4X9VA

Plk-1 polo-box domain in complex with bioactive imidazolium-containing phosphopeptide macrocycle 3c
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
217
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Neighbor-directed histidine N ( tau )-alkylation: A route to imidazolium-containing phosphopeptide macrocycles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
total genus 69
structure length 217
sequence length 224
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4x9vA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4x9vA01
5DNJA 5LHZA 1Q4OA 5DMVC 3BZIA 4HCOA 2OJXA 4X9WA 4E67A 3HIHA 4X9VA 4H5XA 3P34A 4WHLA 3P2WA 4XB0A 3P2ZA 3HIKA 4O6WA 4YYPA 4RS6A 3P36A 1Q4KA 4LKLA 4HABA 4H71A 4E9DA 3P37A 3P35A 4J7BB 4RCPA 2N19A 4HY2A 3Q1IA 3RQ7A 4DFWA 5DMSA 4O56A 4WHKA 3FVHA 4E9CA 4X9RA 4WHHA 2OGQA 4O9WA 4LKMA 1UMWA 5J19A 3C5LA
chains in the Genus database with same CATH superfamily
1FSUA 1Q4OA 4HCOA 4E67A 3HIHA 3P2WA 4O6WA 1F34B 4RS6A 4CXKA 3P35A 2UV8G 1N2KA 2E50A 3HFDA 3ED4A 4E9CA 4WHKA 5DAYA 5DMSA 3LXQA 1E1ZP 5LHZA 3GYVA 1HDHA 2OJXA 3P34A 4NKBA 4WHLA 4FDJA 3P2ZA 4YYPA 4HABA 3GYWA 4CXUA 4J7BB 3FS3A 4FDIA 4G7NA 2VKZG 1F32A 4O56A 4X9RA 4N7VA 4WHHA 1P49A 3LM3A 3HMJG 3BZIA 4X9WA 4H5XA 3HIKA 4NK7A 3P36A 1Q4KA 4LKLA 3P37A 4RCPA 1E2SP 3Q1IA 4CYSA 3FVHA 1E2TA 1AUKA 1E33P 1N2LA 2IA9A 2OGQA 4O9WA 5AJ9A 2QZUA 4LKMA 1E3CP 1UMWA 3C5LA 5DNJA 4CXSA 5DMVC 1A87A 4X9VA 4XB0A 4N9JA 2I9XA 2I9ZA 4H71A 4E9DA 3KDRA 2N19A 4HY2A 4CYRA 3RQ7A 4DFWA 4N7ZA 5J19A
chains in the Genus database with same CATH topology
5DNJA 5LHZA 1Q4OA 5DMVC 3BZIA 4HCOA 2OJXA 4X9WA 4E67A 3HIHA 4X9VA 4H5XA 3P34A 4WHLA 3P2WA 4XB0A 3P2ZA 3HIKA 4O6WA 4YYPA 4RS6A 3P36A 1Q4KA 4LKLA 4HABA 4H71A 4E9DA 3P37A 3P35A 4J7BB 4RCPA 2N19A 4HY2A 3Q1IA 3RQ7A 4DFWA 5DMSA 4O56A 4WHKA 3FVHA 4E9CA 4X9RA 4WHHA 2OGQA 4O9WA 4LKMA 1UMWA 5J19A 3C5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNJ A;  5LHZ A;  1Q4O A;  5DMV C;  3BZI A;  4HCO A;  2OJX A;  4X9W A;  4E67 A;  3HIH A;  4X9V A;  4H5X A;  3P34 A;  4WHL A;  3P2W A;  4XB0 A;  3P2Z A;  3HIK A;  4O6W A;  4YYP A;  4RS6 A;  3P36 A;  1Q4K A;  4LKL A;  4HAB A;  4H71 A;  4E9D A;  3P37 A;  3P35 A;  4J7B B;  4RCP A;  2N19 A;  4HY2 A;  3Q1I A;  3RQ7 A;  4DFW A;  5DMS A;  4O56 A;  4WHK A;  3FVH A;  4E9C A;  4X9R A;  4WHH A;  2OGQ A;  4O9W A;  4LKM A;  1UMW A;  5J19 A;  3C5L A; 
#chains in the Genus database with same CATH topology
 1FSU A;  1Q4O A;  4HCO A;  4E67 A;  3HIH A;  3P2W A;  4O6W A;  1F34 B;  4RS6 A;  4CXK A;  3P35 A;  2UV8 G;  1N2K A;  2E50 A;  3HFD A;  3ED4 A;  4E9C A;  4WHK A;  5DAY A;  5DMS A;  3LXQ A;  1E1Z P;  5LHZ A;  3GYV A;  1HDH A;  2OJX A;  3P34 A;  4NKB A;  4WHL A;  4FDJ A;  3P2Z A;  4YYP A;  4HAB A;  3GYW A;  4CXU A;  4J7B B;  3FS3 A;  4FDI A;  4G7N A;  2VKZ G;  1F32 A;  4O56 A;  4X9R A;  4N7V A;  4WHH A;  1P49 A;  3LM3 A;  3HMJ G;  3BZI A;  4X9W A;  4H5X A;  3HIK A;  4NK7 A;  3P36 A;  1Q4K A;  4LKL A;  3P37 A;  4RCP A;  1E2S P;  3Q1I A;  4CYS A;  3FVH A;  1E2T A;  1AUK A;  1E33 P;  1N2L A;  2IA9 A;  2OGQ A;  4O9W A;  5AJ9 A;  2QZU A;  4LKM A;  1E3C P;  1UMW A;  3C5L A;  5DNJ A;  4CXS A;  5DMV C;  1A87 A;  4X9V A;  4XB0 A;  4N9J A;  2I9X A;  2I9Z A;  4H71 A;  4E9D A;  3KDR A;  2N19 A;  4HY2 A;  4CYR A;  3RQ7 A;  4DFW A;  4N7Z A;  5J19 A; 
#chains in the Genus database with same CATH homology
 5DNJ A;  5LHZ A;  1Q4O A;  5DMV C;  3BZI A;  4HCO A;  2OJX A;  4X9W A;  4E67 A;  3HIH A;  4X9V A;  4H5X A;  3P34 A;  4WHL A;  3P2W A;  4XB0 A;  3P2Z A;  3HIK A;  4O6W A;  4YYP A;  4RS6 A;  3P36 A;  1Q4K A;  4LKL A;  4HAB A;  4H71 A;  4E9D A;  3P37 A;  3P35 A;  4J7B B;  4RCP A;  2N19 A;  4HY2 A;  3Q1I A;  3RQ7 A;  4DFW A;  5DMS A;  4O56 A;  4WHK A;  3FVH A;  4E9C A;  4X9R A;  4WHH A;  2OGQ A;  4O9W A;  4LKM A;  1UMW A;  5J19 A;  3C5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...