LKMA 3BZIA 1UMWA 1E3CP 3HFDA 3HMJG 3ED4A 2IA9A 4E9CA 2OGQA 4CXKA 3P34A 1HDHA 2I9ZA 5J19A 5DAYA 2E50A 3P2WA 4FDIA 1AUKA 3LXQA 4N7ZA 2N19A 4HCOA 1N2KA 5AJ9A 4CYRA 3HIKA 4WHHA 4X9VA 2VKZG 4G7NA 3Q1IA 3GYVA 4O6WA 4YYPA 4O56A 5DMVC 3FVHA 4DFWA 4CXUA 4H71A 4CXSA 4LKLA 3C5LA 4J7BB 4X9RA 5DNJA 2UV8G 4FDJA 5DMSA 4N9JA 2I9XA 4N7VA 2QZUA 1E1ZP 1E2TA 1E33P 1E2SP 4E67A 4CYSA 3P35A 3KDRA 1P49A
chains in the Genus database with same CATH topology
4X9WA 3P2ZA 2N19A 4HCOA 4E9DA 5DNJA 1Q4OA 3HIHA 4LKMA 3BZIA 3RQ7A 1UMWA 3HIKA 4HY2A 4WHHA 5DMSA 4X9VA 4H5XA 4O9WA 4WHLA 1Q4KA 4RS6A 4E9CA 3Q1IA 4XB0A 2OGQA 5LHZA 4O6WA 3P34A 4X9RA 4YYPA 4O56A 5DMVC 3FVHA 4WHKA 5J19A 4RCPA 4DFWA 3P36A 4E67A 4H71A 3P35A 3P37A 2OJXA 4LKLA 3P2WA 3C5LA 4J7BB 4HABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X9W A;  3P2Z A;  2N19 A;  4HCO A;  4E9D A;  5DNJ A;  1Q4O A;  3HIH A;  4LKM A;  3BZI A;  3RQ7 A;  1UMW A;  3HIK A;  4HY2 A;  4WHH A;  5DMS A;  4X9V A;  4H5X A;  4O9W A;  4WHL A;  1Q4K A;  4RS6 A;  4E9C A;  3Q1I A;  4XB0 A;  2OGQ A;  5LHZ A;  4O6W A;  3P34 A;  4X9R A;  4YYP A;  4O56 A;  5DMV C;  3FVH A;  4WHK A;  5J19 A;  4RCP A;  4DFW A;  3P36 A;  4E67 A;  4H71 A;  3P35 A;  3P37 A;  2OJX A;  4LKL A;  3P2W A;  3C5L A;  4J7B B;  4HAB A; 
#chains in the Genus database with same CATH topology
 4X9W A;  4E9D A;  3HIH A;  3GYW A;  3RQ7 A;  4HY2 A;  1A87 A;  4NK7 A;  4H5X A;  1N2L A;  1FSU A;  4O9W A;  4WHL A;  1Q4K A;  4RS6 A;  4XB0 A;  5LHZ A;  1F32 A;  4WHK A;  4RCP A;  3P36 A;  3FS3 A;  4NKB A;  1F34 B;  3P37 A;  2OJX A;  3LM3 A;  4HAB A;  3P2Z A;  1Q4O A;  4LKM A;  3BZI A;  1UMW A;  1E3C P;  3HFD A;  3HMJ G;  3ED4 A;  2IA9 A;  4E9C A;  2OGQ A;  4CXK A;  3P34 A;  1HDH A;  2I9Z A;  5J19 A;  5DAY A;  2E50 A;  3P2W A;  4FDI A;  1AUK A;  3LXQ A;  4N7Z A;  2N19 A;  4HCO A;  1N2K A;  5AJ9 A;  4CYR A;  3HIK A;  4WHH A;  4X9V A;  2VKZ G;  4G7N A;  3Q1I A;  3GYV A;  4O6W A;  4YYP A;  4O56 A;  5DMV C;  3FVH A;  4DFW A;  4CXU A;  4H71 A;  4CXS A;  4LKL A;  3C5L A;  4J7B B;  4X9R A;  5DNJ A;  2UV8 G;  4FDJ A;  5DMS A;  4N9J A;  2I9X A;  4N7V A;  2QZU A;  1E1Z P;  1E2T A;  1E33 P;  1E2S P;  4E67 A;  4CYS A;  3P35 A;  3KDR A;  1P49 A; 
#chains in the Genus database with same CATH homology
 4X9W A;  3P2Z A;  2N19 A;  4HCO A;  4E9D A;  5DNJ A;  1Q4O A;  3HIH A;  4LKM A;  3BZI A;  3RQ7 A;  1UMW A;  3HIK A;  4HY2 A;  4WHH A;  5DMS A;  4X9V A;  4H5X A;  4O9W A;  4WHL A;  1Q4K A;  4RS6 A;  4E9C A;  3Q1I A;  4XB0 A;  2OGQ A;  5LHZ A;  4O6W A;  3P34 A;  4X9R A;  4YYP A;  4O56 A;  5DMV C;  3FVH A;  4WHK A;  5J19 A;  4RCP A;  4DFW A;  3P36 A;  4E67 A;  4H71 A;  3P35 A;  3P37 A;  2OJX A;  4LKL A;  3P2W A;  3C5L A;  4J7B B;  4HAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...