2N19A

Stil binding to the polo-box domain 3 of plk4 regulates centriole duplication
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
GSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTPNFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK4
publication title STIL binding to Polo-box 3 of PLK4 regulates centriole duplication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 88
sequence length 88
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2n19A00
1Q4KA 4X9VA 2N19A 4O56A 4J7BB 4DFWA 3C5LA 4E9DA 3HIKA 3FVHA 1UMWA 4O9WA 3RQ7A 1Q4OA 3BZIA 5J19A 4H5XA 4LKMA 4X9RA 3Q1IA 4YYPA 4LKLA 3P35A 5DMVC 3P37A 4WHLA 4WHHA 4HCOA 4RS6A 4O6WA 4RCPA 2OGQA 4WHKA 5DNJA 2OJXA 4H71A 5LHZA 4HABA 4HY2A 4E67A 3P2WA 4X9WA 4E9CA 3HIHA 5DMSA 4XB0A 3P34A 3P2ZA 3P36A
chains in the Genus database with same CATH superfamily
4X9VA 2I9XA 4FDIA 3C5LA 4CXUA 3BZIA 4X9RA 3Q1IA 3LXQA 5DMVC 4NK7A 5DNJA 2OJXA 4CXKA 4H71A 5LHZA 4HY2A 3HFDA 1AUKA 1E33P 4N7ZA 2QZUA 2I9ZA 3P2ZA 2IA9A 4J7BB 1HDHA 3KDRA 4CYSA 4O9WA 1Q4OA 3LM3A 5J19A 4H5XA 3FS3A 1FSUA 1E2SP 4WHLA 1E1ZP 4RS6A 5AJ9A 4RCPA 1F32A 3P2WA 3HMJG 1N2KA 5DMSA 3P34A 3GYWA 4X9WA 3P36A 1Q4KA 2UV8G 2N19A 1UMWA 1E2TA 3ED4A 3P35A 4NKBA 4WHHA 4FDJA 4G7NA 2OGQA 4HABA 1N2LA 4E67A 1P49A 3HIHA 3GYVA 4O56A 4CYRA 4DFWA 4E9DA 3HIKA 3FVHA 2VKZG 3RQ7A 4LKMA 4YYPA 4LKLA 3P37A 4CXSA 1F34B 1A87A 5DAYA 4HCOA 4O6WA 4WHKA 4N7VA 4E9CA 1E3CP 4XB0A 2E50A 4N9JA
chains in the Genus database with same CATH topology
1Q4KA 4X9VA 2N19A 4O56A 4J7BB 4DFWA 3C5LA 4E9DA 3HIKA 3FVHA 1UMWA 4O9WA 3RQ7A 1Q4OA 3BZIA 5J19A 4H5XA 4LKMA 4X9RA 3Q1IA 4YYPA 4LKLA 3P35A 5DMVC 3P37A 4WHLA 4WHHA 4HCOA 4RS6A 4O6WA 4RCPA 2OGQA 4WHKA 5DNJA 2OJXA 4H71A 5LHZA 4HABA 4HY2A 4E67A 3P2WA 4X9WA 4E9CA 3HIHA 5DMSA 4XB0A 3P34A 3P2ZA 3P36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q4K A;  4X9V A;  2N19 A;  4O56 A;  4J7B B;  4DFW A;  3C5L A;  4E9D A;  3HIK A;  3FVH A;  1UMW A;  4O9W A;  3RQ7 A;  1Q4O A;  3BZI A;  5J19 A;  4H5X A;  4LKM A;  4X9R A;  3Q1I A;  4YYP A;  4LKL A;  3P35 A;  5DMV C;  3P37 A;  4WHL A;  4WHH A;  4HCO A;  4RS6 A;  4O6W A;  4RCP A;  2OGQ A;  4WHK A;  5DNJ A;  2OJX A;  4H71 A;  5LHZ A;  4HAB A;  4HY2 A;  4E67 A;  3P2W A;  4X9W A;  4E9C A;  3HIH A;  5DMS A;  4XB0 A;  3P34 A;  3P2Z A;  3P36 A; 
#chains in the Genus database with same CATH topology
 4X9V A;  2I9X A;  4FDI A;  3C5L A;  4CXU A;  3BZI A;  4X9R A;  3Q1I A;  3LXQ A;  5DMV C;  4NK7 A;  5DNJ A;  2OJX A;  4CXK A;  4H71 A;  5LHZ A;  4HY2 A;  3HFD A;  1AUK A;  1E33 P;  4N7Z A;  2QZU A;  2I9Z A;  3P2Z A;  2IA9 A;  4J7B B;  1HDH A;  3KDR A;  4CYS A;  4O9W A;  1Q4O A;  3LM3 A;  5J19 A;  4H5X A;  3FS3 A;  1FSU A;  1E2S P;  4WHL A;  1E1Z P;  4RS6 A;  5AJ9 A;  4RCP A;  1F32 A;  3P2W A;  3HMJ G;  1N2K A;  5DMS A;  3P34 A;  3GYW A;  4X9W A;  3P36 A;  1Q4K A;  2UV8 G;  2N19 A;  1UMW A;  1E2T A;  3ED4 A;  3P35 A;  4NKB A;  4WHH A;  4FDJ A;  4G7N A;  2OGQ A;  4HAB A;  1N2L A;  4E67 A;  1P49 A;  3HIH A;  3GYV A;  4O56 A;  4CYR A;  4DFW A;  4E9D A;  3HIK A;  3FVH A;  2VKZ G;  3RQ7 A;  4LKM A;  4YYP A;  4LKL A;  3P37 A;  4CXS A;  1F34 B;  1A87 A;  5DAY A;  4HCO A;  4O6W A;  4WHK A;  4N7V A;  4E9C A;  1E3C P;  4XB0 A;  2E50 A;  4N9J A; 
#chains in the Genus database with same CATH homology
 1Q4K A;  4X9V A;  2N19 A;  4O56 A;  4J7B B;  4DFW A;  3C5L A;  4E9D A;  3HIK A;  3FVH A;  1UMW A;  4O9W A;  3RQ7 A;  1Q4O A;  3BZI A;  5J19 A;  4H5X A;  4LKM A;  4X9R A;  3Q1I A;  4YYP A;  4LKL A;  3P35 A;  5DMV C;  3P37 A;  4WHL A;  4WHH A;  4HCO A;  4RS6 A;  4O6W A;  4RCP A;  2OGQ A;  4WHK A;  5DNJ A;  2OJX A;  4H71 A;  5LHZ A;  4HAB A;  4HY2 A;  4E67 A;  3P2W A;  4X9W A;  4E9C A;  3HIH A;  5DMS A;  4XB0 A;  3P34 A;  3P2Z A;  3P36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...