4RS6A

Crystal structure of the c domain of polo like kinase ii in homo sapiens
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
SVADTVARVLRGCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK2
publication title Crystal structure of the polo-box domain of polo-like kinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4rs6A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4rs6A01
4H71A 4O56A 2N19A 1Q4KA 4X9VA 4J7BB 4RCPA 4O6WA 2OGQA 3P36A 4LKMA 4WHKA 4H5XA 4RS6A 5DNJA 1UMWA 3FVHA 3P35A 3Q1IA 4WHHA 3P37A 4HABA 4DFWA 4X9RA 3HIHA 5LHZA 4HCOA 4E67A 5DMVC 5J19A 4XB0A 5DMSA 3BZIA 3P2WA 3P34A 4E9DA 1Q4OA 2OJXA 4HY2A 4WHLA 4E9CA 4YYPA 4LKLA 4O9WA 3RQ7A 3P2ZA 3C5LA 3HIKA 4X9WA
chains in the Genus database with same CATH superfamily
1F32A 4O56A 3HFDA 1N2KA 4RS6A 5DNJA 1F34B 1FSUA 3FVHA 3Q1IA 4CYRA 4DFWA 3HIHA 5LHZA 4E67A 1A87A 1E2SP 3P34A 4E9DA 3ED4A 1N2LA 3KDRA 4YYPA 3GYVA 2IA9A 3GYWA 3HIKA 4X9VA 4O6WA 2I9XA 4LKMA 4G7NA 4H5XA 3P35A 4HABA 2I9ZA 5J19A 5AJ9A 4NKBA 3P2WA 2OJXA 3HMJG 4O9WA 1E2TA 2E50A 4H71A 4CXUA 3FS3A 1UMWA 1E1ZP 4N7VA 4N9JA 4WHHA 4CXKA 4X9RA 4CYSA 5DAYA 5DMVC 1E33P 1Q4OA 1HDHA 1E3CP 4E9CA 3RQ7A 3P2ZA 2VKZG 2N19A 1Q4KA 4J7BB 3LM3A 4RCPA 2OGQA 3P36A 4WHKA 4CXSA 3P37A 4HCOA 4XB0A 5DMSA 3BZIA 1P49A 3LXQA 4FDIA 4HY2A 4WHLA 4NK7A 2UV8G 2QZUA 4LKLA 4FDJA 1AUKA 3C5LA 4X9WA 4N7ZA
chains in the Genus database with same CATH topology
4H71A 4O56A 2N19A 1Q4KA 4X9VA 4J7BB 4RCPA 4O6WA 2OGQA 3P36A 4LKMA 4WHKA 4H5XA 4RS6A 5DNJA 1UMWA 3FVHA 3P35A 3Q1IA 4WHHA 3P37A 4HABA 4DFWA 4X9RA 3HIHA 5LHZA 4HCOA 4E67A 5DMVC 5J19A 4XB0A 5DMSA 3BZIA 3P2WA 3P34A 4E9DA 1Q4OA 2OJXA 4HY2A 4WHLA 4E9CA 4YYPA 4LKLA 4O9WA 3RQ7A 3P2ZA 3C5LA 3HIKA 4X9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H71 A;  4O56 A;  2N19 A;  1Q4K A;  4X9V A;  4J7B B;  4RCP A;  4O6W A;  2OGQ A;  3P36 A;  4LKM A;  4WHK A;  4H5X A;  4RS6 A;  5DNJ A;  1UMW A;  3FVH A;  3P35 A;  3Q1I A;  4WHH A;  3P37 A;  4HAB A;  4DFW A;  4X9R A;  3HIH A;  5LHZ A;  4HCO A;  4E67 A;  5DMV C;  5J19 A;  4XB0 A;  5DMS A;  3BZI A;  3P2W A;  3P34 A;  4E9D A;  1Q4O A;  2OJX A;  4HY2 A;  4WHL A;  4E9C A;  4YYP A;  4LKL A;  4O9W A;  3RQ7 A;  3P2Z A;  3C5L A;  3HIK A;  4X9W A; 
#chains in the Genus database with same CATH topology
 1F32 A;  4O56 A;  3HFD A;  1N2K A;  4RS6 A;  5DNJ A;  1F34 B;  1FSU A;  3FVH A;  3Q1I A;  4CYR A;  4DFW A;  3HIH A;  5LHZ A;  4E67 A;  1A87 A;  1E2S P;  3P34 A;  4E9D A;  3ED4 A;  1N2L A;  3KDR A;  4YYP A;  3GYV A;  2IA9 A;  3GYW A;  3HIK A;  4X9V A;  4O6W A;  2I9X A;  4LKM A;  4G7N A;  4H5X A;  3P35 A;  4HAB A;  2I9Z A;  5J19 A;  5AJ9 A;  4NKB A;  3P2W A;  2OJX A;  3HMJ G;  4O9W A;  1E2T A;  2E50 A;  4H71 A;  4CXU A;  3FS3 A;  1UMW A;  1E1Z P;  4N7V A;  4N9J A;  4WHH A;  4CXK A;  4X9R A;  4CYS A;  5DAY A;  5DMV C;  1E33 P;  1Q4O A;  1HDH A;  1E3C P;  4E9C A;  3RQ7 A;  3P2Z A;  2VKZ G;  2N19 A;  1Q4K A;  4J7B B;  3LM3 A;  4RCP A;  2OGQ A;  3P36 A;  4WHK A;  4CXS A;  3P37 A;  4HCO A;  4XB0 A;  5DMS A;  3BZI A;  1P49 A;  3LXQ A;  4FDI A;  4HY2 A;  4WHL A;  4NK7 A;  2UV8 G;  2QZU A;  4LKL A;  4FDJ A;  1AUK A;  3C5L A;  4X9W A;  4N7Z A; 
#chains in the Genus database with same CATH homology
 4H71 A;  4O56 A;  2N19 A;  1Q4K A;  4X9V A;  4J7B B;  4RCP A;  4O6W A;  2OGQ A;  3P36 A;  4LKM A;  4WHK A;  4H5X A;  4RS6 A;  5DNJ A;  1UMW A;  3FVH A;  3P35 A;  3Q1I A;  4WHH A;  3P37 A;  4HAB A;  4DFW A;  4X9R A;  3HIH A;  5LHZ A;  4HCO A;  4E67 A;  5DMV C;  5J19 A;  4XB0 A;  5DMS A;  3BZI A;  3P2W A;  3P34 A;  4E9D A;  1Q4O A;  2OJX A;  4HY2 A;  4WHL A;  4E9C A;  4YYP A;  4LKL A;  4O9W A;  3RQ7 A;  3P2Z A;  3C5L A;  3HIK A;  4X9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...