4G7NA

The structure of the plk4 cryptic polo box reveals two tandem polo boxes required for centriole duplication
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
SHMDRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLSDYSCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK4
publication title The structure of the plk4 cryptic polo box reveals two tandem polo boxes required for centriole duplication.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 56
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18190 Plk4_PB1 Polo-like Kinase 4 Polo Box 1
A PF18409 Plk4_PB2 Polo-like Kinase 4 Polo Box 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4g7nA01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4g7nA02
4N9JA 4NK7A 4N7ZA 4G7NA 4NKBA 4N7VA
chains in the Genus database with same CATH superfamily
4FDIA 1E1ZP 5DMSA 3RQ7A 4X9WA 4XB0A 4WHHA 3P34A 3P2ZA 4LKLA 3HIKA 2OJXA 1N2LA 3GYVA 2VKZG 1N2KA 4LKMA 4FDJA 3C5LA 3P2WA 2IA9A 4N7ZA 3LXQA 3KDRA 5DAYA 2I9ZA 1Q4OA 4CXUA 4CYRA 3FS3A 4NK7A 5LHZA 4DFWA 5AJ9A 2QZUA 1A87A 3GYWA 4HCOA 2UV8G 1UMWA 1E2TA 3BZIA 2E50A 4HABA 4O6WA 4J7BB 3HIHA 1HDHA 4E9DA 3P35A 4CXSA 4G7NA 3LM3A 4RCPA 3ED4A 1FSUA 4N9JA 4O56A 1E3CP 1E2SP 4X9VA 3P36A 2I9XA 4WHKA 3HFDA 1E33P 4E9CA 4H71A 3P37A 4H5XA 4E67A 4WHLA 3FVHA 5DMVC 4O9WA 1F32A 4YYPA 2N19A 4X9RA 5J19A 1AUKA 4RS6A 1P49A 4N7VA 1F34B 4CYSA 3HMJG 1Q4KA 3Q1IA 2OGQA 4HY2A 4NKBA 4CXKA 5DNJA
chains in the Genus database with same CATH topology
4FDIA 1E1ZP 4CXSA 4G7NA 3LM3A 4CXUA 4CYRA 3FS3A 3ED4A 1FSUA 4N9JA 4NK7A 1N2LA 3GYVA 2VKZG 1N2KA 4FDJA 5AJ9A 1E3CP 1E2SP 1AUKA 2QZUA 3HFDA 1E33P 3GYWA 1P49A 2UV8G 4N7VA 1E2TA 5DAYA 4CYSA 3HMJG 2E50A 4N7ZA 3LXQA 4CXKA 4NKBA 3KDRA 1HDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9J A;  4NK7 A;  4N7Z A;  4G7N A;  4NKB A;  4N7V A; 
#chains in the Genus database with same CATH topology
 4FDI A;  1E1Z P;  5DMS A;  3RQ7 A;  4X9W A;  4XB0 A;  4WHH A;  3P34 A;  3P2Z A;  4LKL A;  3HIK A;  2OJX A;  1N2L A;  3GYV A;  2VKZ G;  1N2K A;  4LKM A;  4FDJ A;  3C5L A;  3P2W A;  2IA9 A;  4N7Z A;  3LXQ A;  3KDR A;  5DAY A;  2I9Z A;  1Q4O A;  4CXU A;  4CYR A;  3FS3 A;  4NK7 A;  5LHZ A;  4DFW A;  5AJ9 A;  2QZU A;  1A87 A;  3GYW A;  4HCO A;  2UV8 G;  1UMW A;  1E2T A;  3BZI A;  2E50 A;  4HAB A;  4O6W A;  4J7B B;  3HIH A;  1HDH A;  4E9D A;  3P35 A;  4CXS A;  4G7N A;  3LM3 A;  4RCP A;  3ED4 A;  1FSU A;  4N9J A;  4O56 A;  1E3C P;  1E2S P;  4X9V A;  3P36 A;  2I9X A;  4WHK A;  3HFD A;  1E33 P;  4E9C A;  4H71 A;  3P37 A;  4H5X A;  4E67 A;  4WHL A;  3FVH A;  5DMV C;  4O9W A;  1F32 A;  4YYP A;  2N19 A;  4X9R A;  5J19 A;  1AUK A;  4RS6 A;  1P49 A;  4N7V A;  1F34 B;  4CYS A;  3HMJ G;  1Q4K A;  3Q1I A;  2OGQ A;  4HY2 A;  4NKB A;  4CXK A;  5DNJ A; 
#chains in the Genus database with same CATH homology
 4FDI A;  1E1Z P;  4CXS A;  4G7N A;  3LM3 A;  4CXU A;  4CYR A;  3FS3 A;  3ED4 A;  1FSU A;  4N9J A;  4NK7 A;  1N2L A;  3GYV A;  2VKZ G;  1N2K A;  4FDJ A;  5AJ9 A;  1E3C P;  1E2S P;  1AUK A;  2QZU A;  3HFD A;  1E33 P;  3GYW A;  1P49 A;  2UV8 G;  4N7V A;  1E2T A;  5DAY A;  4CYS A;  3HMJ G;  2E50 A;  4N7Z A;  3LXQ A;  4CXK A;  4NKB A;  3KDR A;  1HDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...