1AUZA

Solution structure of spoiiaa, a phosphorylatable component of the system that regulates transcription factor sigma-f of bacillus subtilis, nmr, 24 structures
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
116
structure length
116
Chain Sequence
SLGIDMNVKESVLCIRLTGELDHHTAETLKQKVTQSLEKDDIRHIVLNLEDLSFMDSSGLGVILGRYKQIKQIGGEMVVCAISPAVKRLFDMSGLFKIIRFEQSEQQALLTLGVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords SPOIIAA
publication title Solution structure of SpoIIAA, a phosphorylatable component of the system that regulates transcription factor sigmaF of Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 19
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 1997-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1auzA00
3IH9A 2KA5A 2KLNA 5EUSA 1TH8B 1H4YA 3NY7A 3ZTBA 5EUZA 3AGEA 1TILB 3IHAA 1H4XA 1BUZA 4DGHA 1T6RA 5EUUA 3AGDA 3OIRA 2VY9A 3IHBA 1SBOA 4HYLA 1TIDB 4QTPA 1H4ZA 5EZBA 3IH8A 3ZXNA 3IF5A 5EUXA 1VC1A 4XS5A 3LLOA 3OIZA 3LKLA 3MGLA 3F43A 1AUZA 1THNB 3T6OA 5EUWA 4DGFA
chains in the Genus database with same CATH superfamily
1TH8B 2DXLA 3AGEA 2CWWA 1BUZA 4AE2A 3LDFA 3OIRA 4QTPA 4DGFA 3GVKA 3QDQA 1BPLA 3T6OA 1WXXA 1J7XA 1FCFA 4GHNA 3IH9A 3VSEA 5EUSA 1FC9A 2AS0A 1N6EA 3ZTBA 5EUZA 1V0EA 1TILB 3DUPA 1FC7A 1H4XA 1WXWA 4DGHA 5EUUA 3GVJA 3IHBA 4HYLA 4HIZA 3GK7A 1VC1A 3OIZA 3D03A 4JC0A 1THNB 4AEJA 5EUWA 1N6FA 2KA5A 3V8VA 3C0KA 1K32A 2DXNA 1H4YA 1V0FA 3IHAA 2OASA 3JU4A 3AGDA 2VY9A 1TIDB 3D3UA 1H4ZA 5EZBA 3IH8A 5EUXA 3LKLA 3V97A 4DMGA 1N6DA 3EH7A 2ZO9B 2KLNA 1FC6A 3DJAA 3NY7A 3GHFA 3DORA 2ZOAA 1T6RA 3K50A 4L1CA 1SBOA 2RRLA 3ZXNA 3IF5A 1HF2A 3GMFA 4XS5A 3LLOA 2B78A 3MGLA 3MOGA 3F43A 1AUZA 4L8KA 3GVLA
chains in the Genus database with same CATH topology
3IH9A 2KA5A 2KLNA 5EUSA 1TH8B 1H4YA 3NY7A 3ZTBA 5EUZA 3AGEA 1TILB 3IHAA 1H4XA 1BUZA 4DGHA 1T6RA 5EUUA 3AGDA 3OIRA 2VY9A 3IHBA 1SBOA 4HYLA 1TIDB 4QTPA 1H4ZA 5EZBA 3IH8A 3ZXNA 3IF5A 5EUXA 1VC1A 4XS5A 3LLOA 3OIZA 3LKLA 3MGLA 3F43A 1AUZA 1THNB 3T6OA 5EUWA 4DGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH9 A;  2KA5 A;  2KLN A;  5EUS A;  1TH8 B;  1H4Y A;  3NY7 A;  3ZTB A;  5EUZ A;  3AGE A;  1TIL B;  3IHA A;  1H4X A;  1BUZ A;  4DGH A;  1T6R A;  5EUU A;  3AGD A;  3OIR A;  2VY9 A;  3IHB A;  1SBO A;  4HYL A;  1TID B;  4QTP A;  1H4Z A;  5EZB A;  3IH8 A;  3ZXN A;  3IF5 A;  5EUX A;  1VC1 A;  4XS5 A;  3LLO A;  3OIZ A;  3LKL A;  3MGL A;  3F43 A;  1AUZ A;  1THN B;  3T6O A;  5EUW A;  4DGF A; 
#chains in the Genus database with same CATH topology
 1TH8 B;  2DXL A;  3AGE A;  2CWW A;  1BUZ A;  4AE2 A;  3LDF A;  3OIR A;  4QTP A;  4DGF A;  3GVK A;  3QDQ A;  1BPL A;  3T6O A;  1WXX A;  1J7X A;  1FCF A;  4GHN A;  3IH9 A;  3VSE A;  5EUS A;  1FC9 A;  2AS0 A;  1N6E A;  3ZTB A;  5EUZ A;  1V0E A;  1TIL B;  3DUP A;  1FC7 A;  1H4X A;  1WXW A;  4DGH A;  5EUU A;  3GVJ A;  3IHB A;  4HYL A;  4HIZ A;  3GK7 A;  1VC1 A;  3OIZ A;  3D03 A;  4JC0 A;  1THN B;  4AEJ A;  5EUW A;  1N6F A;  2KA5 A;  3V8V A;  3C0K A;  1K32 A;  2DXN A;  1H4Y A;  1V0F A;  3IHA A;  2OAS A;  3JU4 A;  3AGD A;  2VY9 A;  1TID B;  3D3U A;  1H4Z A;  5EZB A;  3IH8 A;  5EUX A;  3LKL A;  3V97 A;  4DMG A;  1N6D A;  3EH7 A;  2ZO9 B;  2KLN A;  1FC6 A;  3DJA A;  3NY7 A;  3GHF A;  3DOR A;  2ZOA A;  1T6R A;  3K50 A;  4L1C A;  1SBO A;  2RRL A;  3ZXN A;  3IF5 A;  1HF2 A;  3GMF A;  4XS5 A;  3LLO A;  2B78 A;  3MGL A;  3MOG A;  3F43 A;  1AUZ A;  4L8K A;  3GVL A; 
#chains in the Genus database with same CATH homology
 3IH9 A;  2KA5 A;  2KLN A;  5EUS A;  1TH8 B;  1H4Y A;  3NY7 A;  3ZTB A;  5EUZ A;  3AGE A;  1TIL B;  3IHA A;  1H4X A;  1BUZ A;  4DGH A;  1T6R A;  5EUU A;  3AGD A;  3OIR A;  2VY9 A;  3IHB A;  1SBO A;  4HYL A;  1TID B;  4QTP A;  1H4Z A;  5EZB A;  3IH8 A;  3ZXN A;  3IF5 A;  5EUX A;  1VC1 A;  4XS5 A;  3LLO A;  3OIZ A;  3LKL A;  3MGL A;  3F43 A;  1AUZ A;  1THN B;  3T6O A;  5EUW A;  4DGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...