4RS6A

Crystal structure of the c domain of polo like kinase ii in homo sapiens
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
SVADTVARVLRGCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRLYLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTLLMSGCSSELKNRMEYALNMLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK2
publication title Crystal structure of the polo-box domain of polo-like kinase 2
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2014-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4rs6A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4rs6A01
2OJXA 3C5LA 4HY2A 4H5XA 4H71A 4E9CA 2N19A 3FVHA 4X9VA 3P2ZA 5DMVC 4X9WA 3P36A 4LKLA 4HCOA 3BZIA 5DMSA 4DFWA 4YYPA 3P35A 4E9DA 4RCPA 4LKMA 4WHKA 4E67A 4J7BB 4O6WA 5DNJA 2OGQA 3HIHA 4XB0A 4WHHA 4X9RA 5LHZA 3P37A 5J19A 3RQ7A 3HIKA 1Q4KA 4HABA 1UMWA 3P2WA 4WHLA 4O56A 4RS6A 4O9WA 3Q1IA 3P34A 1Q4OA
chains in the Genus database with same CATH superfamily
4H71A 4N7VA 3P2ZA 3GYWA 1E1ZP 3P36A 4DFWA 1E33P 4CYRA 4RCPA 4O6WA 1A87A 5DNJA 2OGQA 4WHHA 4X9RA 5LHZA 2I9ZA 4NKBA 4O56A 4RS6A 4N7ZA 2UV8G 1Q4OA 2VKZG 3FS3A 4H5XA 3HFDA 1E2SP 2N19A 4X9VA 3LXQA 1FSUA 4HCOA 1F32A 4LKMA 4XB0A 4G7NA 3RQ7A 4WHLA 4N9JA 4FDIA 2I9XA 3ED4A 3P35A 4E9DA 1E3CP 4WHKA 4CYSA 4E67A 4J7BB 1E2TA 3KDRA 2IA9A 3P2WA 4CXSA 1F34B 3P34A 2OJXA 3C5LA 3GYVA 4HY2A 4FDJA 4CXKA 4E9CA 3FVHA 5DMVC 4X9WA 2QZUA 1P49A 4LKLA 3BZIA 5DMSA 1N2KA 4YYPA 3HMJG 4CXUA 5AJ9A 4NK7A 5DAYA 3HIHA 1AUKA 5J19A 3P37A 3HIKA 3LM3A 2E50A 1Q4KA 4HABA 1HDHA 1UMWA 1N2LA 4O9WA 3Q1IA
chains in the Genus database with same CATH topology
2OJXA 3C5LA 4HY2A 4H5XA 4H71A 4E9CA 2N19A 3FVHA 4X9VA 3P2ZA 5DMVC 4X9WA 3P36A 4LKLA 4HCOA 3BZIA 5DMSA 4DFWA 4YYPA 3P35A 4E9DA 4RCPA 4LKMA 4WHKA 4E67A 4J7BB 4O6WA 5DNJA 2OGQA 3HIHA 4XB0A 4WHHA 4X9RA 5LHZA 3P37A 5J19A 3RQ7A 3HIKA 1Q4KA 4HABA 1UMWA 3P2WA 4WHLA 4O56A 4RS6A 4O9WA 3Q1IA 3P34A 1Q4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJX A;  3C5L A;  4HY2 A;  4H5X A;  4H71 A;  4E9C A;  2N19 A;  3FVH A;  4X9V A;  3P2Z A;  5DMV C;  4X9W A;  3P36 A;  4LKL A;  4HCO A;  3BZI A;  5DMS A;  4DFW A;  4YYP A;  3P35 A;  4E9D A;  4RCP A;  4LKM A;  4WHK A;  4E67 A;  4J7B B;  4O6W A;  5DNJ A;  2OGQ A;  3HIH A;  4XB0 A;  4WHH A;  4X9R A;  5LHZ A;  3P37 A;  5J19 A;  3RQ7 A;  3HIK A;  1Q4K A;  4HAB A;  1UMW A;  3P2W A;  4WHL A;  4O56 A;  4RS6 A;  4O9W A;  3Q1I A;  3P34 A;  1Q4O A; 
#chains in the Genus database with same CATH topology
 4H71 A;  4N7V A;  3P2Z A;  3GYW A;  1E1Z P;  3P36 A;  4DFW A;  1E33 P;  4CYR A;  4RCP A;  4O6W A;  1A87 A;  5DNJ A;  2OGQ A;  4WHH A;  4X9R A;  5LHZ A;  2I9Z A;  4NKB A;  4O56 A;  4RS6 A;  4N7Z A;  2UV8 G;  1Q4O A;  2VKZ G;  3FS3 A;  4H5X A;  3HFD A;  1E2S P;  2N19 A;  4X9V A;  3LXQ A;  1FSU A;  4HCO A;  1F32 A;  4LKM A;  4XB0 A;  4G7N A;  3RQ7 A;  4WHL A;  4N9J A;  4FDI A;  2I9X A;  3ED4 A;  3P35 A;  4E9D A;  1E3C P;  4WHK A;  4CYS A;  4E67 A;  4J7B B;  1E2T A;  3KDR A;  2IA9 A;  3P2W A;  4CXS A;  1F34 B;  3P34 A;  2OJX A;  3C5L A;  3GYV A;  4HY2 A;  4FDJ A;  4CXK A;  4E9C A;  3FVH A;  5DMV C;  4X9W A;  2QZU A;  1P49 A;  4LKL A;  3BZI A;  5DMS A;  1N2K A;  4YYP A;  3HMJ G;  4CXU A;  5AJ9 A;  4NK7 A;  5DAY A;  3HIH A;  1AUK A;  5J19 A;  3P37 A;  3HIK A;  3LM3 A;  2E50 A;  1Q4K A;  4HAB A;  1HDH A;  1UMW A;  1N2L A;  4O9W A;  3Q1I A; 
#chains in the Genus database with same CATH homology
 2OJX A;  3C5L A;  4HY2 A;  4H5X A;  4H71 A;  4E9C A;  2N19 A;  3FVH A;  4X9V A;  3P2Z A;  5DMV C;  4X9W A;  3P36 A;  4LKL A;  4HCO A;  3BZI A;  5DMS A;  4DFW A;  4YYP A;  3P35 A;  4E9D A;  4RCP A;  4LKM A;  4WHK A;  4E67 A;  4J7B B;  4O6W A;  5DNJ A;  2OGQ A;  3HIH A;  4XB0 A;  4WHH A;  4X9R A;  5LHZ A;  3P37 A;  5J19 A;  3RQ7 A;  3HIK A;  1Q4K A;  4HAB A;  1UMW A;  3P2W A;  4WHL A;  4O56 A;  4RS6 A;  4O9W A;  3Q1I A;  3P34 A;  1Q4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...