4X9VA

Plk-1 polo-box domain in complex with bioactive imidazolium-containing phosphopeptide macrocycle 3c
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
224
structure length
217
Chain Sequence
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
publication title Neighbor-directed histidine N ( tau )-alkylation: A route to imidazolium-containing phosphopeptide macrocycles.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 217
sequence length 224
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4x9vA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4x9vA01
4O6WA 2OJXA 4HABA 4H5XA 3P34A 3BZIA 4X9RA 4WHKA 4J7BB 3Q1IA 3RQ7A 4HY2A 4LKLA 5DNJA 4X9WA 4YYPA 1Q4KA 3C5LA 3HIHA 4O9WA 5LHZA 3HIKA 4H71A 4RCPA 5DMSA 4O56A 4HCOA 3P2ZA 4RS6A 1Q4OA 2OGQA 2N19A 4DFWA 4E9CA 5J19A 3P37A 4X9VA 3P36A 4LKMA 3FVHA 1UMWA 3P2WA 4WHHA 4E9DA 4WHLA 5DMVC 3P35A 4XB0A 4E67A
chains in the Genus database with same CATH superfamily
3BZIA 1F32A 1E2TA 3LXQA 4CXUA 2VKZG 5DMSA 4O56A 4HCOA 4RS6A 5J19A 1FSUA 4X9VA 1UMWA 5DMVC 4G7NA 5DAYA 4O6WA 4NK7A 2QZUA 4CXSA 4NKBA 3Q1IA 4LKLA 5DNJA 4X9WA 4YYPA 3GYWA 1Q4KA 3FS3A 4O9WA 4N9JA 4H71A 4RCPA 3HMJG 3P2ZA 4DFWA 3P37A 3FVHA 3KDRA 1E3CP 4N7VA 4CYSA 1A87A 4XB0A 4HABA 4H5XA 4CXKA 2I9XA 5AJ9A 3C5LA 3HIHA 5LHZA 1E2SP 2N19A 1E1ZP 1F34B 3LM3A 4E9CA 2IA9A 4E9DA 4WHLA 3HFDA 1HDHA 1E33P 3P35A 4FDJA 3ED4A 1P49A 2OJXA 2E50A 4N7ZA 3P34A 4X9RA 1N2KA 4WHKA 4J7BB 3RQ7A 4HY2A 1N2LA 4FDIA 3HIKA 1Q4OA 2OGQA 3GYVA 2UV8G 3P36A 4LKMA 4CYRA 3P2WA 4WHHA 2I9ZA 4E67A 1AUKA
chains in the Genus database with same CATH topology
4O6WA 2OJXA 4HABA 4H5XA 3P34A 3BZIA 4X9RA 4WHKA 4J7BB 3Q1IA 3RQ7A 4HY2A 4LKLA 5DNJA 4X9WA 4YYPA 1Q4KA 3C5LA 3HIHA 4O9WA 5LHZA 3HIKA 4H71A 4RCPA 5DMSA 4O56A 4HCOA 3P2ZA 4RS6A 1Q4OA 2OGQA 2N19A 4DFWA 4E9CA 5J19A 3P37A 4X9VA 3P36A 4LKMA 3FVHA 1UMWA 3P2WA 4WHHA 4E9DA 4WHLA 5DMVC 3P35A 4XB0A 4E67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6W A;  2OJX A;  4HAB A;  4H5X A;  3P34 A;  3BZI A;  4X9R A;  4WHK A;  4J7B B;  3Q1I A;  3RQ7 A;  4HY2 A;  4LKL A;  5DNJ A;  4X9W A;  4YYP A;  1Q4K A;  3C5L A;  3HIH A;  4O9W A;  5LHZ A;  3HIK A;  4H71 A;  4RCP A;  5DMS A;  4O56 A;  4HCO A;  3P2Z A;  4RS6 A;  1Q4O A;  2OGQ A;  2N19 A;  4DFW A;  4E9C A;  5J19 A;  3P37 A;  4X9V A;  3P36 A;  4LKM A;  3FVH A;  1UMW A;  3P2W A;  4WHH A;  4E9D A;  4WHL A;  5DMV C;  3P35 A;  4XB0 A;  4E67 A; 
#chains in the Genus database with same CATH topology
 3BZI A;  1F32 A;  1E2T A;  3LXQ A;  4CXU A;  2VKZ G;  5DMS A;  4O56 A;  4HCO A;  4RS6 A;  5J19 A;  1FSU A;  4X9V A;  1UMW A;  5DMV C;  4G7N A;  5DAY A;  4O6W A;  4NK7 A;  2QZU A;  4CXS A;  4NKB A;  3Q1I A;  4LKL A;  5DNJ A;  4X9W A;  4YYP A;  3GYW A;  1Q4K A;  3FS3 A;  4O9W A;  4N9J A;  4H71 A;  4RCP A;  3HMJ G;  3P2Z A;  4DFW A;  3P37 A;  3FVH A;  3KDR A;  1E3C P;  4N7V A;  4CYS A;  1A87 A;  4XB0 A;  4HAB A;  4H5X A;  4CXK A;  2I9X A;  5AJ9 A;  3C5L A;  3HIH A;  5LHZ A;  1E2S P;  2N19 A;  1E1Z P;  1F34 B;  3LM3 A;  4E9C A;  2IA9 A;  4E9D A;  4WHL A;  3HFD A;  1HDH A;  1E33 P;  3P35 A;  4FDJ A;  3ED4 A;  1P49 A;  2OJX A;  2E50 A;  4N7Z A;  3P34 A;  4X9R A;  1N2K A;  4WHK A;  4J7B B;  3RQ7 A;  4HY2 A;  1N2L A;  4FDI A;  3HIK A;  1Q4O A;  2OGQ A;  3GYV A;  2UV8 G;  3P36 A;  4LKM A;  4CYR A;  3P2W A;  4WHH A;  2I9Z A;  4E67 A;  1AUK A; 
#chains in the Genus database with same CATH homology
 4O6W A;  2OJX A;  4HAB A;  4H5X A;  3P34 A;  3BZI A;  4X9R A;  4WHK A;  4J7B B;  3Q1I A;  3RQ7 A;  4HY2 A;  4LKL A;  5DNJ A;  4X9W A;  4YYP A;  1Q4K A;  3C5L A;  3HIH A;  4O9W A;  5LHZ A;  3HIK A;  4H71 A;  4RCP A;  5DMS A;  4O56 A;  4HCO A;  3P2Z A;  4RS6 A;  1Q4O A;  2OGQ A;  2N19 A;  4DFW A;  4E9C A;  5J19 A;  3P37 A;  4X9V A;  3P36 A;  4LKM A;  3FVH A;  1UMW A;  3P2W A;  4WHH A;  4E9D A;  4WHL A;  5DMV C;  3P35 A;  4XB0 A;  4E67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...