4G7NA

The structure of the plk4 cryptic polo box reveals two tandem polo boxes required for centriole duplication
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
218
structure length
218
Chain Sequence
b'SHMDRISVPPLNTKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDPGRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLSDYSCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK4
publication title The structure of the plk4 cryptic polo box reveals two tandem polo boxes required for centriole duplication.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 56
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18190 Plk4_PB1 Polo-like Kinase 4 Polo Box 1
A PF18409 Plk4_PB2 Polo-like Kinase 4 Polo Box 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.120 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4g7nA01
3.30.1120.130 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 4g7nA02
4NKBA 4N7VA 4NK7A 4N7ZA 4G7NA 4N9JA
chains in the Genus database with same CATH superfamily
1E2SP 4RCPA 4X9VA 1HDHA 2OJXA 4G7NA 4E9CA 4O6WA 1AUKA 4O9WA 4NK7A 4HY2A 5AJ9A 3C5LA 1N2LA 2I9XA 4O56A 4E9DA 4WHLA 3GYVA 4N7VA 3LM3A 3P2WA 1FSUA 4N7ZA 5DNJA 4HABA 4N9JA 4LKLA 3FVHA 4CXKA 4E67A 4XB0A 3P36A 2I9ZA 4CYSA 5J19A 4NKBA 4FDJA 3ED4A 4CXSA 1E2TA 3HIKA 2N19A 4LKMA 1N2KA 1A87A 1P49A 2IA9A 3BZIA 2E50A 4X9WA 3P35A 4WHKA 3Q1IA 2QZUA 3RQ7A 1E1ZP 2VKZG 5DMSA 3FS3A 4YYPA 1E33P 4CXUA 2OGQA 3GYWA 4RS6A 4J7BB 2UV8G 5DMVC 3P2ZA 4CYRA 3HFDA 3HMJG 3LXQA 1Q4OA 1F34B 1UMWA 5LHZA 4H71A 1Q4KA 1E3CP 4DFWA 3P34A 5DAYA 3HIHA 3KDRA 4H5XA 1F32A 4HCOA 3P37A 4FDIA 4X9RA 4WHHA
chains in the Genus database with same CATH topology
1E2SP 1N2KA 1P49A 2UV8G 2E50A 1HDHA 4N7ZA 4G7NA 4CYRA 3HFDA 4N9JA 3HMJG 3LXQA 1AUKA 4NK7A 4CXKA 1E3CP 5AJ9A 2QZUA 4CYSA 4NKBA 1E1ZP 1N2LA 4FDJA 3GYVA 3ED4A 2VKZG 5DAYA 3KDRA 4CXSA 4N7VA 3FS3A 3LM3A 1E33P 4FDIA 4CXUA 1E2TA 1FSUA 3GYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKB A;  4N7V A;  4NK7 A;  4N7Z A;  4G7N A;  4N9J A; 
#chains in the Genus database with same CATH topology
 1E2S P;  4RCP A;  4X9V A;  1HDH A;  2OJX A;  4G7N A;  4E9C A;  4O6W A;  1AUK A;  4O9W A;  4NK7 A;  4HY2 A;  5AJ9 A;  3C5L A;  1N2L A;  2I9X A;  4O56 A;  4E9D A;  4WHL A;  3GYV A;  4N7V A;  3LM3 A;  3P2W A;  1FSU A;  4N7Z A;  5DNJ A;  4HAB A;  4N9J A;  4LKL A;  3FVH A;  4CXK A;  4E67 A;  4XB0 A;  3P36 A;  2I9Z A;  4CYS A;  5J19 A;  4NKB A;  4FDJ A;  3ED4 A;  4CXS A;  1E2T A;  3HIK A;  2N19 A;  4LKM A;  1N2K A;  1A87 A;  1P49 A;  2IA9 A;  3BZI A;  2E50 A;  4X9W A;  3P35 A;  4WHK A;  3Q1I A;  2QZU A;  3RQ7 A;  1E1Z P;  2VKZ G;  5DMS A;  3FS3 A;  4YYP A;  1E33 P;  4CXU A;  2OGQ A;  3GYW A;  4RS6 A;  4J7B B;  2UV8 G;  5DMV C;  3P2Z A;  4CYR A;  3HFD A;  3HMJ G;  3LXQ A;  1Q4O A;  1F34 B;  1UMW A;  5LHZ A;  4H71 A;  1Q4K A;  1E3C P;  4DFW A;  3P34 A;  5DAY A;  3HIH A;  3KDR A;  4H5X A;  1F32 A;  4HCO A;  3P37 A;  4FDI A;  4X9R A;  4WHH A; 
#chains in the Genus database with same CATH homology
 1E2S P;  1N2K A;  1P49 A;  2UV8 G;  2E50 A;  1HDH A;  4N7Z A;  4G7N A;  4CYR A;  3HFD A;  4N9J A;  3HMJ G;  3LXQ A;  1AUK A;  4NK7 A;  4CXK A;  1E3C P;  5AJ9 A;  2QZU A;  4CYS A;  4NKB A;  1E1Z P;  1N2L A;  4FDJ A;  3GYV A;  3ED4 A;  2VKZ G;  5DAY A;  3KDR A;  4CXS A;  4N7V A;  3FS3 A;  3LM3 A;  1E33 P;  4FDI A;  4CXU A;  1E2T A;  1FSU A;  3GYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...