3RQ7A

Polo-like kinase 1 polo box domain in complex with a c6h5(ch2)8-derivatized peptide inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
222
structure length
212
Chain Sequence
HLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGAPRLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous alkylation of a Plk1 ligand uncovers a new binding channel.
pubmed doi rcsb
molecule keywords Serine/threonine-protein kinase PLK1
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 63
structure length 212
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3rq7A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 3rq7A01
1UMWA 1Q4KA 4WHKA 4RCPA 4HCOA 4O56A 4E9DA 4YYPA 3P34A 3BZIA 3P36A 5DMSA 5DNJA 4E67A 4E9CA 5J19A 4RS6A 3P37A 3FVHA 3P2ZA 4WHHA 4X9WA 2OGQA 4HY2A 4HABA 4WHLA 3RQ7A 4J7BB 4X9VA 2OJXA 4LKLA 4LKMA 3Q1IA 4XB0A 4O9WA 4DFWA 3P35A 3C5LA 1Q4OA 3HIHA 3P2WA 5LHZA 3HIKA 4O6WA 4X9RA 2N19A 4H5XA 4H71A 5DMVC
chains in the Genus database with same CATH superfamily
4WHKA 4HCOA 4E9DA 4YYPA 3BZIA 1E2SP 4E9CA 3P37A 4WHHA 4HY2A 4WHLA 3RQ7A 4X9VA 4LKLA 1AUKA 4N7ZA 2VKZG 3HIHA 4O6WA 2N19A 1F34B 1HDHA 5DMSA 5AJ9A 4FDIA 4CYSA 1N2LA 3FVHA 3P2ZA 4X9WA 4CYRA 4CXKA 4CXUA 3FS3A 2IA9A 3LM3A 4DFWA 3P35A 3HFDA 1E33P 2UV8G 5DNJA 3HMJG 1E2TA 4N7VA 4RS6A 5J19A 2QZUA 4J7BB 1F32A 4NK7A 2OJXA 3Q1IA 4G7NA 4XB0A 4O9WA 3C5LA 1N2KA 1Q4OA 4N9JA 3P2WA 4X9RA 4H5XA 3GYVA 4H71A 1UMWA 1Q4KA 4RCPA 2I9XA 4O56A 3P34A 3P36A 2I9ZA 1FSUA 1E3CP 4E67A 3LXQA 2E50A 2OGQA 4HABA 4CXSA 3KDRA 1A87A 1E1ZP 1P49A 4LKMA 5DAYA 4NKBA 4FDJA 5LHZA 3HIKA 3ED4A 3GYWA 5DMVC
chains in the Genus database with same CATH topology
1UMWA 1Q4KA 4WHKA 4RCPA 4HCOA 4O56A 4E9DA 4YYPA 3P34A 3BZIA 3P36A 5DMSA 5DNJA 4E67A 4E9CA 5J19A 4RS6A 3P37A 3FVHA 3P2ZA 4WHHA 4X9WA 2OGQA 4HY2A 4HABA 4WHLA 3RQ7A 4J7BB 4X9VA 2OJXA 4LKLA 4LKMA 3Q1IA 4XB0A 4O9WA 4DFWA 3P35A 3C5LA 1Q4OA 3HIHA 3P2WA 5LHZA 3HIKA 4O6WA 4X9RA 2N19A 4H5XA 4H71A 5DMVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMW A;  1Q4K A;  4WHK A;  4RCP A;  4HCO A;  4O56 A;  4E9D A;  4YYP A;  3P34 A;  3BZI A;  3P36 A;  5DMS A;  5DNJ A;  4E67 A;  4E9C A;  5J19 A;  4RS6 A;  3P37 A;  3FVH A;  3P2Z A;  4WHH A;  4X9W A;  2OGQ A;  4HY2 A;  4HAB A;  4WHL A;  3RQ7 A;  4J7B B;  4X9V A;  2OJX A;  4LKL A;  4LKM A;  3Q1I A;  4XB0 A;  4O9W A;  4DFW A;  3P35 A;  3C5L A;  1Q4O A;  3HIH A;  3P2W A;  5LHZ A;  3HIK A;  4O6W A;  4X9R A;  2N19 A;  4H5X A;  4H71 A;  5DMV C; 
#chains in the Genus database with same CATH topology
 4WHK A;  4HCO A;  4E9D A;  4YYP A;  3BZI A;  1E2S P;  4E9C A;  3P37 A;  4WHH A;  4HY2 A;  4WHL A;  3RQ7 A;  4X9V A;  4LKL A;  1AUK A;  4N7Z A;  2VKZ G;  3HIH A;  4O6W A;  2N19 A;  1F34 B;  1HDH A;  5DMS A;  5AJ9 A;  4FDI A;  4CYS A;  1N2L A;  3FVH A;  3P2Z A;  4X9W A;  4CYR A;  4CXK A;  4CXU A;  3FS3 A;  2IA9 A;  3LM3 A;  4DFW A;  3P35 A;  3HFD A;  1E33 P;  2UV8 G;  5DNJ A;  3HMJ G;  1E2T A;  4N7V A;  4RS6 A;  5J19 A;  2QZU A;  4J7B B;  1F32 A;  4NK7 A;  2OJX A;  3Q1I A;  4G7N A;  4XB0 A;  4O9W A;  3C5L A;  1N2K A;  1Q4O A;  4N9J A;  3P2W A;  4X9R A;  4H5X A;  3GYV A;  4H71 A;  1UMW A;  1Q4K A;  4RCP A;  2I9X A;  4O56 A;  3P34 A;  3P36 A;  2I9Z A;  1FSU A;  1E3C P;  4E67 A;  3LXQ A;  2E50 A;  2OGQ A;  4HAB A;  4CXS A;  3KDR A;  1A87 A;  1E1Z P;  1P49 A;  4LKM A;  5DAY A;  4NKB A;  4FDJ A;  5LHZ A;  3HIK A;  3ED4 A;  3GYW A;  5DMV C; 
#chains in the Genus database with same CATH homology
 1UMW A;  1Q4K A;  4WHK A;  4RCP A;  4HCO A;  4O56 A;  4E9D A;  4YYP A;  3P34 A;  3BZI A;  3P36 A;  5DMS A;  5DNJ A;  4E67 A;  4E9C A;  5J19 A;  4RS6 A;  3P37 A;  3FVH A;  3P2Z A;  4WHH A;  4X9W A;  2OGQ A;  4HY2 A;  4HAB A;  4WHL A;  3RQ7 A;  4J7B B;  4X9V A;  2OJX A;  4LKL A;  4LKM A;  3Q1I A;  4XB0 A;  4O9W A;  4DFW A;  3P35 A;  3C5L A;  1Q4O A;  3HIH A;  3P2W A;  5LHZ A;  3HIK A;  4O6W A;  4X9R A;  2N19 A;  4H5X A;  4H71 A;  5DMV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...