2N19A

Stil binding to the polo-box domain 3 of plk4 regulates centriole duplication
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
GSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTPNFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title STIL binding to Polo-box 3 of PLK4 regulates centriole duplication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK4
total genus 18
structure length 88
sequence length 88
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2n19A00
3P37A 3Q1IA 4LKMA 1Q4KA 4HCOA 4RCPA 5DMVC 4HY2A 4XB0A 5LHZA 4E9CA 3P2WA 4HABA 4J7BB 3FVHA 4WHLA 3RQ7A 3C5LA 5DMSA 4O56A 4YYPA 4X9RA 4WHKA 4DFWA 1UMWA 1Q4OA 2N19A 3HIHA 3P34A 5DNJA 4X9VA 2OJXA 3BZIA 4O9WA 4H71A 4RS6A 4E9DA 5J19A 4WHHA 4LKLA 4O6WA 4X9WA 4E67A 3HIKA 2OGQA 3P35A 4H5XA 3P2ZA 3P36A
chains in the Genus database with same CATH superfamily
3Q1IA 1Q4KA 4RCPA 4FDIA 1P49A 4CXSA 3P2WA 4G7NA 3C5LA 4X9RA 5DAYA 2IA9A 1HDHA 3GYVA 4H71A 5J19A 4E67A 4N9JA 3P35A 5DNJA 4CXUA 1AUKA 1E2TA 1F32A 1E1ZP 5DMVC 5LHZA 1F34B 3KDRA 2I9ZA 4WHLA 5DMSA 4YYPA 4DFWA 2VKZG 3HIHA 1FSUA 4NKBA 4X9VA 2OJXA 4O9WA 4N7ZA 4E9DA 4O6WA 1A87A 4H5XA 3P2ZA 4WHKA 3HMJG 3P37A 4N7VA 5AJ9A 4NK7A 4HY2A 3LM3A 3HFDA 4HABA 4J7BB 1N2KA 3FVHA 4O56A 3ED4A 1E2SP 1UMWA 1Q4OA 2N19A 3P34A 3BZIA 4RS6A 1E3CP 4X9WA 3HIKA 3FS3A 3GYWA 4LKMA 4HCOA 1E33P 4XB0A 4E9CA 2I9XA 3RQ7A 1N2LA 4FDJA 4CYRA 3LXQA 4CYSA 2QZUA 2E50A 4CXKA 2UV8G 4LKLA 4WHHA 2OGQA 3P36A
chains in the Genus database with same CATH topology
3P37A 3Q1IA 4LKMA 1Q4KA 4HCOA 4RCPA 5DMVC 4HY2A 4XB0A 5LHZA 4E9CA 3P2WA 4HABA 4J7BB 3FVHA 4WHLA 3RQ7A 3C5LA 5DMSA 4O56A 4YYPA 4X9RA 4WHKA 4DFWA 1UMWA 1Q4OA 2N19A 3HIHA 3P34A 5DNJA 4X9VA 2OJXA 3BZIA 4O9WA 4H71A 4RS6A 4E9DA 5J19A 4WHHA 4LKLA 4O6WA 4X9WA 4E67A 3HIKA 2OGQA 3P35A 4H5XA 3P2ZA 3P36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P37 A;  3Q1I A;  4LKM A;  1Q4K A;  4HCO A;  4RCP A;  5DMV C;  4HY2 A;  4XB0 A;  5LHZ A;  4E9C A;  3P2W A;  4HAB A;  4J7B B;  3FVH A;  4WHL A;  3RQ7 A;  3C5L A;  5DMS A;  4O56 A;  4YYP A;  4X9R A;  4WHK A;  4DFW A;  1UMW A;  1Q4O A;  2N19 A;  3HIH A;  3P34 A;  5DNJ A;  4X9V A;  2OJX A;  3BZI A;  4O9W A;  4H71 A;  4RS6 A;  4E9D A;  5J19 A;  4WHH A;  4LKL A;  4O6W A;  4X9W A;  4E67 A;  3HIK A;  2OGQ A;  3P35 A;  4H5X A;  3P2Z A;  3P36 A; 
#chains in the Genus database with same CATH topology
 3Q1I A;  1Q4K A;  4RCP A;  4FDI A;  1P49 A;  4CXS A;  3P2W A;  4G7N A;  3C5L A;  4X9R A;  5DAY A;  2IA9 A;  1HDH A;  3GYV A;  4H71 A;  5J19 A;  4E67 A;  4N9J A;  3P35 A;  5DNJ A;  4CXU A;  1AUK A;  1E2T A;  1F32 A;  1E1Z P;  5DMV C;  5LHZ A;  1F34 B;  3KDR A;  2I9Z A;  4WHL A;  5DMS A;  4YYP A;  4DFW A;  2VKZ G;  3HIH A;  1FSU A;  4NKB A;  4X9V A;  2OJX A;  4O9W A;  4N7Z A;  4E9D A;  4O6W A;  1A87 A;  4H5X A;  3P2Z A;  4WHK A;  3HMJ G;  3P37 A;  4N7V A;  5AJ9 A;  4NK7 A;  4HY2 A;  3LM3 A;  3HFD A;  4HAB A;  4J7B B;  1N2K A;  3FVH A;  4O56 A;  3ED4 A;  1E2S P;  1UMW A;  1Q4O A;  2N19 A;  3P34 A;  3BZI A;  4RS6 A;  1E3C P;  4X9W A;  3HIK A;  3FS3 A;  3GYW A;  4LKM A;  4HCO A;  1E33 P;  4XB0 A;  4E9C A;  2I9X A;  3RQ7 A;  1N2L A;  4FDJ A;  4CYR A;  3LXQ A;  4CYS A;  2QZU A;  2E50 A;  4CXK A;  2UV8 G;  4LKL A;  4WHH A;  2OGQ A;  3P36 A; 
#chains in the Genus database with same CATH homology
 3P37 A;  3Q1I A;  4LKM A;  1Q4K A;  4HCO A;  4RCP A;  5DMV C;  4HY2 A;  4XB0 A;  5LHZ A;  4E9C A;  3P2W A;  4HAB A;  4J7B B;  3FVH A;  4WHL A;  3RQ7 A;  3C5L A;  5DMS A;  4O56 A;  4YYP A;  4X9R A;  4WHK A;  4DFW A;  1UMW A;  1Q4O A;  2N19 A;  3HIH A;  3P34 A;  5DNJ A;  4X9V A;  2OJX A;  3BZI A;  4O9W A;  4H71 A;  4RS6 A;  4E9D A;  5J19 A;  4WHH A;  4LKL A;  4O6W A;  4X9W A;  4E67 A;  3HIK A;  2OGQ A;  3P35 A;  4H5X A;  3P2Z A;  3P36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...