4G7NA

The structure of the plk4 cryptic polo box reveals two tandem polo boxes required for centriole duplication
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
SHMDRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLSDYSCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK4
publication title The structure of the plk4 cryptic polo box reveals two tandem polo boxes required for centriole duplication.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 56
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18190 Plk4_PB1 Polo-like Kinase 4 Polo Box 1
A PF18409 Plk4_PB2 Polo-like Kinase 4 Polo Box 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4g7nA01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4g7nA02
4NK7A 4N7VA 4N9JA 4G7NA 4NKBA 4N7ZA
chains in the Genus database with same CATH superfamily
1E1ZP 4LKLA 3HFDA 3P34A 4G7NA 4X9VA 4CYRA 4H71A 4NKBA 1AUKA 4HCOA 4O6WA 3HIHA 3Q1IA 4CXSA 3BZIA 2QZUA 1A87A 2I9ZA 5DAYA 4HABA 3ED4A 4N7VA 3KDRA 4N9JA 5J19A 4O56A 4X9RA 3HMJG 3GYVA 1UMWA 4DFWA 5DMSA 4WHKA 4O9WA 2N19A 4HY2A 3FS3A 4H5XA 4YYPA 1N2LA 3P37A 4LKMA 4E9DA 3LM3A 1E33P 1E2SP 2OJXA 1HDHA 1E2TA 4E9CA 3RQ7A 1N2KA 1F32A 2IA9A 4XB0A 1F34B 4CXKA 2VKZG 3LXQA 3P2WA 3P2ZA 1P49A 1Q4KA 1FSUA 4J7BB 3P35A 4FDIA 5LHZA 3P36A 1Q4OA 2UV8G 4RS6A 2E50A 4WHLA 4NK7A 1E3CP 3HIKA 5DNJA 2I9XA 2OGQA 4N7ZA 4X9WA 4CXUA 4CYSA 3FVHA 3GYWA 3C5LA 4WHHA 4FDJA 4RCPA 5AJ9A 5DMVC 4E67A
chains in the Genus database with same CATH topology
5DAYA 1E1ZP 3ED4A 4N7VA 3KDRA 2UV8G 3HFDA 4N9JA 4G7NA 2E50A 3LM3A 1E33P 4NK7A 1E3CP 1E2SP 4CYRA 3HMJG 1HDHA 3GYVA 4NKBA 1AUKA 1E2TA 4N7ZA 1N2KA 4CXUA 4CYSA 3GYWA 4CXKA 4FDJA 2VKZG 5AJ9A 4CXSA 3FS3A 3LXQA 2QZUA 1P49A 1N2LA 1FSUA 4FDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NK7 A;  4N7V A;  4N9J A;  4G7N A;  4NKB A;  4N7Z A; 
#chains in the Genus database with same CATH topology
 1E1Z P;  4LKL A;  3HFD A;  3P34 A;  4G7N A;  4X9V A;  4CYR A;  4H71 A;  4NKB A;  1AUK A;  4HCO A;  4O6W A;  3HIH A;  3Q1I A;  4CXS A;  3BZI A;  2QZU A;  1A87 A;  2I9Z A;  5DAY A;  4HAB A;  3ED4 A;  4N7V A;  3KDR A;  4N9J A;  5J19 A;  4O56 A;  4X9R A;  3HMJ G;  3GYV A;  1UMW A;  4DFW A;  5DMS A;  4WHK A;  4O9W A;  2N19 A;  4HY2 A;  3FS3 A;  4H5X A;  4YYP A;  1N2L A;  3P37 A;  4LKM A;  4E9D A;  3LM3 A;  1E33 P;  1E2S P;  2OJX A;  1HDH A;  1E2T A;  4E9C A;  3RQ7 A;  1N2K A;  1F32 A;  2IA9 A;  4XB0 A;  1F34 B;  4CXK A;  2VKZ G;  3LXQ A;  3P2W A;  3P2Z A;  1P49 A;  1Q4K A;  1FSU A;  4J7B B;  3P35 A;  4FDI A;  5LHZ A;  3P36 A;  1Q4O A;  2UV8 G;  4RS6 A;  2E50 A;  4WHL A;  4NK7 A;  1E3C P;  3HIK A;  5DNJ A;  2I9X A;  2OGQ A;  4N7Z A;  4X9W A;  4CXU A;  4CYS A;  3FVH A;  3GYW A;  3C5L A;  4WHH A;  4FDJ A;  4RCP A;  5AJ9 A;  5DMV C;  4E67 A; 
#chains in the Genus database with same CATH homology
 5DAY A;  1E1Z P;  3ED4 A;  4N7V A;  3KDR A;  2UV8 G;  3HFD A;  4N9J A;  4G7N A;  2E50 A;  3LM3 A;  1E33 P;  4NK7 A;  1E3C P;  1E2S P;  4CYR A;  3HMJ G;  1HDH A;  3GYV A;  4NKB A;  1AUK A;  1E2T A;  4N7Z A;  1N2K A;  4CXU A;  4CYS A;  3GYW A;  4CXK A;  4FDJ A;  2VKZ G;  5AJ9 A;  4CXS A;  3FS3 A;  3LXQ A;  2QZU A;  1P49 A;  1N2L A;  1FSU A;  4FDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...