4RS6A

Crystal structure of the c domain of polo like kinase ii in homo sapiens
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
b'SVADTVARVLRGCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK2
publication title Crystal structure of the polo-box domain of polo-like kinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4rs6A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4rs6A01
4O56A 4WHKA 3P2WA 4YYPA 1Q4OA 4RS6A 5DMVC 2OJXA 4E9DA 4DFWA 3HIKA 4O6WA 4WHHA 3BZIA 4HABA 4J7BB 3P37A 1UMWA 3P2ZA 3P36A 5DNJA 3Q1IA 4H5XA 4X9RA 5DMSA 4LKMA 2N19A 5LHZA 4E9CA 4X9VA 4WHLA 4H71A 4HY2A 3C5LA 4HCOA 3HIHA 3P35A 3RQ7A 4LKLA 4RCPA 4XB0A 1Q4KA 4E67A 5J19A 2OGQA 3P34A 4X9WA 3FVHA 4O9WA
chains in the Genus database with same CATH superfamily
2OJXA 1E33P 1P49A 3HIKA 4O6WA 4WHHA 3BZIA 1AUKA 3FS3A 3P36A 4G7NA 4X9VA 4CYSA 4CXSA 4HCOA 3P35A 3HMJG 2QZUA 1Q4KA 1F34B 4NK7A 4YYPA 3HFDA 4E9DA 4DFWA 3ED4A 4HABA 2VKZG 3Q1IA 4H5XA 4X9RA 5LHZA 4CXUA 1F32A 2I9ZA 1N2KA 4H71A 1A87A 4CXKA 4NKBA 1E2SP 3C5LA 3HIHA 4N9JA 2UV8G 3KDRA 4XB0A 1E2TA 4X9WA 3FVHA 4O9WA 4O56A 3LM3A 4WHKA 3LXQA 4RS6A 4J7BB 1UMWA 4E9CA 4CYRA 1E1ZP 4RCPA 5J19A 1FSUA 3RQ7A 1N2LA 3P2WA 3GYWA 1Q4OA 5DMVC 1E3CP 2I9XA 3P37A 3P2ZA 5DNJA 5DMSA 4LKMA 2N19A 3GYVA 5AJ9A 4WHLA 4HY2A 2IA9A 4FDJA 5DAYA 4N7VA 4N7ZA 4FDIA 4LKLA 4E67A 2E50A 1HDHA 2OGQA 3P34A
chains in the Genus database with same CATH topology
4O56A 4WHKA 3P2WA 4YYPA 1Q4OA 4RS6A 5DMVC 2OJXA 4E9DA 4DFWA 3HIKA 4O6WA 4WHHA 3BZIA 4HABA 4J7BB 3P37A 1UMWA 3P2ZA 3P36A 5DNJA 3Q1IA 4H5XA 4X9RA 5DMSA 4LKMA 2N19A 5LHZA 4E9CA 4X9VA 4WHLA 4H71A 4HY2A 3C5LA 4HCOA 3HIHA 3P35A 3RQ7A 4LKLA 4RCPA 4XB0A 1Q4KA 4E67A 5J19A 2OGQA 3P34A 4X9WA 3FVHA 4O9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O56 A;  4WHK A;  3P2W A;  4YYP A;  1Q4O A;  4RS6 A;  5DMV C;  2OJX A;  4E9D A;  4DFW A;  3HIK A;  4O6W A;  4WHH A;  3BZI A;  4HAB A;  4J7B B;  3P37 A;  1UMW A;  3P2Z A;  3P36 A;  5DNJ A;  3Q1I A;  4H5X A;  4X9R A;  5DMS A;  4LKM A;  2N19 A;  5LHZ A;  4E9C A;  4X9V A;  4WHL A;  4H71 A;  4HY2 A;  3C5L A;  4HCO A;  3HIH A;  3P35 A;  3RQ7 A;  4LKL A;  4RCP A;  4XB0 A;  1Q4K A;  4E67 A;  5J19 A;  2OGQ A;  3P34 A;  4X9W A;  3FVH A;  4O9W A; 
#chains in the Genus database with same CATH topology
 2OJX A;  1E33 P;  1P49 A;  3HIK A;  4O6W A;  4WHH A;  3BZI A;  1AUK A;  3FS3 A;  3P36 A;  4G7N A;  4X9V A;  4CYS A;  4CXS A;  4HCO A;  3P35 A;  3HMJ G;  2QZU A;  1Q4K A;  1F34 B;  4NK7 A;  4YYP A;  3HFD A;  4E9D A;  4DFW A;  3ED4 A;  4HAB A;  2VKZ G;  3Q1I A;  4H5X A;  4X9R A;  5LHZ A;  4CXU A;  1F32 A;  2I9Z A;  1N2K A;  4H71 A;  1A87 A;  4CXK A;  4NKB A;  1E2S P;  3C5L A;  3HIH A;  4N9J A;  2UV8 G;  3KDR A;  4XB0 A;  1E2T A;  4X9W A;  3FVH A;  4O9W A;  4O56 A;  3LM3 A;  4WHK A;  3LXQ A;  4RS6 A;  4J7B B;  1UMW A;  4E9C A;  4CYR A;  1E1Z P;  4RCP A;  5J19 A;  1FSU A;  3RQ7 A;  1N2L A;  3P2W A;  3GYW A;  1Q4O A;  5DMV C;  1E3C P;  2I9X A;  3P37 A;  3P2Z A;  5DNJ A;  5DMS A;  4LKM A;  2N19 A;  3GYV A;  5AJ9 A;  4WHL A;  4HY2 A;  2IA9 A;  4FDJ A;  5DAY A;  4N7V A;  4N7Z A;  4FDI A;  4LKL A;  4E67 A;  2E50 A;  1HDH A;  2OGQ A;  3P34 A; 
#chains in the Genus database with same CATH homology
 4O56 A;  4WHK A;  3P2W A;  4YYP A;  1Q4O A;  4RS6 A;  5DMV C;  2OJX A;  4E9D A;  4DFW A;  3HIK A;  4O6W A;  4WHH A;  3BZI A;  4HAB A;  4J7B B;  3P37 A;  1UMW A;  3P2Z A;  3P36 A;  5DNJ A;  3Q1I A;  4H5X A;  4X9R A;  5DMS A;  4LKM A;  2N19 A;  5LHZ A;  4E9C A;  4X9V A;  4WHL A;  4H71 A;  4HY2 A;  3C5L A;  4HCO A;  3HIH A;  3P35 A;  3RQ7 A;  4LKL A;  4RCP A;  4XB0 A;  1Q4K A;  4E67 A;  5J19 A;  2OGQ A;  3P34 A;  4X9W A;  3FVH A;  4O9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...