4G7NA

The structure of the plk4 cryptic polo box reveals two tandem polo boxes required for centriole duplication
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
SHMDRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLSDYSCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the plk4 cryptic polo box reveals two tandem polo boxes required for centriole duplication.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK4
total genus 56
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18190 Plk4_PB1 Polo-like Kinase 4 Polo Box 1
A PF18409 Plk4_PB2 Polo-like Kinase 4 Polo Box 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4g7nA01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4g7nA02
4N7ZA 4N7VA 4NK7A 4G7NA 4N9JA 4NKBA
chains in the Genus database with same CATH superfamily
1A87A 4O9WA 4X9RA 4CXUA 4N7ZA 3LM3A 4RCPA 4G7NA 5AJ9A 2OJXA 1HDHA 3P35A 3HFDA 4WHHA 3C5LA 3P36A 1E2SP 3ED4A 4WHKA 2E50A 1N2KA 5DMSA 1F32A 4FDIA 2IA9A 4H71A 4HY2A 4O56A 1E2TA 4YYPA 3Q1IA 3P37A 5DNJA 4X9VA 3P2WA 4N7VA 1E33P 4H5XA 3GYVA 3KDRA 4LKMA 4J7BB 1AUKA 3RQ7A 3FS3A 1UMWA 1FSUA 4X9WA 4WHLA 4RS6A 4HABA 3LXQA 4XB0A 2I9XA 4HCOA 2I9ZA 3HIHA 1E3CP 4LKLA 4NKBA 3BZIA 4DFWA 4CYSA 4O6WA 3HIKA 1Q4OA 2OGQA 4CXSA 4E9DA 1E1ZP 5LHZA 3FVHA 3HMJG 2N19A 4NK7A 4CXKA 5J19A 4FDJA 5DMVC 3GYWA 4E9CA 4CYRA 1F34B 2VKZG 2UV8G 4N9JA 4E67A 1P49A 1N2LA 2QZUA 5DAYA 3P34A 3P2ZA 1Q4KA
chains in the Genus database with same CATH topology
3FS3A 4CXUA 4CXSA 4N7ZA 1FSUA 3LM3A 1E1ZP 4G7NA 1E2TA 5AJ9A 3LXQA 3HMJG 1HDHA 4NK7A 4CXKA 4FDJA 3HFDA 3GYWA 4CYRA 2VKZG 4N7VA 1E2SP 3ED4A 2UV8G 2E50A 1E3CP 1N2KA 4N9JA 4NKBA 1E33P 1P49A 3GYVA 1N2LA 2QZUA 3KDRA 5DAYA 4FDIA 1AUKA 4CYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N7Z A;  4N7V A;  4NK7 A;  4G7N A;  4N9J A;  4NKB A; 
#chains in the Genus database with same CATH topology
 1A87 A;  4O9W A;  4X9R A;  4CXU A;  4N7Z A;  3LM3 A;  4RCP A;  4G7N A;  5AJ9 A;  2OJX A;  1HDH A;  3P35 A;  3HFD A;  4WHH A;  3C5L A;  3P36 A;  1E2S P;  3ED4 A;  4WHK A;  2E50 A;  1N2K A;  5DMS A;  1F32 A;  4FDI A;  2IA9 A;  4H71 A;  4HY2 A;  4O56 A;  1E2T A;  4YYP A;  3Q1I A;  3P37 A;  5DNJ A;  4X9V A;  3P2W A;  4N7V A;  1E33 P;  4H5X A;  3GYV A;  3KDR A;  4LKM A;  4J7B B;  1AUK A;  3RQ7 A;  3FS3 A;  1UMW A;  1FSU A;  4X9W A;  4WHL A;  4RS6 A;  4HAB A;  3LXQ A;  4XB0 A;  2I9X A;  4HCO A;  2I9Z A;  3HIH A;  1E3C P;  4LKL A;  4NKB A;  3BZI A;  4DFW A;  4CYS A;  4O6W A;  3HIK A;  1Q4O A;  2OGQ A;  4CXS A;  4E9D A;  1E1Z P;  5LHZ A;  3FVH A;  3HMJ G;  2N19 A;  4NK7 A;  4CXK A;  5J19 A;  4FDJ A;  5DMV C;  3GYW A;  4E9C A;  4CYR A;  1F34 B;  2VKZ G;  2UV8 G;  4N9J A;  4E67 A;  1P49 A;  1N2L A;  2QZU A;  5DAY A;  3P34 A;  3P2Z A;  1Q4K A; 
#chains in the Genus database with same CATH homology
 3FS3 A;  4CXU A;  4CXS A;  4N7Z A;  1FSU A;  3LM3 A;  1E1Z P;  4G7N A;  1E2T A;  5AJ9 A;  3LXQ A;  3HMJ G;  1HDH A;  4NK7 A;  4CXK A;  4FDJ A;  3HFD A;  3GYW A;  4CYR A;  2VKZ G;  4N7V A;  1E2S P;  3ED4 A;  2UV8 G;  2E50 A;  1E3C P;  1N2K A;  4N9J A;  4NKB A;  1E33 P;  1P49 A;  3GYV A;  1N2L A;  2QZU A;  3KDR A;  5DAY A;  4FDI A;  1AUK A;  4CYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...