2N19A

Stil binding to the polo-box domain 3 of plk4 regulates centriole duplication
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
GSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTPNFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK4
publication title STIL binding to Polo-box 3 of PLK4 regulates centriole duplication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 88
sequence length 88
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2n19A00
3P2ZA 4O6WA 1UMWA 4O9WA 2OGQA 4X9RA 3C5LA 2N19A 4DFWA 3P35A 4HABA 4WHHA 4HY2A 5DMSA 3P37A 5DMVC 4H5XA 3BZIA 3P36A 4YYPA 2OJXA 4X9VA 5J19A 4H71A 5LHZA 4LKLA 4E9CA 4O56A 4E67A 3RQ7A 3HIHA 1Q4KA 4J7BB 1Q4OA 4RS6A 4WHLA 4HCOA 4X9WA 4WHKA 3Q1IA 3FVHA 3P34A 4RCPA 5DNJA 4E9DA 4LKMA 4XB0A 3HIKA 3P2WA
chains in the Genus database with same CATH superfamily
3P2ZA 5AJ9A 4O9WA 2I9ZA 4N7ZA 4CYSA 4DFWA 4WHHA 2VKZG 4H71A 4LKLA 4E9CA 3HIHA 4WHLA 3LM3A 1Q4OA 4RS6A 2UV8G 4CXKA 1F34B 5DNJA 3P34A 4RCPA 4LKMA 4XB0A 1E3CP 1UMWA 2OGQA 3FS3A 1E2SP 3P35A 4HY2A 5DMSA 4CYRA 3HFDA 1P49A 5LHZA 5DAYA 3ED4A 4O56A 1F32A 4J7BB 2IA9A 4X9WA 2QZUA 4WHKA 1AUKA 1A87A 4YYPA 1HDHA 3HMJG 4CXUA 3C5LA 4N7VA 1E33P 4HABA 5DMVC 4H5XA 3P36A 4X9VA 1FSUA 4N9JA 1Q4KA 1N2KA 3LXQA 3FVHA 3HIKA 4O6WA 2I9XA 4FDIA 4X9RA 4FDJA 2E50A 2N19A 4CXSA 1N2LA 3P37A 4NKBA 4NK7A 3BZIA 5J19A 2OJXA 3GYVA 4G7NA 1E1ZP 1E2TA 3GYWA 4E67A 3RQ7A 4HCOA 3KDRA 3Q1IA 4E9DA 3P2WA
chains in the Genus database with same CATH topology
3P2ZA 4O6WA 1UMWA 4O9WA 2OGQA 4X9RA 3C5LA 2N19A 4DFWA 3P35A 4HABA 4WHHA 4HY2A 5DMSA 3P37A 5DMVC 4H5XA 3BZIA 3P36A 4YYPA 2OJXA 4X9VA 5J19A 4H71A 5LHZA 4LKLA 4E9CA 4O56A 4E67A 3RQ7A 3HIHA 1Q4KA 4J7BB 1Q4OA 4RS6A 4WHLA 4HCOA 4X9WA 4WHKA 3Q1IA 3FVHA 3P34A 4RCPA 5DNJA 4E9DA 4LKMA 4XB0A 3HIKA 3P2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P2Z A;  4O6W A;  1UMW A;  4O9W A;  2OGQ A;  4X9R A;  3C5L A;  2N19 A;  4DFW A;  3P35 A;  4HAB A;  4WHH A;  4HY2 A;  5DMS A;  3P37 A;  5DMV C;  4H5X A;  3BZI A;  3P36 A;  4YYP A;  2OJX A;  4X9V A;  5J19 A;  4H71 A;  5LHZ A;  4LKL A;  4E9C A;  4O56 A;  4E67 A;  3RQ7 A;  3HIH A;  1Q4K A;  4J7B B;  1Q4O A;  4RS6 A;  4WHL A;  4HCO A;  4X9W A;  4WHK A;  3Q1I A;  3FVH A;  3P34 A;  4RCP A;  5DNJ A;  4E9D A;  4LKM A;  4XB0 A;  3HIK A;  3P2W A; 
#chains in the Genus database with same CATH topology
 3P2Z A;  5AJ9 A;  4O9W A;  2I9Z A;  4N7Z A;  4CYS A;  4DFW A;  4WHH A;  2VKZ G;  4H71 A;  4LKL A;  4E9C A;  3HIH A;  4WHL A;  3LM3 A;  1Q4O A;  4RS6 A;  2UV8 G;  4CXK A;  1F34 B;  5DNJ A;  3P34 A;  4RCP A;  4LKM A;  4XB0 A;  1E3C P;  1UMW A;  2OGQ A;  3FS3 A;  1E2S P;  3P35 A;  4HY2 A;  5DMS A;  4CYR A;  3HFD A;  1P49 A;  5LHZ A;  5DAY A;  3ED4 A;  4O56 A;  1F32 A;  4J7B B;  2IA9 A;  4X9W A;  2QZU A;  4WHK A;  1AUK A;  1A87 A;  4YYP A;  1HDH A;  3HMJ G;  4CXU A;  3C5L A;  4N7V A;  1E33 P;  4HAB A;  5DMV C;  4H5X A;  3P36 A;  4X9V A;  1FSU A;  4N9J A;  1Q4K A;  1N2K A;  3LXQ A;  3FVH A;  3HIK A;  4O6W A;  2I9X A;  4FDI A;  4X9R A;  4FDJ A;  2E50 A;  2N19 A;  4CXS A;  1N2L A;  3P37 A;  4NKB A;  4NK7 A;  3BZI A;  5J19 A;  2OJX A;  3GYV A;  4G7N A;  1E1Z P;  1E2T A;  3GYW A;  4E67 A;  3RQ7 A;  4HCO A;  3KDR A;  3Q1I A;  4E9D A;  3P2W A; 
#chains in the Genus database with same CATH homology
 3P2Z A;  4O6W A;  1UMW A;  4O9W A;  2OGQ A;  4X9R A;  3C5L A;  2N19 A;  4DFW A;  3P35 A;  4HAB A;  4WHH A;  4HY2 A;  5DMS A;  3P37 A;  5DMV C;  4H5X A;  3BZI A;  3P36 A;  4YYP A;  2OJX A;  4X9V A;  5J19 A;  4H71 A;  5LHZ A;  4LKL A;  4E9C A;  4O56 A;  4E67 A;  3RQ7 A;  3HIH A;  1Q4K A;  4J7B B;  1Q4O A;  4RS6 A;  4WHL A;  4HCO A;  4X9W A;  4WHK A;  3Q1I A;  3FVH A;  3P34 A;  4RCP A;  5DNJ A;  4E9D A;  4LKM A;  4XB0 A;  3HIK A;  3P2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...