2N19A

Stil binding to the polo-box domain 3 of plk4 regulates centriole duplication
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
GSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTPNFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK4
publication title STIL binding to Polo-box 3 of PLK4 regulates centriole duplication.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 88
sequence length 88
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2n19A00
3HIHA 4RCPA 4RS6A 4WHKA 3BZIA 3HIKA 5DMVC 5LHZA 4X9WA 4LKLA 4HCOA 3RQ7A 3P37A 2N19A 1UMWA 5DMSA 4O9WA 4X9RA 4HY2A 1Q4OA 3C5LA 2OJXA 4WHLA 4YYPA 3P35A 5DNJA 5J19A 4X9VA 2OGQA 3Q1IA 1Q4KA 4O6WA 3P2ZA 4E9CA 3P36A 4H71A 4HABA 4O56A 3P34A 4LKMA 4E9DA 3P2WA 4XB0A 4DFWA 4J7BB 4E67A 4H5XA 3FVHA 4WHHA
chains in the Genus database with same CATH superfamily
3HIHA 4NK7A 4RS6A 4CXSA 1AUKA 3BZIA 1HDHA 5LHZA 4HCOA 4CXUA 3GYVA 3LM3A 3P35A 2OGQA 4O6WA 3P2ZA 3P36A 4O56A 3HMJG 4CXKA 1E3CP 3P2WA 5DAYA 1F34B 4NKBA 4N7VA 4CYSA 2VKZG 4LKLA 4O9WA 3KDRA 3C5LA 4FDJA 4WHLA 4N7ZA 3Q1IA 4E9CA 4H71A 3GYWA 4LKMA 4E9DA 3ED4A 4J7BB 3FVHA 1UMWA 2QZUA 2E50A 2I9ZA 4WHKA 3HIKA 5DMVC 4X9WA 2N19A 2IA9A 5DMSA 3LXQA 1A87A 4X9RA 1Q4OA 4YYPA 2UV8G 4CYRA 1E2SP 5J19A 4X9VA 5AJ9A 1Q4KA 1FSUA 4HABA 1E1ZP 1E33P 4WHHA 2I9XA 4RCPA 4G7NA 3RQ7A 3P37A 1N2KA 1F32A 4HY2A 2OJXA 5DNJA 3HFDA 1E2TA 4N9JA 1P49A 1N2LA 3P34A 4XB0A 4DFWA 3FS3A 4E67A 4H5XA 4FDIA
chains in the Genus database with same CATH topology
3HIHA 4RCPA 4RS6A 4WHKA 3BZIA 3HIKA 5DMVC 5LHZA 4X9WA 4LKLA 4HCOA 3RQ7A 3P37A 2N19A 1UMWA 5DMSA 4O9WA 4X9RA 4HY2A 1Q4OA 3C5LA 2OJXA 4WHLA 4YYPA 3P35A 5DNJA 5J19A 4X9VA 2OGQA 3Q1IA 1Q4KA 4O6WA 3P2ZA 4E9CA 3P36A 4H71A 4HABA 4O56A 3P34A 4LKMA 4E9DA 3P2WA 4XB0A 4DFWA 4J7BB 4E67A 4H5XA 3FVHA 4WHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIH A;  4RCP A;  4RS6 A;  4WHK A;  3BZI A;  3HIK A;  5DMV C;  5LHZ A;  4X9W A;  4LKL A;  4HCO A;  3RQ7 A;  3P37 A;  2N19 A;  1UMW A;  5DMS A;  4O9W A;  4X9R A;  4HY2 A;  1Q4O A;  3C5L A;  2OJX A;  4WHL A;  4YYP A;  3P35 A;  5DNJ A;  5J19 A;  4X9V A;  2OGQ A;  3Q1I A;  1Q4K A;  4O6W A;  3P2Z A;  4E9C A;  3P36 A;  4H71 A;  4HAB A;  4O56 A;  3P34 A;  4LKM A;  4E9D A;  3P2W A;  4XB0 A;  4DFW A;  4J7B B;  4E67 A;  4H5X A;  3FVH A;  4WHH A; 
#chains in the Genus database with same CATH topology
 3HIH A;  4NK7 A;  4RS6 A;  4CXS A;  1AUK A;  3BZI A;  1HDH A;  5LHZ A;  4HCO A;  4CXU A;  3GYV A;  3LM3 A;  3P35 A;  2OGQ A;  4O6W A;  3P2Z A;  3P36 A;  4O56 A;  3HMJ G;  4CXK A;  1E3C P;  3P2W A;  5DAY A;  1F34 B;  4NKB A;  4N7V A;  4CYS A;  2VKZ G;  4LKL A;  4O9W A;  3KDR A;  3C5L A;  4FDJ A;  4WHL A;  4N7Z A;  3Q1I A;  4E9C A;  4H71 A;  3GYW A;  4LKM A;  4E9D A;  3ED4 A;  4J7B B;  3FVH A;  1UMW A;  2QZU A;  2E50 A;  2I9Z A;  4WHK A;  3HIK A;  5DMV C;  4X9W A;  2N19 A;  2IA9 A;  5DMS A;  3LXQ A;  1A87 A;  4X9R A;  1Q4O A;  4YYP A;  2UV8 G;  4CYR A;  1E2S P;  5J19 A;  4X9V A;  5AJ9 A;  1Q4K A;  1FSU A;  4HAB A;  1E1Z P;  1E33 P;  4WHH A;  2I9X A;  4RCP A;  4G7N A;  3RQ7 A;  3P37 A;  1N2K A;  1F32 A;  4HY2 A;  2OJX A;  5DNJ A;  3HFD A;  1E2T A;  4N9J A;  1P49 A;  1N2L A;  3P34 A;  4XB0 A;  4DFW A;  3FS3 A;  4E67 A;  4H5X A;  4FDI A; 
#chains in the Genus database with same CATH homology
 3HIH A;  4RCP A;  4RS6 A;  4WHK A;  3BZI A;  3HIK A;  5DMV C;  5LHZ A;  4X9W A;  4LKL A;  4HCO A;  3RQ7 A;  3P37 A;  2N19 A;  1UMW A;  5DMS A;  4O9W A;  4X9R A;  4HY2 A;  1Q4O A;  3C5L A;  2OJX A;  4WHL A;  4YYP A;  3P35 A;  5DNJ A;  5J19 A;  4X9V A;  2OGQ A;  3Q1I A;  1Q4K A;  4O6W A;  3P2Z A;  4E9C A;  3P36 A;  4H71 A;  4HAB A;  4O56 A;  3P34 A;  4LKM A;  4E9D A;  3P2W A;  4XB0 A;  4DFW A;  4J7B B;  4E67 A;  4H5X A;  3FVH A;  4WHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...